(data stored in ACNUC8465 zone)

HOGENOMDNA: BURCH_3

ID   BURCH_3; SV 1; empty ; DNA; empty ; PRO; 1055417 BP.
XX
AC   NC_008544;
XX
PR   Project: 58369;
XX
DE   Burkholderia cenocepacia HI2424 chromosome 3, complete sequence.
XX
OS   Burkholderia cenocepacia HI2424
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1055417
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Kim,E., LiPuma,J.J., Gonzalez,C.F., Konstantinidis,K., Tiedje,J.M. and
RA   Richardson,P.;
RT   "Complete sequence of Chromosome 3 of Burkholderia cenocepacia HI2424";
RL   Unpublished
XX
RN   [2]
RP   1-1055417
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (26-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1055417
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Kim,E., LiPuma,J.J., Gonzalez,C.F., Konstantinidis,K., Tiedje,J.M. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (30-AUG-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000460.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635681
CC   Source DNA and bacteria available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1055417
FT                   /strain="HI2424"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia cenocepacia HI2424"
FT                   /chromosome="3"
FT                   /db_xref="taxon:331272"
FT   gene            complement(49..240)
FT                   /db_xref="GeneID:4454579"
FT                   /locus_tag="Bcen2424_5867"
FT   CDS_pept        complement(49..240)
FT                   /locus_tag="Bcen2424_5867"
FT                   /gene_family="HOG000248595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp/Fap pilin component"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: bcn:Bcen_5503
FT                   Flp/Fap pilin component"
FT                   /db_xref="GI:116686246"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="GeneID:4454579"
FT                   /translation="MSKFIQQVGRFVRDEDGVTAIEYGLIAALIAIGIIAALSTVGKDL
FT                   KTVFTTIADDLDSAVAAI"
FT                   /protein_id="YP_839493.1"
FT   misc_feature    complement(58..219)
FT                   /note="Flp/Fap pilin component; Region: Flp_Fap; cl01585"
FT                   /db_xref="CDD:120751"
FT                   /locus_tag="Bcen2424_5867"
FT   gene            complement(380..571)
FT                   /db_xref="GeneID:4454580"
FT                   /locus_tag="Bcen2424_5868"
FT   CDS_pept        complement(380..571)
FT                   /locus_tag="Bcen2424_5868"
FT                   /gene_family="HOG000248595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Flp/Fap pilin component"
FT                   /transl_table="11"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: bcn:Bcen_5504
FT                   Flp/Fap pilin component"
FT                   /db_xref="GI:116686247"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="GeneID:4454580"
FT                   /translation="MSRIIEKIAWFVEDQDGVTAIEYGLIAALIAIGIVGALTTVGTDL
FT                   KTVFNTVADDLDSVVAAI"
FT                   /protein_id="YP_839494.1"
FT   gene            743..1084
FT                   /db_xref="GeneID:4454581"
FT                   /locus_tag="Bcen2424_5869"
FT   CDS_pept        743..1084
FT                   /locus_tag="Bcen2424_5869"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116686248"
FT                   /db_xref="GeneID:4454581"
FT                   /translation="MYGSTGRMNRASRATGTARLPFDAWNSVEREMNSRQSCNVSLTRL
FT                   AIRDVLWSFIFIPHVPPCRFLIARKLSGLVGRSTTVAAVDRPGAAYSPTRSSPSFPQVI
FT                   REPVPLLFA"
FT                   /protein_id="YP_839495.1"
FT   gene            1621..2859
FT                   /db_xref="GeneID:4454582"
FT                   /locus_tag="Bcen2424_5870"
FT   CDS_pept        1621..2859
FT                   /locus_tag="Bcen2424_5870"
FT                   /gene_family="HOG000165186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5506 hypothetical protein"
FT                   /db_xref="GI:116686249"
FT                   /db_xref="GeneID:4454582"
FT                   /translation="MYTANRGTRDRAIRCAQWLTADRIIPYSCIMLMLFAALVIVWGVV
FT                   TNGFTSNATARPGTDFSVFWTASHLVLQGHAASAYDASSFVQAEFAHFGAFLQHRPLPW
FT                   LYPPTMLLFIAPVALVPFLPAYFLFFAGSLLCYALAVSRLSGLRAHLPVPRAAMVVVIA
FT                   YSAVCMSALFGQNSILTAGLAALALHLLGKRPVLAGVLIGLLAIKPQLAVVFPFVLIAT
FT                   RAWRTFAAAAISATLFAAAGVALAGPAALHGLARAMSTVREQHFMLASYWLASPTPFAA
FT                   LRLAGAPVAAALAAQAAVALLAIAAAVSVWRRTHDMRLRGAVLAVATLLTTPYLWHYEL
FT                   TWLGIAIFCLIAHGLDEGWLPGDQGILVIAWLLPIFEMFNRLMKLPQIGPVVLLAVLFV
FT                   VVRRTALASRGKQ"
FT                   /protein_id="YP_839496.1"
FT   misc_feature    1930..>2277
FT                   /note="Protein of unknown function (DUF2029); Region:
FT                   DUF2029; cl09812"
FT                   /db_xref="CDD:175042"
FT                   /locus_tag="Bcen2424_5870"
FT   gene            2856..4235
FT                   /db_xref="GeneID:4454583"
FT                   /locus_tag="Bcen2424_5871"
FT   CDS_pept        2856..4235
FT                   /locus_tag="Bcen2424_5871"
FT                   /gene_family="HOG000165186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5507 hypothetical protein"
FT                   /db_xref="GI:116686250"
FT                   /db_xref="GeneID:4454583"
FT                   /translation="MKAPSFARHAHSAIDVHPELPIAGPRRHPHWLNRDRVRVYAAAVL
FT                   LTELLFIGLYLIRVILSKHGVLEPLSPDFSPIWSAAWLAAHGHGADAWHYATLFAIEKS
FT                   AVPTITLANGTQPWLYPPTMLLLVLPLGWLPYTLALVLWLGITYALFAATIHATVQRDA
FT                   AWLCALAFPGAFLTVIVGQTSLFTATLAAVGLLALNRRPVCAGICFGLLTMKPQLAVLF
FT                   PLALLCAGQWRALAAWAATIAVSALLATLAFGVGPWVAFAHVIADVYAIVGTGRAQLAR
FT                   MPTLFALATMAGWPALVARGLQLLSAAVAAIAVVYAWRGACSYALRAATLACACLLVSP
FT                   YLYDYDLTWYGIVIAWYARYALTRGWRRFDREWLMLLWPMPLAGLAVVPHLSFQFMPLV
FT                   TLASLALLVSRIAQERRDVPSMPDARDTSTETGFAHPSRAHHRPAHGMRRTGRPTLGAG
FT                   R"
FT                   /protein_id="YP_839497.1"
FT   misc_feature    3270..3827
FT                   /note="Protein of unknown function (DUF2029); Region:
FT                   DUF2029; cl09812"
FT                   /db_xref="CDD:175042"
FT                   /locus_tag="Bcen2424_5871"
FT   gene            4260..5303
FT                   /db_xref="GeneID:4454584"
FT                   /locus_tag="Bcen2424_5872"
FT   CDS_pept        4260..5303
FT                   /locus_tag="Bcen2424_5872"
FT                   /gene_family="HOG000283247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_5508 glycosyl transferase, family 2"
FT                   /db_xref="GI:116686251"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:4454584"
FT                   /translation="MRESIYTPLVSLVVPFYNEGEAVERFFDVVIPLLSAIDAIRFEIV
FT                   CVNDGSRDDTLERLVRIGAAERRVRVIDLTRNFGKEAALTAGLDEAAGDAVIPLDADLQ
FT                   DPPSLIPVMIEHWRDGAEVVAAKRSNRACDSFAKRTAAALYYRVHNLLSDVKLPENVGD
FT                   FRLMDRKVVNALRNLPERHRFMKGLFAWVGYKTVIVEYQRDPRSAGHSKFSGWKLWNFA
FT                   LEGITSFSTVPLRSWTYIGVGIAALAFVYGAFIILRTLLFGNPVLGYASLISVTLFIGG
FT                   IELIGIGVVGEYVGRIYDESKQRPVYLIRRRYQAHGKVIELPVARDARRQPARRRAQPV
FT                   RARIGAR"
FT                   /protein_id="YP_839498.1"
FT   misc_feature    4293..4841
FT                   /note="Bacterial DPM1_like enzymes are related to
FT                   eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen2424_5872"
FT   misc_feature    order(4302..4304,4308..4310,4563..4565)
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen2424_5872"
FT   misc_feature    order(4404..4406,4560..4565)
FT                   /note="Putative Catalytic site; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen2424_5872"
FT   misc_feature    4557..4565
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133030"
FT                   /locus_tag="Bcen2424_5872"
FT   gene            5316..5699
FT                   /db_xref="GeneID:4454585"
FT                   /locus_tag="Bcen2424_5873"
FT   CDS_pept        5316..5699
FT                   /locus_tag="Bcen2424_5873"
FT                   /gene_family="HOG000155113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GtrA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: GtrA family protein; KEGG: bcn:Bcen_5509
FT                   GtrA-like protein"
FT                   /db_xref="GI:116686252"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="GeneID:4454585"
FT                   /translation="MSTLLQAERTRLVRFGVSGLCSTAIHVLVATALFARLDAAPVTAN
FT                   AIAFLCATAFSYLANTLWSFSSTVRTRNAIRFLAVMLAGFVETMLIARAAEALDAPRAM
FT                   GVVAIALLIPPTTFVLHRLWTYR"
FT                   /protein_id="YP_839499.1"
FT   misc_feature    5355..5693
FT                   /note="GtrA-like protein; Region: GtrA; cl00971"
FT                   /db_xref="CDD:154117"
FT                   /locus_tag="Bcen2424_5873"
FT   gene            5995..6498
FT                   /db_xref="GeneID:4454586"
FT                   /locus_tag="Bcen2424_5874"
FT   CDS_pept        5995..6498
FT                   /locus_tag="Bcen2424_5874"
FT                   /gene_family="HOG000266303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5510 hypothetical protein"
FT                   /db_xref="GI:116686253"
FT                   /db_xref="GeneID:4454586"
FT                   /translation="MSRVTDVLVSFDTETILKKYPNPSKNPAAPTLIDWRYVYMVTNQD
FT                   NVISGQAGGELDLKAQVGDLIRWRETSLSLGFENQVVFYKFIGNVGNDLISTPTPRVAE
FT                   ASIPVPNTSKPEVPTCQKVANYYWSSECLKVGRVTYHFQFQIIDRNCQSQGCFSWDPFI
FT                   SIHN"
FT                   /protein_id="YP_839500.1"
FT   misc_feature    5995..6492
FT                   /note="Inclusion body protein; Region: PixA; pfam12306"
FT                   /db_xref="CDD:152741"
FT                   /locus_tag="Bcen2424_5874"
FT   gene            6564..7103
FT                   /db_xref="GeneID:4454587"
FT                   /locus_tag="Bcen2424_5875"
FT   CDS_pept        6564..7103
FT                   /locus_tag="Bcen2424_5875"
FT                   /gene_family="HOG000266315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5511 hypothetical protein"
FT                   /db_xref="GI:116686254"
FT                   /db_xref="GeneID:4454587"
FT                   /translation="MSGVRCDALAIVDAVTLLSAYPDASRDADVPTVIDGRHIYVLSPG
FT                   DAGQVSHNDNRLFAGLSPGDQLRLRETALALRAEVTVLFVRFALKDAGIVTPLEAEIRD
FT                   AATPVPDGDDLLHPSCRPMKDHFWHSEVLAPGTTTCTADFAVLDRDGAVSGYFRWETTI
FT                   EIAGSRPDTKRPDVKP"
FT                   /protein_id="YP_839501.1"
FT   misc_feature    6567..7061
FT                   /note="Inclusion body protein; Region: PixA; pfam12306"
FT                   /db_xref="CDD:152741"
FT                   /locus_tag="Bcen2424_5875"
FT   gene            complement(7176..8117)
FT                   /db_xref="GeneID:4454588"
FT                   /locus_tag="Bcen2424_5876"
FT   CDS_pept        complement(7176..8117)
FT                   /locus_tag="Bcen2424_5876"
FT                   /gene_family="HOG000190583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5512 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="GI:116686255"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4454588"
FT                   /translation="MSRPAFAVTRIARVLAAALIAGSAVAAHAASFDLSPEQPARQRGA
FT                   VNPAVEQALPAGFRFAEANTLTIGIAPNLPPLSTYATDARTVVGFDPDLAQLIADSVGR
FT                   KLKIVPLAWADWPLALQSGKVDAVISNVTVTEQRKEKFDFSTYRKDQLGFYVKTGSKLA
FT                   AIREPKDVAGLRVVTDSGTNQEKILLEWNRQNVARGLAPVEIQYYADAAERWVALQSGR
FT                   VDTIFSVNSMLAYQASLRGDAKLIGTVSGGWPRTADIAITTRKGSGLADPLTLAINALI
FT                   ANGSYRKALDHWQLDAEAIERSQTNPPGLPRT"
FT                   /protein_id="YP_839502.1"
FT   sig_peptide     complement(8028..8117)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT                   /locus_tag="Bcen2424_5876"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(7239..7922)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5876"
FT   misc_feature    complement(7239..7922)
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="Bcen2424_5876"
FT   misc_feature    complement(order(7431..7433,7569..7571,7704..7706,
FT                   7779..7781,7896..7898))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5876"
FT   misc_feature    complement(order(7452..7454,7470..7472,7482..7484))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5876"
FT   misc_feature    complement(order(7338..7343,7350..7361))
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5876"
FT   gene            complement(8204..9325)
FT                   /db_xref="GeneID:4454589"
FT                   /locus_tag="Bcen2424_5877"
FT   CDS_pept        complement(8204..9325)
FT                   /locus_tag="Bcen2424_5877"
FT                   /gene_family="HOG000266326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5513 hypothetical protein"
FT                   /db_xref="GI:116686256"
FT                   /db_xref="GeneID:4454589"
FT                   /translation="MTYLADARIALTAAESAHIRQTLGALAYDPAGGAGYISAVRKLAY
FT                   NAFPDRIVDAFDRAKAPTADAHGSIEIDNLPIDDDVKGSPRFEETGRSFKAGVLSENVL
FT                   VALSTLAGEPYSIAHEGRELVNNLTPHKATARDYTGLGSEVELDFHIENAAQAHMPEGD
FT                   TSPFALLLLGVRSEAGGGPYTRLADARRALQLLSPDDIAQLYGEHYIIRVPYRWRGAAP
FT                   TPRDNTDLSAVLSGPLDAPRVTVAFYPDMVLAVNTRAQEALANLYRAVREVSFGVQVSP
FT                   GKLVLINNHFTLHSRDRFDPQYDENDRAFRWVQRVFVARSLWNFRAFTPLQARVFDPKA
FT                   LYAGESVQARQPSPVVQPAPQRAAAVELEATPA"
FT                   /protein_id="YP_839503.1"
FT   misc_feature    complement(8366..>8692)
FT                   /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
FT                   trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
FT                   carrying out three reactions in the biosynthesis of
FT                   clavulanic acid, an inhibitor of class A serine
FT                   beta-lactamases. In general, Fe(II)-2OG...; Region:
FT                   CAS_like; cl00184"
FT                   /db_xref="CDD:174021"
FT                   /locus_tag="Bcen2424_5877"
FT   gene            9720..11171
FT                   /db_xref="GeneID:4454590"
FT                   /locus_tag="Bcen2424_5878"
FT   CDS_pept        9720..11171
FT                   /locus_tag="Bcen2424_5878"
FT                   /gene_family="HOG000239124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5514 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:116686257"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4454590"
FT                   /translation="MSDRAPTLDRIDRGDHMPTAAADSRRTSLRAIFPTVAAASLGFAI
FT                   VQLDVTVVNVAIPSLGHAFGSSIHGLQWIVDAYTLSFAALLLTSGTLADRFGSRRLFAY
FT                   GLALFLLASLGCALAPSLVTLVAARVAQGVGAAMILPTSLALITHACANDAAARVRAVA
FT                   WWSATGGAISAAGPTLGGLLIDSLGWRAIFFINLPICALGLWLTLRHVRDSAAARTRLF
FT                   DPAGQFVAVLVLGLLTGGIIRAGAHGLGDPYAAGALIASAVLGVLFVAIERRVAAPMLQ
FT                   LALFRLPRVPGVLAIGAVTNAAFYGLIFSLSVYFQNACGFTATESGLALAPLTIIMLAN
FT                   IASARLAVRYGFRATVIIGLAVSLAGYVWLWQTLAAHTPYLLLAPGLAAMAIGGGIAIP
FT                   ALTSTMLGSVEAGRSGTASAILNTARQVGAAIGVAALGALVAGQGAAIVAGAARAFVIA
FT                   AVLVAICVVLAVRWPRDASATGTRA"
FT                   /protein_id="YP_839504.1"
FT   misc_feature    9825..>10346
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5878"
FT   misc_feature    9831..10997
FT                   /note="drug resistance transporter, EmrB/QacA subfamily;
FT                   Region: efflux_EmrB; TIGR00711"
FT                   /db_xref="CDD:129794"
FT                   /locus_tag="Bcen2424_5878"
FT   misc_feature    order(9867..9869,9876..9884,9888..9893,9942..9944,
FT                   9951..9956,9963..9965,9975..9980,9984..9989,10125..10130,
FT                   10137..10142,10149..10154,10161..10163,10197..10202,
FT                   10209..10214,10230..10232)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5878"
FT   gene            11224..12492
FT                   /db_xref="GeneID:4454591"
FT                   /locus_tag="Bcen2424_5879"
FT   CDS_pept        11224..12492
FT                   /locus_tag="Bcen2424_5879"
FT                   /gene_family="HOG000266337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: bcn:Bcen_5515
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="GI:116686258"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:4454591"
FT                   /translation="MQHRFIDTVLIVDGASTAAYLAPAFRAYGIRCAHVISDPDLPEIY
FT                   RNQFVPSDYIRQVQHRGDIDATLAQLSDLRIGAVLHGLDAALELADTLAERLDVPSRNP
FT                   LATSAARRDKFAMNERIRQAGLRAPAHFHSTSVDEALDWARAHGTLPLVVKPARSAGVA
FT                   GVKICRTLAQVEAAARDVLATRSLYNQPNDDIVIQSYSEGQEYIVDSVSFEGRHRVVSL
FT                   WEVHRDRTHAPRLDKMLVLNHADPRYAPLLDYAANVLDALDVRFGPTHLELFDTADGPT
FT                   IVELNARLHGSLDPRLTSAVSGENHVSAAVEAVLHPERLFGDVTAPTDFRGYCGHVLLL
FT                   SSRNGVLRQDFTWQAIQALPSFVGLKQWIKVGDTLRVTTDLQTALGTVGLYSPTFERLL
FT                   EDCRRIREIEADFFADEGAVAPA"
FT                   /protein_id="YP_839505.1"
FT   misc_feature    11245..12462
FT                   /note="hypothetical protein; Provisional; Region: PRK07206"
FT                   /db_xref="CDD:168858"
FT                   /locus_tag="Bcen2424_5879"
FT   misc_feature    11593..>11862
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen2424_5879"
FT   gene            complement(12501..13376)
FT                   /db_xref="GeneID:4454592"
FT                   /locus_tag="Bcen2424_5880"
FT   CDS_pept        complement(12501..13376)
FT                   /locus_tag="Bcen2424_5880"
FT                   /gene_family="HOG000233521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5516 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686259"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454592"
FT                   /translation="MNIPLLETFRAVVQEGSALRAAERLGCTQSNVTARLRQLEESLDA
FT                   PLFDRHGKRLVLNDAGRRLIPYCDRILRLVDEATQVVRETPVARSFRLGSMESTAATRL
FT                   PALAAALKERDPALGLAVQIGSEPDLAEALLRGRIDAALTARAVVRPGLRYEPAFAEDM
FT                   VLVSAATVTRRQLLADNTVRLLAFHDGCPYRAVAEHWLKARGIAIESVSSFGTFGAILG
FT                   CVAAGMGVAILPKRITTEHVARKEVRTHAFDDLDSVTTYLVTPDEAPALPELDALRAVL
FT                   GRQAGALLAR"
FT                   /protein_id="YP_839506.1"
FT   misc_feature    complement(12504..13376)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen2424_5880"
FT   misc_feature    complement(13191..13364)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5880"
FT   misc_feature    complement(12534..13109)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen2424_5880"
FT   misc_feature    complement(order(12699..12704,12708..12713,12729..12746,
FT                   13005..13025,13029..13031,13041..13043,13050..13055,
FT                   13059..13064))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen2424_5880"
FT   gene            13524..14468
FT                   /db_xref="GeneID:4454593"
FT                   /locus_tag="Bcen2424_5881"
FT   CDS_pept        13524..14468
FT                   /locus_tag="Bcen2424_5881"
FT                   /gene_family="HOG000266348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5517 hypothetical protein"
FT                   /db_xref="GI:116686260"
FT                   /db_xref="GeneID:4454593"
FT                   /translation="MRALIAALVRRGPTVLACGVGLGLLVPPLAALARPLMPVTVFVFV
FT                   LGTLLRVEPSAVRAVARRPAVSLLLPAMTMIACPVALGIAARLAGLPYDWVVALVIAYC
FT                   APPSSGTSTIARMLSLDASVALVATLASMVFVPLTAPLLTAWFSHDAAVSISPSSLALR
FT                   LALLIGSAEGVALLVRRFAGARLARHATPIDAVVVVALLIFALGTMAGMQQSIIDAPHR
FT                   ALTAIALAFVVNAGFQLVAYGLTPGDVRTRLNVALIVANRNVGLMWAALGLAATPTMTL
FT                   VFACAQLPIYTLPRVVQHLLPRLEAQRLRRRAR"
FT                   /protein_id="YP_839507.1"
FT   sig_peptide     13524..13625
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.945 at
FT                   residue 34"
FT                   /locus_tag="Bcen2424_5881"
FT                   /product="hypothetical protein"
FT   gene            14506..15717
FT                   /db_xref="GeneID:4454594"
FT                   /locus_tag="Bcen2424_5882"
FT   CDS_pept        14506..15717
FT                   /locus_tag="Bcen2424_5882"
FT                   /gene_family="HOG000266359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; KEGG: bcn:Bcen_5518
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="GI:116686261"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:4454594"
FT                   /translation="MKRLIVIGARATGSSVALVRAAVARRVAVTVITTPGHRLDGVFPD
FT                   DVETVNLTPDAGQLAGWLRARFPDELDTLRVTTAHDTYARTAAWVADALGLPGPDARHV
FT                   AYAVSKSNQKALLAEHGIPAAQFVAGTLAAPAALAAAAAPLRFPVVVKPSEGSASDGVR
FT                   RCEDIAAVRAQLDTLAAAAQADAPELATERVVIEEFLAGSEYCVEYFDGRYVGALRKLK
FT                   RHGAGFLERGYTSELDLDADTLRALIDVGTRATAAAGLTWGPVHLDCIVHDGVPHVIEL
FT                   NPRIAGSFICDIVRDGYGFNVVEALLDKLDGKAVTIPELFEPHAYARAEFLLDSDPGAW
FT                   RFARGGEIDDGAVRISYGPQVLPDRERRAFLYVRVALPAAHGAADDAGPAAERRELKST
FT                   TESA"
FT                   /protein_id="YP_839508.1"
FT   sig_peptide     14506..14571
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.694 at
FT                   residue 22"
FT                   /locus_tag="Bcen2424_5882"
FT                   /product="hypothetical protein"
FT   misc_feature    14764..>15117
FT                   /note="phosphoribosylamine--glycine ligase; Provisional;
FT                   Region: PRK00885"
FT                   /db_xref="CDD:167091"
FT                   /locus_tag="Bcen2424_5882"
FT   misc_feature    14947..15369
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen2424_5882"
FT   misc_feature    <15292..>15486
FT                   /note="Predicted ATP-dependent carboligase related to
FT                   biotin carboxylase [General function prediction only];
FT                   Region: COG2232"
FT                   /db_xref="CDD:32413"
FT                   /locus_tag="Bcen2424_5882"
FT   gene            complement(15701..16897)
FT                   /db_xref="GeneID:4454595"
FT                   /locus_tag="Bcen2424_5883"
FT   CDS_pept        complement(15701..16897)
FT                   /locus_tag="Bcen2424_5883"
FT                   /gene_family="HOG000217197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5519 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:116686262"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4454595"
FT                   /translation="MGNRTIRFAFFLCGFAAFLNLYSTQGILHELAAAFNVSAERAGQG
FT                   ISATTLAVAIIAPFVGALAARFDRRTVISWAAVACVLPVVWSAHAASFSSFLAARFAAG
FT                   MLMPFIFAISIACIGEIFSHDAATEVSALFVAGTTLGGFAGRFVTNVLTSGFGWRHALD
FT                   FIAFLCLATGLAIHACLPSSGAARPEGEGASIPRWKLLTRGPLLASFLVGACVLASQVA
FT                   TFTFVGLRLARAPFGFNTVEIGAIYAVFLVAVVVTPLAGRVAAKRGPRDLALAATGLAM
FT                   VGALLTLSGSVAAILTGLALSSTAVFVEQASANAFISRAAPGARSTAIGVYLSFYYFGG
FT                   SLGSILPVPAWNRWGWVGCVAFVVVAQAIAGALVFFFWRGTPPAGASKPRSPEVRLTR"
FT                   /protein_id="YP_839509.1"
FT   sig_peptide     complement(16826..16897)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.600 at
FT                   residue 24"
FT                   /locus_tag="Bcen2424_5883"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(15764..16834)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5883"
FT   misc_feature    complement(order(15878..15880,15887..15892,15899..15904,
FT                   15911..15916,15944..15946,15953..15958,15968..15970,
FT                   15977..15982,15989..15991,16127..16129,16139..16141,
FT                   16157..16159,16169..16171,16214..16216,16223..16228,
FT                   16235..16240,16247..16249,16472..16474,16490..16495,
FT                   16502..16507,16541..16543,16550..16555,16562..16567,
FT                   16574..16579,16715..16720,16724..16729,16739..16741,
FT                   16748..16753,16760..16762,16811..16816,16820..16828))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5883"
FT   misc_feature    complement(15740..16822)
FT                   /note="Arabinose efflux permease [Carbohydrate transport
FT                   and metabolism]; Region: AraJ; COG2814"
FT                   /db_xref="CDD:32643"
FT                   /locus_tag="Bcen2424_5883"
FT   gene            16993..17883
FT                   /db_xref="GeneID:4454596"
FT                   /locus_tag="Bcen2424_5884"
FT   CDS_pept        16993..17883
FT                   /locus_tag="Bcen2424_5884"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5520 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686263"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454596"
FT                   /translation="MLDLRRLRYFVTVAEELHFGRAALRLRIAQPPLTRHIAALEADLD
FT                   IRLFERSTRAVQLTPAGALFLEHARSVIHAVDEAEATARKMAQGMVGRVVIGYASSIPM
FT                   SDAFSDIIRNASRSMPEVELAFREVSTATQRQQIANGTMDVGFGWSAKAPGERIRSLVV
FT                   SRESLVAAVPARSKYADKATIEFRELVKENFVTFPAGYGSALNAALEDLCAQEGVTPRT
FT                   RPTASQITTLVSLVAAERGVAIVPGFTSTLQRSGVAYVPLARPHVLELVVTWSEPFSSS
FT                   CVEQFIEFARSITRG"
FT                   /protein_id="YP_839510.1"
FT   misc_feature    16996..17853
FT                   /note="DNA-binding transcriptional regulator HcaR;
FT                   Provisional; Region: PRK09906"
FT                   /db_xref="CDD:170151"
FT                   /locus_tag="Bcen2424_5884"
FT   misc_feature    17002..17178
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5884"
FT   misc_feature    17269..17862
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen2424_5884"
FT   misc_feature    order(17284..17286,17308..17310,17317..17322,17326..17331,
FT                   17338..17340,17362..17364,17368..17370,17374..17376,
FT                   17509..17511,17611..17616,17671..17676,17692..17697,
FT                   17701..17706,17758..17760)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen2424_5884"
FT   misc_feature    order(17287..17289,17437..17439,17581..17586,17605..17607)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="Bcen2424_5884"
FT   gene            complement(17950..18564)
FT                   /db_xref="GeneID:4454597"
FT                   /locus_tag="Bcen2424_5885"
FT   CDS_pept        complement(17950..18564)
FT                   /locus_tag="Bcen2424_5885"
FT                   /gene_family="HOG000266370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NIPSNAP family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   bcn:Bcen_5521 hypothetical protein"
FT                   /db_xref="GI:116686264"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="GeneID:4454597"
FT                   /translation="MPYELTTLSCPLLDQDRVSRRAHHWVSDADAHGRLLGAWRTEIGE
FT                   LSRVVVLRGFETMDALQHERDRALRAERPFGIESASVRLTMESYALFPFLPDIEPAALG
FT                   DFYEIRRYWLKAGGIAPTISAWERAVGPAKAYTSHLVCNLYALDGPPRITHIWGFSSLE
FT                   ERMALRKRHYAEGLWPPAGGPEQIERATSTIGLPETWSPLR"
FT                   /protein_id="YP_839511.1"
FT   misc_feature    complement(<18358..>18480)
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="Bcen2424_5885"
FT   misc_feature    complement(17959..18246)
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="Bcen2424_5885"
FT   gene            18661..19581
FT                   /db_xref="GeneID:4454598"
FT                   /locus_tag="Bcen2424_5886"
FT   CDS_pept        18661..19581
FT                   /locus_tag="Bcen2424_5886"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5522 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686265"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454598"
FT                   /translation="MDLLKAMAVFVRIVETGSLTAAAQASDLSPTMVGNYLQTLESRLG
FT                   AVLVHRTTRKQKVSAFGHAYYERCVEILGLVDDTEQLALAHLKQPRGRLRVTAPVVFTN
FT                   ECLIPALADYYRRYPEIKLDIVATDSLADLFDEGFEAAIRIGTLANPDVVARPLAPYRL
FT                   VLCASPAYVHEHGAPATPHALGEHHCLTYAYPPRAEWHAAQTQWTLEGPDGPMSLSVDG
FT                   RLKIDNADALRRAALRGLGIAMLPSILIRDDIREKRLIEIMPDFAGPERTMNLLYLQER
FT                   QQSPKLRSFTEFVVDRFGAETACRT"
FT                   /protein_id="YP_839512.1"
FT   misc_feature    18670..19569
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen2424_5886"
FT   misc_feature    18670..18849
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5886"
FT   misc_feature    18934..19542
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen2424_5886"
FT   misc_feature    order(18982..18987,18991..18996,19003..19005,19015..19017,
FT                   19021..19041,19327..19344,19360..19365,19369..19374)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen2424_5886"
FT   gene            complement(19765..19989)
FT                   /db_xref="GeneID:4454599"
FT                   /locus_tag="Bcen2424_5887"
FT   CDS_pept        complement(19765..19989)
FT                   /locus_tag="Bcen2424_5887"
FT                   /gene_family="HOG000218303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5523 hypothetical protein"
FT                   /db_xref="GI:116686266"
FT                   /db_xref="GeneID:4454599"
FT                   /translation="MHNKRIQQYNGYAVQPSAHRLPDGSFSSNLLLERADSTHDEGRYQ
FT                   FYSLDYFTSEAQALAHSARWARNWVDSRG"
FT                   /protein_id="YP_839513.1"
FT   gene            complement(20265..20468)
FT                   /db_xref="GeneID:4454600"
FT                   /locus_tag="Bcen2424_5888"
FT   CDS_pept        complement(20265..20468)
FT                   /locus_tag="Bcen2424_5888"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcn:Bcen_5524 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="GI:116686267"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="GeneID:4454600"
FT                   /translation="MDTGIVKWFNDSKGFGFITPDKGGDDLFAHFSEIRADGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPL"
FT                   /protein_id="YP_839514.1"
FT   misc_feature    complement(20271..20462)
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen2424_5888"
FT   misc_feature    complement(order(20298..20300,20385..20387,20418..20420,
FT                   20445..20447))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen2424_5888"
FT   misc_feature    complement(order(20379..20390,20409..20429))
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bcen2424_5888"
FT   gene            complement(20776..21879)
FT                   /db_xref="GeneID:4454601"
FT                   /locus_tag="Bcen2424_5889"
FT   CDS_pept        complement(20776..21879)
FT                   /locus_tag="Bcen2424_5889"
FT                   /gene_family="HOG000028073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcn:Bcen_5525
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="GI:116686268"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4454601"
FT                   /translation="MIHGVNGLDVHILEAGHESAGRPLALLLHGFPDLAYGWRHLMPIL
FT                   ADAGYHVVAPDQRGYGRTTGWANDYDAPLGPFSLLNMTRDALGLVSALGYRHTSMLVGH
FT                   DLGSPVAAYCALARPDVFPSVVLMSAPFPGPPALPFDTARSETSSAQPNSEGRKLAAAL
FT                   AALDPPRAYYQQYLCTRNANRDMWHPPQGLSAFLRAFFHVKSADWPGNKPHPLKALTAS
FT                   ELAQMPTYYVMDLGKTMPETVAPFQPSAAEILACKWLTDAELGVYTAEYGRTGFQGALQ
FT                   AYRVLSDPDLNAELRLFSGRTIDVPSLFIGGKRDWGTYSAPGALDLMRTKAATSMRGIE
FT                   LIDGAGHWIQQEQPGKLGELLLAFAKA"
FT                   /protein_id="YP_839515.1"
FT   misc_feature    complement(<21685..21831)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen2424_5889"
FT   misc_feature    complement(<21481..21732)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen2424_5889"
FT   misc_feature    complement(20779..>21111)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Bcen2424_5889"
FT   gene            22087..22716
FT                   /db_xref="GeneID:4454602"
FT                   /locus_tag="Bcen2424_5890"
FT   CDS_pept        22087..22716
FT                   /locus_tag="Bcen2424_5890"
FT                   /gene_family="HOG000161263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_5526
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:116686269"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:4454602"
FT                   /translation="MAIAIDRSSGTWYFSRMTRKTDARARAIATAERLFRIQGYTATGL
FT                   TQILEESGAPKGSFYFHFPRGKAQLAEEAIDNYVTHRIAVLRNISADTTGHALNFVRQI
FT                   FSTFAAEMVATDFQYGCLMQNLANELPALDAELTQRVARGFADSTEVIAAHFRGCGFAA
FT                   ARASSAAAALVAALEGARTVARLERSPAVFDALADVSSQGWGASEG"
FT                   /protein_id="YP_839516.1"
FT   misc_feature    22132..>22515
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Bcen2424_5890"
FT   misc_feature    22168..22308
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Bcen2424_5890"
FT   gene            complement(23072..23992)
FT                   /db_xref="GeneID:4454603"
FT                   /locus_tag="Bcen2424_5891"
FT   CDS_pept        complement(23072..23992)
FT                   /locus_tag="Bcen2424_5891"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5527 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686270"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454603"
FT                   /translation="MDNNATMPADLPDLKLLQLFDLLYDVRSVTRVAEQLGQSQPTVSI
FT                   WLGHLREHLHDPLFIRTPGGMAPTPQADALIGPCREILESLRRFTAWEIAFDPATAQRR
FT                   FRICMTDASHVTLLPRLLAHVRAQAPGVRLEAARIDGNTERALESGEADLAIGYVPWLG
FT                   GGIYQQKLYDQDWICLVNRHHPRIRGRLGARQYRSEGHVAITAGTGAQLLEQALRQARI
FT                   ERDVVLELPGFLGLGAIVQTTDLITTLPRHIGETLAQANDLAVHACPIPVEGFAVRQHW
FT                   HARYHHEAGNRWLRGVVIRLFGASH"
FT                   /protein_id="YP_839517.1"
FT   misc_feature    complement(23078..23914)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen2424_5891"
FT   misc_feature    complement(23777..>23914)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5891"
FT   misc_feature    complement(23087..23683)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators that are involved in the
FT                   catabolism of dinitrotoluene, naphthalene and
FT                   gamma-hexachlorohexane; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_DntR_NahR_LinR_like; cd08459"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen2424_5891"
FT   misc_feature    complement(order(23162..23164,23363..23365,23471..23473,
FT                   23642..23644,23654..23659,23663..23665))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen2424_5891"
FT   misc_feature    complement(order(23225..23227,23267..23269,23276..23281,
FT                   23288..23293,23300..23314,23393..23395,23579..23581,
FT                   23585..23599,23603..23608,23615..23620,23624..23629,
FT                   23636..23641,23648..23653,23660..23662))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176148"
FT                   /locus_tag="Bcen2424_5891"
FT   gene            24074..25024
FT                   /db_xref="GeneID:4454604"
FT                   /locus_tag="Bcen2424_5892"
FT   CDS_pept        24074..25024
FT                   /locus_tag="Bcen2424_5892"
FT                   /gene_family="HOG000050222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bcn:Bcen_5528 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein"
FT                   /db_xref="GI:116686271"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="GeneID:4454604"
FT                   /translation="MKIAILGAGALGCAIGATLTEGGHETWLIDRSPAHVDAMRRDGLR
FT                   VDDARGTRQVRVHATTQAAEVGAADVVVVLVKSFHTDAAIRGALSLVGPDTVVLSLQNG
FT                   LGHEDILSDAVGRERVLAGKTYVGGVLRGPGHIESGVIGKNTYIGELDGRITPRVQAIA
FT                   AAFDTAGLATTISDNIVGTMWDKLLVNVATGALTGLTGLTYGQLYDEPLLKATSLAAVA
FT                   EAIAAAQAAGVKLSMTDPEQAWTLAAEGLPAAFKTSMLQSLEKGSITEIDFINGSVVRA
FT                   GQRHGVPTPVNATLVACIKGLERAMADRQREEAAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_839518.1"
FT   sig_peptide     24074..24136
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.444 at
FT                   residue 21"
FT                   /locus_tag="Bcen2424_5892"
FT                   /product="hypothetical protein"
FT   misc_feature    24134..24985
FT                   /note="2-dehydropantoate 2-reductase; Reviewed; Region:
FT                   PRK06522"
FT                   /db_xref="CDD:168592"
FT                   /locus_tag="Bcen2424_5892"
FT   misc_feature    24134..24532
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5892"
FT   misc_feature    24605..24982
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="Bcen2424_5892"
FT   gene            25021..25413
FT                   /db_xref="GeneID:4454605"
FT                   /locus_tag="Bcen2424_5893"
FT   CDS_pept        25021..25413
FT                   /locus_tag="Bcen2424_5893"
FT                   /gene_family="HOG000266381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcn:Bcen_5529
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:116686272"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR011588"
FT                   /db_xref="GeneID:4454605"
FT                   /translation="MSATKAYLEHVAIWVKDIHWHIRFFEDVLGMTLREVDGPLDAPRQ
FT                   YWTLGGMQFIHAPDHNGPEGRLAHLGVMCEDLEAALAAARRFDVTEMPQGRNWIRLPDG
FT                   LAVELIQARPASCVAQALAINPRAEA"
FT                   /protein_id="YP_839519.1"
FT   misc_feature    25048..25347
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cd06587"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen2424_5893"
FT   misc_feature    order(25048..25050,25060..25062,25150..25152,25225..25227,
FT                   25336..25338,25342..25344)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen2424_5893"
FT   misc_feature    order(25048..25050,25225..25227,25342..25344)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Bcen2424_5893"
FT   gene            25416..25874
FT                   /db_xref="GeneID:4454606"
FT                   /locus_tag="Bcen2424_5894"
FT   CDS_pept        25416..25874
FT                   /locus_tag="Bcen2424_5894"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bcn:Bcen_5530 MaoC-like dehydratase"
FT                   /db_xref="GI:116686273"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="GeneID:4454606"
FT                   /translation="MTIVEKYWDDAREGDTCTSPTYLVTKERILAYADLTGDHTPVHVD
FT                   EEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVT
FT                   FRVGSMRASKSRPDWGIVVLPSELINQDGQVVQRGEHRLMVPRRPEAL"
FT                   /protein_id="YP_839520.1"
FT   misc_feature    25470..25847
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
FT                   Catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway.  The structure
FT                   of the monomer includes a five-strand antiparallel...;
FT                   Region: R_hydratase_like; cd03441"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen2424_5894"
FT   misc_feature    order(25512..25514,25527..25529,25533..25535,25542..25544,
FT                   25587..25589,25596..25601)
FT                   /note="active site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen2424_5894"
FT   misc_feature    order(25527..25529,25533..25535,25542..25544,25596..25598)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48036"
FT                   /locus_tag="Bcen2424_5894"
FT   gene            25874..27094
FT                   /db_xref="GeneID:4454607"
FT                   /locus_tag="Bcen2424_5895"
FT   CDS_pept        25874..27094
FT                   /locus_tag="Bcen2424_5895"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bcn:Bcen_5531 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:116686274"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:4454607"
FT                   /translation="MQARPLEGIRVVDYSHFLAGPYVGRCLAALGAEVIKVERPGAGDA
FT                   GRQHATVLDDQQSGYFLQLNMGKRGVSVNMKDARGKAFMQRLCDSADVFIENYRPGALD
FT                   KLGLGYEELSARNPGLVYCSISAYGHTGPDAHRAGFGLIAEAKSGIMQMVGTPGERPPL
FT                   LRISLGDMYTGIHAVAAINAALLGRVKSGRGQHVDMALYDTLVSMHEYAVQCYTLKGVL
FT                   PEQTGHDMPTSTLYGVFRAADGDLVIAAQVDDAWKRFAQLIEAHGGPAGFGADSRFHDS
FT                   TGRNAHRAAILSVVEPWVAARSVASVLDLLDGIDVPCAKVQRIDEVLNDPQIQARGMVV
FT                   EQQHPRYGTLRLPNLPFRFSDCDTTIREVAPDLGQHNAEVARSLGFDAAEIDAMQADGV
FT                   LYSKVSQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_839521.1"
FT   misc_feature    25880..27073
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:176929"
FT                   /locus_tag="Bcen2424_5895"
FT   misc_feature    25886..27091
FT                   /note="crotonobetainyl-CoA:carnitine CoA-transferase;
FT                   Provisional; Region: PRK03525"
FT                   /db_xref="CDD:167542"
FT                   /locus_tag="Bcen2424_5895"
FT   gene            27091..27927
FT                   /db_xref="GeneID:4454608"
FT                   /locus_tag="Bcen2424_5896"
FT   CDS_pept        27091..27927
FT                   /locus_tag="Bcen2424_5896"
FT                   /gene_family="HOG000237876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: bcn:Bcen_5532 shikimate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="GI:116686275"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="GeneID:4454608"
FT                   /translation="MMTDQYAVIGNPIGHTKSPLIHGLFAQETQQDLRYTAIEGPLEPA
FT                   GAFAATVRAFFDGGGKGINVTAPFKLDAFAMSDERSERAQLAGAANALKFDGGRILADN
FT                   FDGIGLVRDIEANLNLPMAGKRVLVLGAGGAARGALLPFLDAGPAELVIANRDVDKARL
FT                   LAAQVAGRGPLVAGSYADLARMGRFDLVVNATSASLTGDLPPVPPSVFSPTGTAYELAY
FT                   GKRLTPFLRLAKNAGVHGIADGVGMLVEQAAEAFAWWRGVRPATSAVIDRLAVPFD"
FT                   /transl_table="11"
FT                   /protein_id="YP_839522.1"
FT   misc_feature    27091..27909
FT                   /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
FT                   PRK00258"
FT                   /db_xref="CDD:166875"
FT                   /locus_tag="Bcen2424_5896"
FT   misc_feature    27112..27363
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="Bcen2424_5896"
FT   misc_feature    27406..27873
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen2424_5896"
FT   misc_feature    order(27406..27408,27754..27756,27832..27834,27841..27843)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen2424_5896"
FT   misc_feature    order(27484..27486,27493..27495,27553..27558,27670..27678,
FT                   27748..27750,27820..27822,27829..27834)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Bcen2424_5896"
FT   gene            28105..29337
FT                   /db_xref="GeneID:4454609"
FT                   /locus_tag="Bcen2424_5897"
FT   CDS_pept        28105..29337
FT                   /locus_tag="Bcen2424_5897"
FT                   /gene_family="HOG000143170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5533 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:116686276"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4454609"
FT                   /translation="MPDTTRPARLNFALMLPLLLAAQPVATDSYLPALPEIAATLGSAS
FT                   VSLTVFALIFGVGQLPMGGLSDRIGRRPVLLTGLALYALSALAAALASSAAMLVAARAM
FT                   QGFAMAAILVCARATVRDRYSAGDGPYVMARGFMGMGMMAFLAPILGAYVTQHAGWRWV
FT                   LAGMSLYAFGLLVMCWYGFEESAARIAPGRNSTGDVREIFGNVPFRVWTLLAASTYTGM
FT                   FCFLLLSPTIYIRQLGISPQRYGWIPASGTLVYVLSTVGCRHLLRRQSMLRTVRQGATL
FT                   SLSGAVIQALGCALLPGSIWPLLVGHGVYCLGHGIHQPCGQAGAVSGLPHLAGRAVSWS
FT                   GFIMMFFAFSVGQTAAVFTDPRYQSGAWPMVVPMLGVGVTLVTIAFVWLPRIGGANLGA
FT                   AAVPARAVDGR"
FT                   /protein_id="YP_839523.1"
FT   sig_peptide     28105..28188
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.561 at
FT                   residue 28"
FT                   /locus_tag="Bcen2424_5897"
FT                   /product="hypothetical protein"
FT   misc_feature    28174..29250
FT                   /note="drug resistance transporter, Bcr/CflA subfamily;
FT                   Region: efflux_Bcr_CflA; TIGR00710"
FT                   /db_xref="CDD:162006"
FT                   /locus_tag="Bcen2424_5897"
FT   misc_feature    28180..29262
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5897"
FT   misc_feature    order(28183..28185,28192..28200,28204..28209,28246..28248,
FT                   28255..28260,28267..28269,28279..28284,28288..28293,
FT                   28429..28434,28441..28446,28453..28458,28465..28467,
FT                   28501..28506,28513..28518,28534..28536,28759..28761,
FT                   28768..28773,28780..28785,28792..28794,28834..28836,
FT                   28846..28848,28858..28860,28867..28869,28879..28881,
FT                   29035..29037,29044..29049,29056..29058,29068..29073,
FT                   29080..29082,29110..29115,29122..29127,29134..29139,
FT                   29146..29148)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5897"
FT   gene            complement(29451..30278)
FT                   /db_xref="GeneID:4454610"
FT                   /locus_tag="Bcen2424_5898"
FT   CDS_pept        complement(29451..30278)
FT                   /locus_tag="Bcen2424_5898"
FT                   /gene_family="HOG000266392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bcn:Bcen_5534 methyltransferase type 11"
FT                   /db_xref="GI:116686277"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:4454610"
FT                   /translation="MTSYAEIYLKDFHRRRAGVTRRAYGNRPARSAQAAYPSSYHALAN
FT                   RVPNDAMSRTVLDLACGDGPLLQILNDRGHAATKLIGIDMSDGELSVARGILPHEIRLL
FT                   NERAQAMSLDSGSVDYVLSHMALMLMDDIEQVVREIRRVLCDGGSFSAIVGRSFLTGKV
FT                   GEVFLDIFKPIAKDRLTELRLGDARTRSEAGWQELLKPDFVDVSFEDIEIDWTPTPEQL
FT                   WLDMLDTYDADRMSEAARAQFKSELLSAFAPLQGEDGTLQTGWGLRLVQATAA"
FT                   /protein_id="YP_839524.1"
FT   misc_feature    complement(29829..30116)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen2424_5898"
FT   misc_feature    complement(order(29907..29909,29955..29963,30024..30029,
FT                   30084..30104))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcen2424_5898"
FT   gene            complement(30565..31467)
FT                   /db_xref="GeneID:4454611"
FT                   /locus_tag="Bcen2424_5899"
FT   CDS_pept        complement(30565..31467)
FT                   /locus_tag="Bcen2424_5899"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   bcn:Bcen_5535 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="GI:116686278"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="GeneID:4454611"
FT                   /translation="MKQQIGLIGVGLMGHGIARNVLKHGYPLTVVEHPGNQPLDELLRD
FT                   GVRTVRTARELAAQADVIILCVTGSPEVEAVLTGDDGVLAGLRDNAIVVDCSTAVPEST
FT                   VRMARLVEAAGGRFVDAPMTRGAKEAHEGRLNLLVGAPPGLFAEIRPVLACFAENITCV
FT                   GDVGAGHSMKLLHNYVSLGTIALLSEAVACAKRSGVDVAVLADVLANGGGGGAALNRLR
FT                   PFLETGDTSALPFHMANALKDLSYYSAMAEGVDAAHGIAAAVTETYRDAVAGAGAHCPV
FT                   LKLSDVLMVGGVGDEGTSR"
FT                   /protein_id="YP_839525.1"
FT   misc_feature    complement(30649..31458)
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Bcen2424_5899"
FT   misc_feature    complement(<30937..31458)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5899"
FT   gene            complement(31525..32853)
FT                   /db_xref="GeneID:4454612"
FT                   /locus_tag="Bcen2424_5900"
FT   CDS_pept        complement(31525..32853)
FT                   /locus_tag="Bcen2424_5900"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5536 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:116686279"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4454612"
FT                   /translation="MEIDAACNPGDLAAPASAHDLAQEDRIFRRLAVQILPILMFAYVT
FT                   SYIDRVNVSFAKLQMSEHLGFSDAVFGFGAGIFFLGYVIFEVPSNMLLVRVGPRRWITR
FT                   IVVSWGVVSGLTAFVSTPMQFYVMRFLLGVAEAGFIPAIVLYMARSFPGRRRARILSMF
FT                   YAALALAGLIGSPLTGFILQYFDGAMQIPGWKWIFILESLPAFVAALYVWKGLDDDVTR
FT                   SERFSQAERAVLARVLAEDRATTESVNHRGLFSNWLVWAFCVIYFLDVFAIYGYTFWAP
FT                   TMIKQMGIGSDFVIGLLAALPNAVAVVVMVLFGRSADRCGRQRLHVAALLLMGATGLGL
FT                   SVVWHDQLWLGMFALCIANAGLISFPPLFWSMPTAALGTASVSMGIAVISSFGNLGGFF
FT                   GPYAVGYLKQASGSLAAPLFVMVGCLLLGIVLTMLLPARLVDR"
FT                   /protein_id="YP_839526.1"
FT   misc_feature    complement(31573..32781)
FT                   /note="4-hydroxyphenylacetate permease; Region: HpaX;
FT                   TIGR02332"
FT                   /db_xref="CDD:131385"
FT                   /locus_tag="Bcen2424_5900"
FT   misc_feature    complement(31546..32748)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5900"
FT   misc_feature    complement(order(31663..31665,31672..31677,31684..31689,
FT                   31696..31701,31732..31734,31741..31746,31756..31758,
FT                   31765..31770,31777..31779,31924..31926,31936..31938,
FT                   31945..31947,31957..31959,31969..31971,32011..32013,
FT                   32020..32025,32032..32037,32044..32046,32341..32343,
FT                   32359..32364,32371..32376,32410..32412,32419..32424,
FT                   32431..32436,32443..32448,32584..32589,32593..32598,
FT                   32608..32610,32617..32622,32629..32631,32680..32685,
FT                   32689..32697,32704..32706))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5900"
FT   gene            complement(32870..33181)
FT                   /db_xref="GeneID:4454613"
FT                   /locus_tag="Bcen2424_5901"
FT   CDS_pept        complement(32870..33181)
FT                   /locus_tag="Bcen2424_5901"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116686280"
FT                   /db_xref="GeneID:4454613"
FT                   /translation="MVLTLTRSDRPRMVRRTPQRRRRAAKARAVRAIGGRNPFSVGLCI
FT                   APYDGGPRVRSRYSKCHLKDFAYRVGGAAGRFEPSPVAHIYIDSDCTRDDASMHAGHP"
FT                   /protein_id="YP_839527.1"
FT   gene            33249..34169
FT                   /db_xref="GeneID:4454614"
FT                   /locus_tag="Bcen2424_5902"
FT   CDS_pept        33249..34169
FT                   /locus_tag="Bcen2424_5902"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5537 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686281"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454614"
FT                   /translation="MFDLTSLALFVRAAELGSLSRAAQQSHMSLSTASRRIALLEHHFR
FT                   VVLLNRTVAGVELTPAGEALLRHATDLLLRTDAIYSELSDYTKGAVGRVRVFANISAIS
FT                   QDLPDQLRTFSQRYRDIKLQISELRSSDILQALREGRADVGIVTSRTAPEGIHLAPYCM
FT                   DRASVVVPDDYPLTGDSIDFSALLDHDLVALDDRSELTRALVREAALLGKSVRFRVQVQ
FT                   SFEAMCRLIAAGQGIGILPERAVALFREPMRLRFIRLNDPWANRVMSVGIRAGAVPLPT
FT                   RKLFEFLASFAPPSLVSGEAGQSND"
FT                   /protein_id="YP_839528.1"
FT   misc_feature    33252..34124
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcen2424_5902"
FT   misc_feature    33258..33437
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5902"
FT   misc_feature    33525..34112
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen2424_5902"
FT   misc_feature    order(33570..33575,33579..33584,33591..33593,33603..33605,
FT                   33609..33629,33900..33917,33933..33938,33942..33947)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen2424_5902"
FT   gene            34472..35575
FT                   /db_xref="GeneID:4454615"
FT                   /locus_tag="Bcen2424_5903"
FT   CDS_pept        34472..35575
FT                   /locus_tag="Bcen2424_5903"
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="KEGG: bcn:Bcen_5538 tartrate dehydrogenase; TIGRFAM:
FT                   tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="GI:116686282"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="GeneID:4454615"
FT                   /translation="MKNPHRIAVIAGDGIGKEVMPEGLRVLRAAAARFDIPLAFDEFGD
FT                   WCTDHYVRHGTMMPADWARQIGAHDAIFFGAVGAPDIVPDHVAVWESLIKIRREFDQYV
FT                   NLRPVRLMPGVPAPLAGRQPGDIDFIVVRENTEGEYSSVGGRMFTGTDREIAVQQSVFS
FT                   RVGVDRVLRFAFELARSRPRKQLTAATKSNGISITMPFWDERLAEMARSFPDIETRKYH
FT                   IDILCAHFVQNPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERRFPSLFEP
FT                   VHGSAPDIAGRGIANPIGQIWSAALLLQHLGRGESRYEAAAAEIVAAIESVLIAGPRTR
FT                   DMGGTASTEELGAAIAHTIANPASIEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_839529.1"
FT   misc_feature    34472..35548
FT                   /note="Isocitrate/isopropylmalate dehydrogenase; Region:
FT                   Iso_dh; cl00445"
FT                   /db_xref="CDD:174206"
FT                   /locus_tag="Bcen2424_5903"
FT   gene            35579..37027
FT                   /db_xref="GeneID:4454616"
FT                   /locus_tag="Bcen2424_5904"
FT   CDS_pept        35579..37027
FT                   /locus_tag="Bcen2424_5904"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bcn:Bcen_5539
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="GI:116686283"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4454616"
FT                   /translation="MQFDHYIGNARVVPNTGERIDVVDPSTGEPFATIARGDATDVQRA
FT                   VSAAQRAMGDTLDGPWAKLSPVERSNLLFAYAAAVSQHADELAQLEARDTGKALNTART
FT                   DAAVLARYLQYYAGCVDKLHGDTLPYTAGFTVLTVREPIGVTGHIIPWNYPMQIYGRSV
FT                   GASLAAGNACVVKPAEDASLSILRLAEIAAEVGFPAGTVNVVTGLGGEAGAALSAHPGI
FT                   RHISFTGSTGTGALVGRAAAERHCPAVLELGGKSPQLLFDDADLDQALPVIVNAIVQNA
FT                   GQTCSAGSRLLVQRTVYERVLDRLAQQFERLRSGPPSMNLEMGPLVNAKQHARVRAIVE
FT                   RAQADGIRVAARGTIAAGASGAGYYQEAVLFRDVPPDSELAQEEVFGPVLAAMPFDDED
FT                   AAVALANGTQYGLVAGVWTRDGARALRLARKLQAGQVFINNYGAGGGVELPFGGVKASG
FT                   YGREKGFEALLGFTALKTIAIRHD"
FT                   /transl_table="11"
FT                   /protein_id="YP_839530.1"
FT   misc_feature    35585..37012
FT                   /note="1-pyrroline-5-carboxylate dehydrogenase;
FT                   Provisional; Region: PRK03137"
FT                   /db_xref="CDD:167499"
FT                   /locus_tag="Bcen2424_5904"
FT   misc_feature    35642..37015
FT                   /note="Uncharacterized Saccharopolyspora spinosa aldehyde
FT                   dehydrogenase (AAS00426)-like; Region: ALDH_AAS00426;
FT                   cd07109"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen2424_5904"
FT   misc_feature    order(36023..36037,36059..36061,36104..36106,36110..36115,
FT                   36257..36268,36275..36277,36284..36289,36329..36337,
FT                   36431..36433,36728..36730,36734..36736,36812..36814,
FT                   36929..36931)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen2424_5904"
FT   misc_feature    order(36035..36037,36329..36331,36422..36424,36431..36433)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen2424_5904"
FT   misc_feature    order(36329..36331,36422..36424,36431..36433)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143427"
FT                   /locus_tag="Bcen2424_5904"
FT   gene            complement(37307..38245)
FT                   /db_xref="GeneID:4454617"
FT                   /locus_tag="Bcen2424_5905"
FT   CDS_pept        complement(37307..38245)
FT                   /locus_tag="Bcen2424_5905"
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: bcn:Bcen_5540 cysteine synthase"
FT                   /db_xref="GI:116686284"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="GeneID:4454617"
FT                   /translation="MKSTPGSILDTIGNTSLVPLRHVVPKNGARLFVKLESQNPTGSMK
FT                   DRIALAMIEAPERDGRLKPGGAVVEYTGGSTGVSLALVCAVKRHPLHLVSSDAFSKEKL
FT                   DHMRLLGAELTLVPSDNGKQTGKLTKDMIREAHRIAGETGAYITAQMENTDQLDAYTKM
FT                   ADEIWEQTGGRLDGFVQSVGTAASLRGISRRLREHDARIRIAGVEPAESAVLSGGSTGA
FT                   HKIDGIGAGYVVPLWRDGIADELERVSTEDARAMAFRLAAEEGLFCGTSTGANVTGALR
FT                   LAERLGPDATIVTIMCDTGMKYLKSFAQTMG"
FT                   /transl_table="11"
FT                   /protein_id="YP_839531.1"
FT   misc_feature    complement(37334..38227)
FT                   /note="Cysteine synthase [Amino acid transport and
FT                   metabolism]; Region: CysK; COG0031"
FT                   /db_xref="CDD:30381"
FT                   /locus_tag="Bcen2424_5905"
FT   misc_feature    complement(37334..38209)
FT                   /note="CBS_like: This subgroup includes Cystathionine
FT                   beta-synthase (CBS) and Cysteine synthase. CBS is a unique
FT                   heme-containing enzyme that catalyzes a pyridoxal
FT                   5'-phosphate (PLP)-dependent condensation of serine and
FT                   homocysteine to give cystathionine...; Region: CBS_like;
FT                   cd01561"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen2424_5905"
FT   misc_feature    complement(order(37334..37336,37343..37345,37373..37375,
FT                   37445..37453,37457..37465,37736..37741,37916..37921,
FT                   37928..37933,37940..37945,37991..37993,38000..38002,
FT                   38126..38128,38132..38134,38150..38152,38189..38197))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen2424_5905"
FT   misc_feature    complement(order(37352..37357,37433..37435,37565..37567,
FT                   37685..37702,38021..38023,38111..38113))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen2424_5905"
FT   misc_feature    complement(38111..38113)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107204"
FT                   /locus_tag="Bcen2424_5905"
FT   gene            complement(38292..38699)
FT                   /db_xref="GeneID:4454618"
FT                   /locus_tag="Bcen2424_5906"
FT   CDS_pept        complement(38292..38699)
FT                   /locus_tag="Bcen2424_5906"
FT                   /gene_family="HOG000168796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG)"
FT                   /transl_table="11"
FT                   /note="PFAM: membrane-associated proteins in eicosanoid and
FT                   glutathione metabolism (MAPEG); KEGG: bcn:Bcen_5541
FT                   membrane-associated proteins in eicosanoid and glutathione
FT                   metabolism (MAPEG)"
FT                   /db_xref="GI:116686285"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="GeneID:4454618"
FT                   /translation="MTFSPELHLLTLTAIATLLMWIPYMLARIMTRGLMAALSNPDPSH
FT                   PPDPPWAERARRAHANAIENLAVFAPLVLMCAMTGASSPATVFSARLYLGARLVHYVVY
FT                   AAGIPVVRTIAFLTGFAATLTFAVALLGHAT"
FT                   /protein_id="YP_839532.1"
FT   misc_feature    complement(38358..>38549)
FT                   /note="MAPEG family; Region: MAPEG; cl09190"
FT                   /db_xref="CDD:158449"
FT                   /locus_tag="Bcen2424_5906"
FT   gene            complement(38922..39788)
FT                   /db_xref="GeneID:4454619"
FT                   /locus_tag="Bcen2424_5907"
FT   CDS_pept        complement(38922..39788)
FT                   /locus_tag="Bcen2424_5907"
FT                   /gene_family="HOG000221953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NmrA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NmrA family protein; KEGG: bcn:Bcen_5542
FT                   NmrA-like"
FT                   /db_xref="GI:116686286"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="GeneID:4454619"
FT                   /translation="MYAITGITGKVGGALARELLASGRPVRAVVRDATRAAAWAARGCE
FT                   IATAFMEAPALLADAFAGATGVFILLPPVFDPAPGFPEARKVIEAVSAALLKARPDRVV
FT                   CLSTIGAQADEPNLLTQLALMEQALREMPMPVTFLRPGWFMENAAWDVASARDEGVVAS
FT                   YLQPLDKPVPMVATADVGRVAAQLLQQTWHGVRVVELEGPCRVSPNDLALAFARVLGRD
FT                   VRAEAVDRRTWEALFRAQGMKHPLPRMRMLDGFNEGWIDFESDPEEILHGHVALDTVLG
FT                   ELVSRTV"
FT                   /protein_id="YP_839533.1"
FT   misc_feature    complement(38931..39788)
FT                   /note="Predicted nucleoside-diphosphate-sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG0702"
FT                   /db_xref="CDD:31046"
FT                   /locus_tag="Bcen2424_5907"
FT   misc_feature    complement(39096..>39590)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5907"
FT   gene            39999..40919
FT                   /db_xref="GeneID:4454620"
FT                   /locus_tag="Bcen2424_5908"
FT   CDS_pept        39999..40919
FT                   /locus_tag="Bcen2424_5908"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5543 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686287"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454620"
FT                   /translation="MRSSSEKLSGSISVFAAVVDAGTFSAAADVIGMTPPGVSRAIARL
FT                   EKRLNIRLFNRTTRSVSLTEEGRRFYEQVMPHLAGLEEAAAAAAGGASAVRGKLRINLD
FT                   PVVYRAILGPRLDAFMDAHPELEIELIARDSLGDLVMDGFDLAVRFGEPRASSLIARKL
FT                   LDTGVVTVAAPSYIARRGRPAKPEDLEDRHHRCLEFRNPETGKPFAWEFHRKRKRIVVD
FT                   TRGRLTVNDPGALLNACLAGSGIAQMLLLGAEPLIADGRLINLFPEWADERYPLYAYYP
FT                   SRHHVPAKTRAFLDFIRICSEKPRH"
FT                   /protein_id="YP_839534.1"
FT   sig_peptide     39999..40085
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.569 at
FT                   residue 29"
FT                   /locus_tag="Bcen2424_5908"
FT                   /product="hypothetical protein"
FT   misc_feature    40029..40889
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen2424_5908"
FT   misc_feature    40038..40202
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5908"
FT   misc_feature    40287..40889
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5908"
FT   misc_feature    order(40317..40319,40329..40331,40446..40448,40488..40490,
FT                   40494..40496,40692..40694,40743..40745,40824..40826)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5908"
FT   misc_feature    order(40320..40325,40335..40340,40344..40349,40356..40358,
FT                   40368..40370,40374..40394,40581..40583,40674..40688,
FT                   40707..40712,40719..40721)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5908"
FT   gene            40981..42033
FT                   /db_xref="GeneID:4454621"
FT                   /locus_tag="Bcen2424_5909"
FT   CDS_pept        40981..42033
FT                   /locus_tag="Bcen2424_5909"
FT                   /gene_family="HOG000125069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS605 family transposase OrfB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: bcn:Bcen_5544 transposase,
FT                   IS605 OrfB"
FT                   /db_xref="GI:116686288"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="GeneID:4454621"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWSKKWP
FT                   TGFNLNVLATGSSKELGIHSGTVNATCEQYAKSRSQRRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGTNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDQFGRRAAEKLAKAQRARKHKRHIAKLHAKVANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAVKLARTRMAKSVYDASWSSFRNKLRYKAVAHGATF
FT                   EEVDESGSTQSCSSCGSKDSSTRPKGIAGLRVREWACSDCGAEHDRDINAALNILRCGR
FT                   ASPGVGIRRL"
FT                   /protein_id="YP_839535.1"
FT   misc_feature    <41401..41712
FT                   /note="Probable transposase; Region: Transposase_2;
FT                   pfam01385"
FT                   /db_xref="CDD:144832"
FT                   /locus_tag="Bcen2424_5909"
FT   misc_feature    41767..41991
FT                   /note="Putative transposase DNA-binding domain; Region:
FT                   Transposase_35; pfam07282"
FT                   /db_xref="CDD:115907"
FT                   /locus_tag="Bcen2424_5909"
FT   gene            complement(42103..43065)
FT                   /db_xref="GeneID:4454622"
FT                   /locus_tag="Bcen2424_5910"
FT   CDS_pept        complement(42103..43065)
FT                   /locus_tag="Bcen2424_5910"
FT                   /gene_family="HOG000063198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI domain protein; SMART:
FT                   helix-turn-helix- domain containing protein, AraC type;
FT                   KEGG: bcn:Bcen_5545 transcriptional regulator, AraC family"
FT                   /db_xref="GI:116686289"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:4454622"
FT                   /translation="MRLTILALEGLFDTGLTVLLDTFAMANELAAAQGFAAPPFDVTVA
FT                   GVRKRVRTAHGLSMLVEPASSVRRPDWVAVPAPGIREPERLIETLQRRDVCDAMAHLRA
FT                   WHADGVGVAAACIGTFLLAEAGLLDHREATTTWSLSPFFRQRYPAVDLNDSRMVVAADR
FT                   VVTAGSAMGHLDLALWLLRQASPELATLVARFMLIDKRSSQAEYIIPDYLAHADPLIAR
FT                   FERWAREHLSLGFSLQTAAAALAVGPRTLQRRTEAVLGKSPLAFFQDLRIERAQNLVSM
FT                   GYDLETIASEVGYADSATLRALLRRRLGRGVRELRADNR"
FT                   /protein_id="YP_839536.1"
FT   misc_feature    complement(42469..43059)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_2; cd03138"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bcen2424_5910"
FT   misc_feature    complement(42718..42720)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bcen2424_5910"
FT   misc_feature    complement(<42172..42465)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bcen2424_5910"
FT   gene            43218..44141
FT                   /db_xref="GeneID:4454623"
FT                   /locus_tag="Bcen2424_5911"
FT   CDS_pept        43218..44141
FT                   /locus_tag="Bcen2424_5911"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; glucose/ribitol
FT                   dehydrogenase; KEGG: bcn:Bcen_5546 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:116686290"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4454623"
FT                   /translation="MRLRSSNLIGWETLNMSRTILITGASSGFGRDTAETLSRAGHRVF
FT                   ASMRDVAGRNRPHADALRASGVQVVELDVTDDASVERGVASVLEHAGRLDVLINNAGIG
FT                   SAGVSEAFTTKQVQALFDVNVFGIQRMSRAVLPTFRKQGEGLIVNVGSILGRVTFPFFG
FT                   LYGASKFAIEALTDSYRYELSTLGIDVVLVQPSNYPTNIFGSAQRPADAARVPGYGEAG
FT                   AIPDKMVETLMTLFASDHAPDPHDVAEAIAQLVEQAPGTRPARWVVGQSFGADALNAQA
FT                   AAIQAQTLESLGLAHLAGPQGQSAAA"
FT                   /protein_id="YP_839537.1"
FT   misc_feature    43257..44027
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Bcen2424_5911"
FT   misc_feature    43266..44006
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5911"
FT   gene            complement(44309..45049)
FT                   /db_xref="GeneID:4454624"
FT                   /locus_tag="Bcen2424_5912"
FT   CDS_pept        complement(44309..45049)
FT                   /locus_tag="Bcen2424_5912"
FT                   /gene_family="HOG000273993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_5547 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="GI:116686291"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:4454624"
FT                   /translation="MSHDIEPTTTQQDTIYATLRQWVTVGRFLPGERLKIRNVAAEMGV
FT                   GQMPVRAALQRLAAEGALVNVPNAGTIVPRLTVPEFDDLLQMRMLLEGEAAERGCLRLE
FT                   PAELATLRKLCQRMAKALKHPADQPARARKSAGDKPTLKQPAVSLKADQATDYLAANED
FT                   FHVLLYKAAGSPLLFELIDTLWLKAGPISNRLFDTSEASAVLNDAHEDLMDALDRRDAA
FT                   AARRAVERDIFVAGQFLRSTLKRD"
FT                   /protein_id="YP_839538.1"
FT   misc_feature    complement(44831..45007)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen2424_5912"
FT   misc_feature    complement(order(44837..44848,44852..44857,44885..44887,
FT                   44894..44899,44903..44917,44939..44944))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen2424_5912"
FT   misc_feature    complement(44420..44803)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Bcen2424_5912"
FT   gene            complement(45046..46428)
FT                   /db_xref="GeneID:4454625"
FT                   /locus_tag="Bcen2424_5913"
FT   CDS_pept        complement(45046..46428)
FT                   /locus_tag="Bcen2424_5913"
FT                   /gene_family="HOG000020210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bcn:Bcen_5548 aminotransferase class-III"
FT                   /db_xref="GI:116686292"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:4454625"
FT                   /translation="MNHTLPHTGIEHERVQALLAHERAEYAQRNPKSQVMSARAAPQLM
FT                   FGVPLHWMNDWSTPFALHVAQAQGAQLTDVDGHTLADFCLGDTGAMFGHSPAVVTEALA
FT                   TQARQGLTTMLPNEDASVVGELLARHFGLPKWQFAMTASDANRFLLRWVRAATGRRTLL
FT                   VFNGCYHGTVDDVFVDLVDGQPTQRASLLGQVHDLTITTRVVEFNDLAALEAALAPGDV
FT                   ACVLAEPVMTNIGMVLPEPGYWAQAQDLIRRHGSLLVLDETHTLSSGPGGYACAHGLQP
FT                   DAVVVGKALGGGMPCAAYGFSAALAERAEAAKRTAPPGHSGIGTTLTANLLAMAAMRAT
FT                   LTHLMTPEVFAPMHALAEQLAAGLRTIIARHGLPWCVTQVGARVEFQFCPQPPRNGSQA
FT                   EAVMDAELEHALHLALLNRGVLITPFHNMMLVCPDTTRMHVQRLLAAFDTVLASLTAAA
FT                   DS"
FT                   /protein_id="YP_839539.1"
FT   misc_feature    complement(45061..46413)
FT                   /note="aminotransferase; Validated; Region: PRK07046"
FT                   /db_xref="CDD:168782"
FT                   /locus_tag="Bcen2424_5913"
FT   misc_feature    complement(45076..46284)
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Bcen2424_5913"
FT   misc_feature    complement(order(45565..45570,45637..45639,45646..45648,
FT                   45745..45747,45991..45993,46000..46005))
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen2424_5913"
FT   misc_feature    complement(45565..45567)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bcen2424_5913"
FT   gene            complement(46439..47773)
FT                   /db_xref="GeneID:4454626"
FT                   /locus_tag="Bcen2424_5914"
FT   CDS_pept        complement(46439..47773)
FT                   /locus_tag="Bcen2424_5914"
FT                   /gene_family="HOG000005154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   bcn:Bcen_5549 glutamate--ammonia ligase"
FT                   /db_xref="GI:116686293"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="GeneID:4454626"
FT                   /translation="MNDALSDFLTRHRIREVECVIPDMTGIARGKILPRDLFTASGEMR
FT                   IPKSVLLNTVNGQQPDNSPFVGDTDPDMVCKPDAATVRIVPWAAEPVAVVIHDCLEWDG
FT                   QPVQLSPRAVLRRVLALYEARGWQPVVAPEMEFYLVARNQNPHEPLQPPLGRTGKPEVG
FT                   RQSYSIDAVNDFDPFFMELSAFCDQHQLGVETLIHEAGPGQMEINFSHGEPLDLADRVF
FT                   LFKRTVRETALRHGVFATFMAKPMEGEPGSAMHIHQSINDGEGRNIFSNTDGTASEHFH
FT                   HFIGGLQTYIPQVMPMLAPYVNSYRRLAPYMSAPINVRWGQDNRTCGIRVPKSGPGARR
FT                   VENRVPGVDANPYLAMAATLACGYIGMRDRLHPSEPTEGSAWNVAHELPRHLENAIEAM
FT                   RACDAMKEVLGETFVDAFCAVKELEFSTYNRVISSWEREHLLLLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_839540.1"
FT   misc_feature    complement(46445..47767)
FT                   /note="Glutamine synthetase [Amino acid transport and
FT                   metabolism]; Region: GlnA; COG0174"
FT                   /db_xref="CDD:30523"
FT                   /locus_tag="Bcen2424_5914"
FT   misc_feature    complement(46685..47446)
FT                   /note="Glutamine synthetase, catalytic domain; Region:
FT                   Gln-synt_C; pfam00120"
FT                   /db_xref="CDD:143894"
FT                   /locus_tag="Bcen2424_5914"
FT   gene            complement(47855..48202)
FT                   /db_xref="GeneID:4454627"
FT                   /locus_tag="Bcen2424_5915"
FT   CDS_pept        complement(47855..48202)
FT                   /locus_tag="Bcen2424_5915"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5550 hypothetical protein"
FT                   /db_xref="GI:116686294"
FT                   /db_xref="GeneID:4454627"
FT                   /translation="MCVVAVPPTVLGGEAAGGSTGGCRPEAAGSSISETDGQTTAPLGN
FT                   PTVGPFPDLGLGNQWPIKSNGRLCIQTGHLLFDAENGWRGSVSTTVPKGCSWTCDRRCS
FT                   RCRELSCSSLG"
FT                   /protein_id="YP_839541.1"
FT   gene            complement(48274..49038)
FT                   /db_xref="GeneID:4454628"
FT                   /locus_tag="Bcen2424_5916"
FT   CDS_pept        complement(48274..49038)
FT                   /locus_tag="Bcen2424_5916"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   glucose/ribitol dehydrogenase; KEGG: bcn:Bcen_5551
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:116686295"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:4454628"
FT                   /translation="MARKLDNKIALVTGATSGIGLATAQRFAAEGAHVYLTGRRQAELD
FT                   AAVAGIREAGGTATGVRSDSTKLDELDALYAQIKEEQGRLDVLFVNAGGGSMLPLGSIT
FT                   EAHYDDTFDRNVKGVLFTVQKALPLLADGASVILTGSTAGSAGTAAFSVYSASKAAVRA
FT                   FARSWILDLKDRRIRVNTISPGATRTPGLLDLAGDDAGQRQGLADYLAAQIPMGRLGEP
FT                   GEIAGAALFLASDDASFVNGIELFVDGGQQQI"
FT                   /protein_id="YP_839542.1"
FT   misc_feature    complement(48289..49038)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5916"
FT   sig_peptide     complement(48952..49038)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.941 at
FT                   residue 29"
FT                   /locus_tag="Bcen2424_5916"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(48286..49029)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Bcen2424_5916"
FT   gene            49180..50097
FT                   /db_xref="GeneID:4454629"
FT                   /locus_tag="Bcen2424_5917"
FT   CDS_pept        49180..50097
FT                   /locus_tag="Bcen2424_5917"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5552 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686296"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454629"
FT                   /translation="MAHLPDFEGLAMFAKVAEHGSFAAAARSTGVSVATVSRGVARLED
FT                   RLGARLFNRTSRQLSLTEFGRTISEKAGEIYRQAEEAESSAREMSVQPRGLVRLAVPMS
FT                   FGLRWVAPLLPGFFRAYPEVSIDLHLSDASVDLIADGFDAALRIAALPDSSLVARRLCA
FT                   VTQFVVAAPEYLRREGRPTHPLELADRPCLPYAYRARSAVWRFTNDAGDEESVMPTGPL
FT                   RVTNADALLPTLLDGLAIAELPEFIAGEYLADGRLEAILPDWSLTTGGLYFVTPSARAR
FT                   PAKVTALSDYFAEHLGNPVWRWPK"
FT                   /protein_id="YP_839543.1"
FT   misc_feature    49198..49377
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5917"
FT   misc_feature    49201..50061
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcen2424_5917"
FT   misc_feature    49462..50052
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5917"
FT   misc_feature    order(49492..49494,49504..49506,49621..49623,49663..49665,
FT                   49669..49671,49858..49860,49909..49911,49990..49992)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5917"
FT   misc_feature    order(49495..49500,49510..49515,49519..49524,49531..49533,
FT                   49543..49545,49549..49569,49750..49752,49840..49854,
FT                   49873..49878,49885..49887)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcen2424_5917"
FT   gene            complement(50232..50576)
FT                   /db_xref="GeneID:4454630"
FT                   /locus_tag="Bcen2424_5918"
FT   CDS_pept        complement(50232..50576)
FT                   /locus_tag="Bcen2424_5918"
FT                   /gene_family="HOG000266403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulatory protein, LysR"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5553 regulatory protein, LysR"
FT                   /db_xref="GI:116686297"
FT                   /db_xref="GeneID:4454630"
FT                   /translation="MGRHIQLVVTDNQPDAEKTQQGVASERQWWVDDLGAKHDLLRGSL
FT                   CWGRMPRHMVDADLAKGTLVELQRRAWHMRPLTFMVSQRRGYAFSGCETRLVELLGQCP
FT                   SHRVRRGKST"
FT                   /protein_id="YP_839544.1"
FT   misc_feature    complement(50346..>50462)
FT                   /note="transcriptional regulator, ArgP family; Region:
FT                   argP; TIGR03298"
FT                   /db_xref="CDD:163206"
FT                   /locus_tag="Bcen2424_5918"
FT   gene            complement(50634..51371)
FT                   /db_xref="GeneID:4454631"
FT                   /locus_tag="Bcen2424_5919"
FT   CDS_pept        complement(50634..51371)
FT                   /locus_tag="Bcen2424_5919"
FT                   /gene_family="HOG000243724" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bcn:Bcen_5554 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="GI:116686298"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4454631"
FT                   /translation="MKVTIAYIEEPPFGWTEADGTARGADLELAATILRQIGVTRVEYC
FT                   PTTFSELLPGVASGHWDMNVPLFVTPQRAHTVAFSVPVWGIEDGFLVRPGNPKALRRYA
FT                   SIAERPDARLGIIAGQVQHDSAMAAGVSRRQIVVFEQQADAIAAVLSGVIDAYASTALG
FT                   NRIVAGRIGSAMIEAVAHEPDGDGSQRTPPLGAFSFNRENRDLLTAFNRQLRAYVGSPD
FT                   HRARMARFGLTDREIDPAVSPTG"
FT                   /protein_id="YP_839545.1"
FT   misc_feature    complement(50721..51368)
FT                   /note="Bacterial periplasmic substrate-binding proteins;
FT                   Region: PBPb; smart00062"
FT                   /db_xref="CDD:128376"
FT                   /locus_tag="Bcen2424_5919"
FT   misc_feature    complement(50724..51341)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5919"
FT   misc_feature    complement(order(50892..50894,51009..51011,51153..51155,
FT                   51225..51227))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5919"
FT   misc_feature    complement(order(50913..50915,50931..50933,50943..50945))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5919"
FT   misc_feature    complement(50784..50801)
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcen2424_5919"
FT   gene            complement(51588..52499)
FT                   /db_xref="GeneID:4454632"
FT                   /locus_tag="Bcen2424_5920"
FT   CDS_pept        complement(51588..52499)
FT                   /locus_tag="Bcen2424_5920"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_5555 ABC transporter related"
FT                   /db_xref="GI:116686299"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4454632"
FT                   /translation="MQNPQAVPDYLIQSDAVRERFARLKARDVILDVRHVGKRFTTPQG
FT                   ECVALDDISFRTHRREFVCVIGPSGCGKSTLIRILAGLDAQTSGDVLLDGKPVDGPGAD
FT                   RGMVFQGYTLFPWLTVKKNVMFGLRMNGSSSGVAEREALQWLDLVGLTRFADVYPHQLS
FT                   GGMKQRVAIARALANRPRILLMDEPFGALDAQTRARMQTHLLDIWRNIDVTILFITHDL
FT                   DEAIFLADRILVLKANPGGVQELIEVPVPRPRDYSQVNTPEFVATKARLEALIHPKEAA
FT                   TAEDDGIKPHMIRMTDVADNVE"
FT                   /protein_id="YP_839546.1"
FT   misc_feature    complement(51654..52418)
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(51753..52409)
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars...; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(52278..52301)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(order(51840..51842,51939..51944,52170..52172,
FT                   52275..52283,52287..52292))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(52170..52181)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(51987..52016)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(51939..51956)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(51921..51932)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   misc_feature    complement(51834..51854)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Bcen2424_5920"
FT   gene            complement(52545..53519)
FT                   /db_xref="GeneID:4454633"
FT                   /locus_tag="Bcen2424_5921"
FT   CDS_pept        complement(52545..53519)
FT                   /locus_tag="Bcen2424_5921"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_5556
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:116686300"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4454633"
FT                   /translation="MTTTRNTTGWLAVRRELTTRGKWTLALASFLLPFAVWCLISYVPF
FT                   VWHPQMRITNPGSVDYFQTGMQIDRDVFDDELAHARATHAAVPEGERANPVYLPAPHQV
FT                   LRAFYTAFTTPPASRDGVWLHESLWHSIRIIFWGFVISSAIGVPLGIVCGTFSALARLQ
FT                   EPFLEFFRYLPAPAFGALMVAILGIYDAPKIAIIVIGTLFQQVLIIANTTRKLEYGLFE
FT                   AAMTLGTKKLKLLTHVVIPGVLPDLYRDQRILLGWAWTYLIVAELVGTSSGITWYISQQ
FT                   ARYQHFDNVYAAILMIGIIGLGTDIVLGLLGRRLFPWDRTLKA"
FT                   /protein_id="YP_839547.1"
FT   misc_feature    complement(52566..53240)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Bcen2424_5921"
FT   gene            complement(53583..55454)
FT                   /db_xref="GeneID:4454634"
FT                   /locus_tag="Bcen2424_5922"
FT   CDS_pept        complement(53583..55454)
FT                   /locus_tag="Bcen2424_5922"
FT                   /gene_family="HOG000116698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amidase"
FT                   /transl_table="11"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_B1385 putative UreA
FT                   amidolyase"
FT                   /db_xref="GI:116686301"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="GeneID:4454634"
FT                   /translation="MSTTDRPVLPGLRSIAALRARYAAGDLTPHALVDAIAAHFDAGDP
FT                   HHAWIRPLTRDEMMSYADALAGRDIASLPLYGVPFAIKDNIDLAGIPTTAGCPAYAYTP
FT                   ARSAPVIERLIAAGAIPVGKTNLDQFATGLSGQRSPYGACRNALDSRYASGGSSSGSAV
FT                   AVALGVATFSLGTDTAGSGRVPAAFHGLVGLKPTRGVLSTLGVVPACRSLDCVSVFARS
FT                   ADDARTVFAAAHGVMDGDPYGRAWQPLLGADGLRVQPARPLAQLRFGTPRADQLEFFGD
FT                   ASYRAAWGAALERLRATGAQVVEIDFEPFLAAARLLYDGPWVAERLAAIGAFAAREPDA
FT                   LHPVIREIVGGASRFSAADAFAAFDRLAALRVDAARAWDGLDAIVMPTSATTATVDALE
FT                   ADPIAINSRFGYYTNFVNLLDLSAIAVPAGTCSTGPHAGLPFGITFVGRAHDDARLLDL
FT                   AQAWGDGAAAVDDVRPPAAAMSARAAAAGVVRVAVVGAHLRGEPLNGQLTQRGARFVTA
FT                   TTTAPAYRLYALSAEASGGVAKPGLVRVPNDGAPIAVEVWEMPVDAYGSFVAGIAAPLG
FT                   IGTLTLADGARVQGFLCESVALDDAQDITRFGGWRAYRAQAASGALQ"
FT                   /protein_id="YP_839548.1"
FT   misc_feature    complement(53598..55415)
FT                   /note="allophanate hydrolase; Provisional; Region:
FT                   PRK08186"
FT                   /db_xref="CDD:169265"
FT                   /locus_tag="Bcen2424_5922"
FT   misc_feature    complement(53610..55319)
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cl11426"
FT                   /db_xref="CDD:175251"
FT                   /locus_tag="Bcen2424_5922"
FT   gene            complement(55451..59068)
FT                   /db_xref="GeneID:4454635"
FT                   /locus_tag="Bcen2424_5923"
FT   CDS_pept        complement(55451..59068)
FT                   /locus_tag="Bcen2424_5923"
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biotin carboxylation region"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: urea amidolyase related protein; Biotin
FT                   carboxylation region; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; Allophanate hydrolase subunit 2;
FT                   Allophanate hydrolase subunit 1; Carbamoyl-phosphate
FT                   synthase L chain, ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; biotin carboxylase
FT                   domain protein; KEGG: bcn:Bcen_5558 allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="GI:116686302"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:4454635"
FT                   /translation="MRFAKVLVANRGEIACRVIRTLKRLGIASVAIYSDADRDARHVAL
FT                   ADEAVRVGPAPAADSYLNVAAILAAARETGAQAVHPGYGFLSEHAGFADACEAAGLRFI
FT                   GPRGDHMRAFGLKHTARELAAAHGVALLPGTGLLDDVATALAEADAIGYPVMLKSTAGG
FT                   GGIGMSLCRDAAQLGAAFESVVRLGAANFAHAGVYLEKFVEHARHIEVQIFGDGRGGAI
FT                   ALGERDCSVQRRNQKVIEETPAPDLSAAERDALHASAVRLARAVGYASAGTVEFVFDAS
FT                   TRQFYFLEVNTRLQVEHCVTEAVTGVDLVEWMILQAEGDLPPLDTLAVVPRGASIQVRL
FT                   YAEDPNKQFQPSAGLLTHVAFPDDVRVDGWIEAGTEISAHYDPLLAKLIVRGDTRRDAL
FT                   AALRAALDQTELYGIETNLDYLRAVVGSDTFARGAPTTAFLSRFAFAPHTIDVLDGGVQ
FT                   TTVQQAPGRVGYWSVGVPPSGPMDDRAFDLANALLGNARDAAGLEFTMVGATLRFNTAT
FT                   LFVLGGAPLAATLDGEAVPFWQVVRARPGAVLKLGGVTGAGVRACLAVKGGLQVPDYLG
FT                   SKATFTLGQFGGHAGRALRKGDVLHLHADAGRGDAGAMLAAAEIPALTHAWTLGVLDGP
FT                   HGAPDFFTPDDIAMLYGTQWTVHYNSSRTGVRLIGPKPQWARADGGEAGLHPSNIHDNA
FT                   YAIGAVDFTGDMPVILGPDGPSLGGFVCPVTVVRDELWKLGQLRPGDTVQFVRAGVSAG
FT                   VSTAAVVDATRDVAAAASGASASFDDCVLHRDPSAGGGIGVVYRRSGDRNVLVEYGPLV
FT                   LDLNLRFRVHALMGWLDAHRLPGMLDLTPGIRSLQVQFDARTLPLDALLAHLQAAEREL
FT                   ADVADLRVPNRIVHLPLSWDDPSTRVAIERYMQSVRPDAPWCPSNIEFIRRINGLASID
FT                   DVKRIVFDARYLVMGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTPENAVGIGGAYL
FT                   CVYGMEGPGGYQFVGRTVQMWNRHRTTREFEAGKPWLLRFFDEIRFYEVSEAELTALRA
FT                   DFIAGRATLKIEESVFDLRAYNRFLHDEAESIAAFKATQQAAFDAERERWRAAGHAEYV
FT                   GDAEPGDAQADRVAGALDDTQRAIAADVSGSVWKVLVDAGERVTEGQVVAIVESMKMEV
FT                   AVTATEDGTIETIDCAPGAAVVAGQRLMVMKAGAAEEVA"
FT                   /protein_id="YP_839549.1"
FT   misc_feature    complement(55478..59062)
FT                   /note="urea carboxylase; Region: urea_carbox; TIGR02712"
FT                   /db_xref="CDD:162983"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(58736..59062)
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(58112..58720)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(57749..58060)
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(56834..57652)
FT                   /note="Allophanate hydrolase subunit 2; Region: AHS2;
FT                   cl00865"
FT                   /db_xref="CDD:176587"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(55922..56683)
FT                   /note="Allophanate hydrolase subunit 1 [Amino acid
FT                   transport and metabolism]; Region: DUR1; cl00896"
FT                   /db_xref="CDD:176822"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(55481..55681)
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(order(55556..55558,55577..55585,55610..55612))
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen2424_5923"
FT   misc_feature    complement(55580..55582)
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Bcen2424_5923"
FT   gene            complement(59157..59813)
FT                   /db_xref="GeneID:4454636"
FT                   /locus_tag="Bcen2424_5924"
FT   CDS_pept        complement(59157..59813)
FT                   /locus_tag="Bcen2424_5924"
FT                   /gene_family="HOG000251570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5559 hypothetical protein"
FT                   /db_xref="GI:116686303"
FT                   /db_xref="GeneID:4454636"
FT                   /translation="MPIIESRLDPRDAIHDVTLSAGDPWLHDLKRGQTFRILDLEGNQA
FT                   VDTLFYRTDDPEERYSAQDTIRSQRNLYLSAGSVLMSSRGNPMATIVADTCGRHDTLGG
FT                   ACAAESNTVRYALDKRYMHNCRDSFLNAISHCTCGAGARLTKRDLVGNVNFFMNVPVTP
FT                   LGGLTFEDGISAPGKYVEMRAEMDVTVLISNCPQLNNPCNGYNPTPVRLMIWEAE"
FT                   /protein_id="YP_839550.1"
FT   misc_feature    complement(59169..59780)
FT                   /note="Domain of unknown function (DUF1989); Region:
FT                   DUF1989; cl01474"
FT                   /db_xref="CDD:163985"
FT                   /locus_tag="Bcen2424_5924"
FT   gene            complement(59825..60580)
FT                   /db_xref="GeneID:4454637"
FT                   /locus_tag="Bcen2424_5925"
FT   CDS_pept        complement(59825..60580)
FT                   /locus_tag="Bcen2424_5925"
FT                   /gene_family="HOG000251569" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5560 hypothetical protein"
FT                   /db_xref="GI:116686304"
FT                   /db_xref="GeneID:4454637"
FT                   /translation="MSPSPQAILAPPPHVAWETLIPAGTHWSGILRRGLALRIVDVDGG
FT                   ANLSAVFHRQEDLLERYNMADTLKAQHTAHLTRGHALYTDMGRVIASITADTLGWHDPL
FT                   GGVGDARLFAHKYGTSSYQADRNAMIRNGRDSLVLELAKYGLSARDLAANVNFFSKLDA
FT                   RDDGALEFVAGHSPAGSAFDLRFEMNTLAAFSTAPHPLDPRPDYAPKAVKLIAYRAYPA
FT                   DGAAPDDDPCRRACAENMRGFANTDRLFA"
FT                   /protein_id="YP_839551.1"
FT   misc_feature    complement(59828..60538)
FT                   /note="Domain of unknown function (DUF1989); Region:
FT                   DUF1989; cl01474"
FT                   /db_xref="CDD:163985"
FT                   /locus_tag="Bcen2424_5925"
FT   gene            60780..61046
FT                   /db_xref="GeneID:4454638"
FT                   /locus_tag="Bcen2424_5926"
FT   CDS_pept        60780..61046
FT                   /locus_tag="Bcen2424_5926"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5561 hypothetical protein"
FT                   /db_xref="GI:116686305"
FT                   /db_xref="GeneID:4454638"
FT                   /translation="MLRTSRASNKRVACQPPLDDRTTRPGGAMPRDIRMTDAFACPRGG
FT                   RAAHHAHASAHRCSARRVLAHRPMRDGMGIAEPMHRHLISDPS"
FT                   /protein_id="YP_839552.1"
FT   gene            61466..62488
FT                   /db_xref="GeneID:4454639"
FT                   /locus_tag="Bcen2424_5927"
FT   CDS_pept        61466..62488
FT                   /locus_tag="Bcen2424_5927"
FT                   /gene_family="HOG000266414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5562 ABC transport system
FT                   substrate-binding protein"
FT                   /db_xref="GI:116686306"
FT                   /db_xref="GeneID:4454639"
FT                   /translation="MTRPAPALRHLPSFRFIRHALGAAVAAATLWAAPAVHAAAPLKIG
FT                   YSDWPGWVAFQVALDKGWFKEAGVDVDFEWFDYSASLDAFSAGKLDAVAATNGDALVTG
FT                   ASGAKNVMILLTDYSAGNDMIVAKPPLRTVEALKGKKIGVELGLVDHLLLETALQKHGL
FT                   KDGDVTLVNAKTNELPQVLGSSADIAAVAAWQPNAGEALKRAPGARAIFTSADAPGLIY
FT                   DAITVAPASLAARRADWAKVIKVWYRCVAYINDPKTQADAVKIMSARVGLAPAQYLPLL
FT                   KGTHLLDEAAAKRAFRKGDGLDSIYGSTRNANAFNVRNAVYKQSQDVDAYIDPRLVDAH
FT                   "
FT                   /protein_id="YP_839553.1"
FT   sig_peptide     61466..61582
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT                   /locus_tag="Bcen2424_5927"
FT                   /product="hypothetical protein"
FT   misc_feature    61592..62371
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen2424_5927"
FT   gene            complement(62636..63355)
FT                   /db_xref="GeneID:4454640"
FT                   /locus_tag="Bcen2424_5928"
FT   CDS_pept        complement(62636..63355)
FT                   /locus_tag="Bcen2424_5928"
FT                   /gene_family="HOG000238352" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bcn:Bcen_5563
FT                   metallophosphoesterase"
FT                   /db_xref="GI:116686307"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:4454640"
FT                   /translation="MFSAAVDSLNRIRPEPDLVVISGDLTDEGTEDEYRKLRELLVELR
FT                   RPFVVLPGNHDDRGNLRAAFPDHAWLPDEGALSFALDVGELRLVALDTSVPGLHHGDLD
FT                   AETLAWLDTELAEHRNRTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRI
FT                   LAGHVHRSMQTRLGRVPVLTCPSTTTQIALRVEADAQPASFLEPPAYMLHRWAGRGQPA
FT                   VSHLCYVGHFEGPFPFA"
FT                   /protein_id="YP_839554.1"
FT   misc_feature    complement(62705..63355)
FT                   /note="Enterobacter aerogenes GpdQ and related proteins,
FT                   metallophosphatase domain; Region: MPP_GpdQ; cd07402"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen2424_5928"
FT   misc_feature    complement(order(62708..62710,62714..62716,62723..62725,
FT                   62810..62812,62816..62824,62831..62845,62864..62866,
FT                   62870..62872,62951..62956,62960..62962,63239..63241,
FT                   63266..63268,63275..63277,63332..63337,63344..63349))
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen2424_5928"
FT   misc_feature    complement(order(62789..62791,62849..62851,62855..62857,
FT                   62972..62974,63191..63196,63275..63277,63284..63286))
FT                   /note="active site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen2424_5928"
FT   misc_feature    complement(order(62849..62851,62855..62857,62972..62974,
FT                   63194..63196,63284..63286))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163645"
FT                   /locus_tag="Bcen2424_5928"
FT   gene            complement(63639..64088)
FT                   /db_xref="GeneID:4454641"
FT                   /locus_tag="Bcen2424_5929"
FT   CDS_pept        complement(63639..64088)
FT                   /locus_tag="Bcen2424_5929"
FT                   /gene_family="HOG000078519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5564 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:116686308"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4454641"
FT                   /translation="MRWFGTDPMTDIGEADKLIQVFADWRRSGSGVRWAVERLSDGHLL
FT                   GTCGLFRWNRNWRSCAVGYELATFARGKGYMNEALSAAIDYGFDTMQINRIEAQVHPQN
FT                   ASSIQVLETLGFVREGYQRQAGYWRGAYHDLLQFSLLRSDCLRRG"
FT                   /protein_id="YP_839555.1"
FT   misc_feature    complement(63642..64082)
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="Bcen2424_5929"
FT   misc_feature    complement(63702..>63914)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen2424_5929"
FT   gene            complement(64481..65005)
FT                   /db_xref="GeneID:4454642"
FT                   /locus_tag="Bcen2424_5930"
FT   CDS_pept        complement(64481..65005)
FT                   /locus_tag="Bcen2424_5930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5565 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:116686309"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4454642"
FT                   /translation="MLQCASPSSLPPPMSPSVDELLALDVLTLREHTERAGDAFDVDEH
FT                   RAKLCKSLEINELCYVRRDGKLVAYAMLRPEAGACWFVGAFGTHPLHRTYTVVNELFAK
FT                   IATLASERRIGELRSHVYKTNRLSIAFHRKLGFVVTRENEKGFEFSTTLDELATKPAVR
FT                   RATARATSRSD"
FT                   /protein_id="YP_839556.1"
FT   misc_feature    complement(64592..64825)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen2424_5930"
FT   gene            complement(65108..65539)
FT                   /db_xref="GeneID:4454643"
FT                   /locus_tag="Bcen2424_5931"
FT   CDS_pept        complement(65108..65539)
FT                   /locus_tag="Bcen2424_5931"
FT                   /gene_family="HOG000261967" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcn:Bcen_5566 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:116686310"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:4454643"
FT                   /translation="MSRLRKKVGSDLILSPSVAAVIHDHEGKLLLQEKSSGEAWSLPAG
FT                   GVELGESPQEAIFREVMEETGYVIRIHGILGVFGGRLFRYTYPSGDRVEYVVTLFQCKI
FT                   IDGSGIPSDPETTSTRYFGRHDMPELALPYPKDDLFLPF"
FT                   /protein_id="YP_839557.1"
FT   misc_feature    complement(65135..65494)
FT                   /note="Members of the Nudix hydrolase superfamily catalyze
FT                   the hydrolysis of NUcleoside DIphosphates linked to other
FT                   moieties, X. Enzymes belonging to this superfamily require
FT                   a divalent cation, such as Mg2+ or Mn2+, for their activity
FT                   and contain a highly...; Region: Nudix_Hydrolase_17;
FT                   cd04676"
FT                   /db_xref="CDD:72911"
FT                   /locus_tag="Bcen2424_5931"
FT   misc_feature    complement(65339..65407)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72911"
FT                   /locus_tag="Bcen2424_5931"
FT   gene            65833..66114
FT                   /db_xref="GeneID:4454644"
FT                   /locus_tag="Bcen2424_5932"
FT   CDS_pept        65833..66114
FT                   /locus_tag="Bcen2424_5932"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116686311"
FT                   /db_xref="GeneID:4454644"
FT                   /translation="MEDQSGASSSSDPTSFPAERPSYSTSESRPAQTDDARARRQPNAL
FT                   SQHRHARQSDAERCHRVRHHRDETWGSARPTQPSRRRTVLADREQDKW"
FT                   /protein_id="YP_839558.1"
FT   gene            complement(66426..66992)
FT                   /db_xref="GeneID:4454645"
FT                   /locus_tag="Bcen2424_5933"
FT   CDS_pept        complement(66426..66992)
FT                   /locus_tag="Bcen2424_5933"
FT                   /gene_family="HOG000266437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF925; KEGG:
FT                   bcn:Bcen_5568 protein of unknown function DUF925"
FT                   /db_xref="GI:116686312"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="GeneID:4454645"
FT                   /translation="MNLNERLVEIARQSSWCMSALSAARAMGLKSWCIGAGAIRNLVWD
FT                   SLHGYVTPTRPADVDLAYFDPSDLSSIRDAEIQHSLTAQCPEIPWEVTNQAAVHLWFES
FT                   AFGHPVPPFSSLTQAVASWPEYATTVGLTLLGDGTIDVCAPYGLDDLFSMVVRRNPARV
FT                   SIDTYLRRIQQKRYKDRWPRVTIIV"
FT                   /protein_id="YP_839559.1"
FT   misc_feature    complement(66432..66932)
FT                   /note="Bacterial protein of unknown function (DUF925);
FT                   Region: DUF925; cl01435"
FT                   /db_xref="CDD:154400"
FT                   /locus_tag="Bcen2424_5933"
FT   gene            complement(67251..68213)
FT                   /db_xref="GeneID:4454646"
FT                   /locus_tag="Bcen2424_5934"
FT   CDS_pept        complement(67251..68213)
FT                   /locus_tag="Bcen2424_5934"
FT                   /gene_family="HOG000181312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5569 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686313"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454646"
FT                   /translation="MATKLSFEVLEVLDAIDRTGTFAEAAELLHRVPSTLTYLVQKLES
FT                   DMDVELFDRSGRRTRLTEAGRAVVEDGRRLLDAARHLEAKAKGIRDSWESELRLCVDAI
FT                   LPIQSLWPYVHAFYDLEMNTQLSLSTEVLGGVWDALVTRRADLAIGAFGEPPHAANIAA
FT                   RPIGTLRHVFVVAPDHPLARIPEPLESETIAGYRGVVISDTSRELQRQSVATRDGQPLV
FT                   IVPTLAAKLQALCEGIAVGMLPDFVAKEPIHEGRLVARRIVGVREFTNGYLAWREDKVG
FT                   NALNWWIAQLDSTDLLERLLTPRQESKGQPGTATCAVRY"
FT                   /protein_id="YP_839560.1"
FT   misc_feature    complement(67317..68201)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK11074"
FT                   /db_xref="CDD:170934"
FT                   /locus_tag="Bcen2424_5934"
FT   misc_feature    complement(68016..68195)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5934"
FT   misc_feature    complement(67341..67928)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcen2424_5934"
FT   misc_feature    complement(order(67506..67511,67515..67520,67536..67553,
FT                   67824..67844,67848..67850,67860..67862,67869..67874,
FT                   67878..67883))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcen2424_5934"
FT   gene            69028..69261
FT                   /db_xref="GeneID:4454647"
FT                   /locus_tag="Bcen2424_5935"
FT   CDS_pept        69028..69261
FT                   /locus_tag="Bcen2424_5935"
FT                   /gene_family="HOG000266438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5570 hypothetical protein"
FT                   /db_xref="GI:116686314"
FT                   /db_xref="GeneID:4454647"
FT                   /translation="MNPEQARAEETQAMERMVAATLRVQSTFASMQKQFPPQGSGEPSP
FT                   FALQTFDAALQELEDAQAAFDALLNDLIDGNR"
FT                   /protein_id="YP_839561.1"
FT   gene            complement(69400..70521)
FT                   /db_xref="GeneID:4454648"
FT                   /locus_tag="Bcen2424_5936"
FT   CDS_pept        complement(69400..70521)
FT                   /locus_tag="Bcen2424_5936"
FT                   /gene_family="HOG000266449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: reu:Reut_B4368 ATP-binding region,
FT                   ATPase-like:histidine kinase A, N-terminal"
FT                   /db_xref="GI:116686315"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4454648"
FT                   /translation="MRLADFIVRNMETILVQWEAFAATLLPAARHMNSQGLRDHAREIL
FT                   TAVAKDIATPQTREAQHEKSLGRAPEPANASETAAQTHAVLRARRGFNINQLAAEYRAL
FT                   RASVLRLWIDACQPGAPDMDDMIRFNEAIDQALAESVSFFTEQVEQARNLLLGMLSHDM
FT                   RTPLQTIQLTASYLAALNAGEEVSEAAARLIRSGGRMQGLLDDLCDFNRTQLGLGINVV
FT                   PRNIDLAHVLDNVVDELRAGHPDREITVDMRGDLRGEWDDQRMQQLLSNLVSNAIKYGA
FT                   RDTPVRVVATTTGDEVFVEVGNSGPAIDPRTLDRIFDPLERGEARQGRKGDDAGLGLGL
FT                   FIAREIAKAHRGRIDARSDQTETVFAVRLPRGV"
FT                   /protein_id="YP_839562.1"
FT   misc_feature    complement(69886..70077)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(order(69901..69903,69913..69915,69922..69924,
FT                   69934..69936,69943..69945,69955..69957,70003..70005,
FT                   70012..70014,70024..70026,70033..70035,70045..70047,
FT                   70057..70059))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(70039..70041)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(69415..69729)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(order(69427..69429,69433..69435,69448..69450,
FT                   69454..69456,69502..69513,69598..69603,69607..69609,
FT                   69613..69615,69619..69621,69688..69690,69697..69699,
FT                   69709..69711))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(69697..69699)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5936"
FT   misc_feature    complement(order(69505..69507,69511..69513,69601..69603,
FT                   69607..69609))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5936"
FT   gene            70767..72032
FT                   /db_xref="GeneID:4454494"
FT                   /locus_tag="Bcen2424_5937"
FT   CDS_pept        70767..72032
FT                   /locus_tag="Bcen2424_5937"
FT                   /gene_family="HOG000156337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="poly(3-hydroxybutyrate) depolymerase-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5573 poly(3-hydroxybutyrate)
FT                   depolymerase-like"
FT                   /db_xref="GI:116686316"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="GeneID:4454494"
FT                   /translation="MRVTPVPPGAAFRLPRHRQHEPCFAPVRLPSDGGVGRLFPSRPAA
FT                   GTKLHMPRKKSSLWLRHLELFSIATGARPKKRAGKPRPAAPKAAKKVVQRTIKPAVAAP
FT                   AAKRTGAAPAARAPSVEPPGTWLRSFHSAGPSAGRLVNHLAYALYLPAAPAKTAGMPAV
FT                   VMLHGCKQTAESFAAGTRICRLAERAGFAVLFPEQAKTTHAHRCWHWHGDATESEAAAV
FT                   ASLVDAIVRRHGFDRDRIYVAGLSAGAGLAAALALRYPDRFAAVGLHSGPAIAPPSSTM
FT                   AAMSLMRRGLRDDPVAALDACADVASYPGMPALVIHGALDTVVTDRNATQLGIAFARLN
FT                   RLVDEHGAIRIGEQRSYAQDDADYIDYLKGGRLVVRVCIVRRLPHAWSGGDPSEPFHSA
FT                   KGPDATAMFWHFFRRQRRKRLA"
FT                   /protein_id="YP_839563.1"
FT   misc_feature    71244..71828
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcen2424_5937"
FT   gene            complement(72080..73915)
FT                   /db_xref="GeneID:4454495"
FT                   /locus_tag="Bcen2424_5938"
FT   CDS_pept        complement(72080..73915)
FT                   /locus_tag="Bcen2424_5938"
FT                   /gene_family="HOG000266460" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; MHYT domain protein; KEGG: bcn:Bcen_5574
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="GI:116686317"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4454495"
FT                   /translation="MAAGRALAPAAAMHSTRCGRPIMHGIYNLPLVVLSLAIATLASYT
FT                   TLDLAAFISLLDDPKLKRAWLGGGAAAMGTGIWSMHFVGMLAFSLPVPLGYAWQETGAS
FT                   LAIAVLVSYFALNVVTRARLGWRRLCMGGVLMGGGIAGMHYTGMAAMHMQPGIRYDAAL
FT                   FAASIGIAVIASTAALWIAQALRMQQARHATAQRIGAAVIMGLAITGMHYTAMAAAHFA
FT                   PDARCGAANGVDAPWLATTVALFTMATLVVTLLVCRFDARTTFLRGMTDTLERLVRVRT
FT                   GELERALYSYEQTTRMLQRTRENMAAEIDERKAAHALLEQEKDEQRRLLHALEETHEQL
FT                   LQSEKLASIGQLAAGVAHEINNPIGFVSANLNTLKTWVRSLLDVVAAHEAALPQLDPAT
FT                   RDALTAVHRAVDLDYVRDEIAMLIDESIDGALRVRRIVQDLRDFSRPASDEWSVVDLHA
FT                   GLESTLNVVHNELKYKADIVRDYGDVPHVECLPSQLNQVFMNLLVNAAQAIPERGVITI
FT                   RTSSDGDQVSIAISDTGAGMTPDVVRRIFDPFFTTKPVGQGTGLGLSVSHGIVERHRGT
FT                   IDVTSEPGRGTTFRIRLPVRRAGDRASAAALEQRA"
FT                   /protein_id="YP_839564.1"
FT   misc_feature    complement(73148..73849)
FT                   /note="MHYT domain (predicted integral membrane sensor
FT                   domain) [Signal transduction mechanisms]; Region: COG3300"
FT                   /db_xref="CDD:33109"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(73529..73696)
FT                   /note="Bacterial signalling protein N terminal repeat;
FT                   Region: MHYT; pfam03707"
FT                   /db_xref="CDD:112517"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(73358..73486)
FT                   /note="Bacterial signalling protein N terminal repeat;
FT                   Region: MHYT; pfam03707"
FT                   /db_xref="CDD:112517"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(72113..>72943)
FT                   /note="sensory histidine kinase AtoS; Provisional; Region:
FT                   PRK11360"
FT                   /db_xref="CDD:171082"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(72137..72436)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(order(72149..72151,72155..72160,72173..72175,
FT                   72179..72181,72227..72238,72305..72310,72314..72316,
FT                   72320..72322,72326..72328,72395..72397,72404..72406,
FT                   72416..72418))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(72404..72406)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5938"
FT   misc_feature    complement(order(72230..72232,72236..72238,72308..72310,
FT                   72314..72316))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcen2424_5938"
FT   gene            complement(73933..75351)
FT                   /db_xref="GeneID:4454496"
FT                   /locus_tag="Bcen2424_5939"
FT   CDS_pept        complement(73933..75351)
FT                   /locus_tag="Bcen2424_5939"
FT                   /gene_family="HOG000266481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase, HD sub domain; KEGG: bcn:Bcen_5575
FT                   response regulator receiver modulated metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="GI:116686318"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:4454496"
FT                   /translation="MTTSATNGVNAVAPETSDTAAASASVEVPRVPSILLVDDEPNVVS
FT                   ALRRVFRPAGYDIVTADSGETALEILASTDIDLIVSDMRMPHMSGAEFLARARALYPDT
FT                   MRILLTGYAELASVVQAVNEGGVYRYLNKPWDDHDLLLTIEQALEQRRLRREAARLAAL
FT                   TEAQNEALRRFNTDLETQVRARTEELGQTVMFLEAAQSDLKSSFTAMVQVCASMIELRC
FT                   GAASGHAMRVGEIARRLALASGMSELHAQDVYFAGLLHGIGKLSLPDELLHKPLARMTT
FT                   DEHRVFQEHPLRAQMVLTPVAQLHKVASIVLHQYERFNGRGTPDGLVGDAIPIGSRIVA
FT                   IARDFEGLRHGEIGAPHSIEQAIDVLRSQASVRYDPQLVAGFIELMRDPASLGIAASVA
FT                   EIRSAQLREGMELADDLRTHRGVLLMTKGSVMSAHQIELVRRFETREGTPFDILVLAGP
FT                   AAQAHAPNAGVPPA"
FT                   /protein_id="YP_839565.1"
FT   misc_feature    complement(74197..75288)
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HD-GYP domain [Transcription / Signal
FT                   transduction mechanisms]; Region: COG3437"
FT                   /db_xref="CDD:33243"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(74920..75249)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(order(74950..74955,74962..74964,75022..75024,
FT                   75082..75084,75106..75108,75235..75240))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(75106..75108)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(order(75082..75090,75094..75099))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(74947..74955)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(74305..74670)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cd00077"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(order(74323..74325,74569..74574,74668..74670))
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen2424_5939"
FT   misc_feature    complement(74569..74571)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Bcen2424_5939"
FT   gene            complement(75473..75928)
FT                   /db_xref="GeneID:4454497"
FT                   /locus_tag="Bcen2424_5940"
FT   CDS_pept        complement(75473..75928)
FT                   /locus_tag="Bcen2424_5940"
FT                   /gene_family="HOG000221500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5576 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:116686319"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4454497"
FT                   /translation="MTTTLTFLPVTQADADALVAIRIAAMRDSLERIGRFDPQRARDRF
FT                   LASFDPALCRFIEAGHSRAGFYTLRPMADHWLLDHLYIVPAHQGKGIGAAVLREIFAAA
FT                   DERRMPVRVGALRGSDSNRFYERHGFVRTDEAEWDIYYRREPGTAAT"
FT                   /protein_id="YP_839566.1"
FT   misc_feature    complement(75536..75739)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcen2424_5940"
FT   gene            complement(76186..76590)
FT                   /db_xref="GeneID:4454498"
FT                   /locus_tag="Bcen2424_5941"
FT   CDS_pept        complement(76186..76590)
FT                   /locus_tag="Bcen2424_5941"
FT                   /gene_family="HOG000266482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5577 hypothetical protein"
FT                   /db_xref="GI:116686320"
FT                   /db_xref="GeneID:4454498"
FT                   /translation="MMIGSESAAFFMLRLGTPHPSWAFTDDSNMLGIGDCDGVMSAMFE
FT                   LDRNQVARIRRLGQSVERIRCTCERAGRELHFYLHGRQVSQGVWVGVASADPDYLPTDE
FT                   MIATWEVPKPDDAFRSTGAGADLIASLSLA"
FT                   /protein_id="YP_839567.1"
FT   misc_feature    complement(<76297..76590)
FT                   /note="RNase II stability modulator; Provisional; Region:
FT                   PRK10060"
FT                   /db_xref="CDD:170227"
FT                   /locus_tag="Bcen2424_5941"
FT   sig_peptide     complement(76519..76590)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.898 at
FT                   residue 24"
FT                   /locus_tag="Bcen2424_5941"
FT                   /product="hypothetical protein"
FT   gene            complement(76761..77966)
FT                   /db_xref="GeneID:4454499"
FT                   /locus_tag="Bcen2424_5942"
FT   CDS_pept        complement(76761..77966)
FT                   /locus_tag="Bcen2424_5942"
FT                   /gene_family="HOG000208778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bcn:Bcen_5578 sodium:dicarboxylate symporter"
FT                   /db_xref="GI:116686321"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="GeneID:4454499"
FT                   /translation="MQMLGGLVLGAACGVFAPGFAAKLGFLSAMFGHAIKMVVMPLIFL
FT                   SVTVGVFRAGRLRERLGKVALSSIGFFVLMTGLAASLGLLLNFAFRPGLGASMVQSGSM
FT                   PAALASSIDWTKFLVDLIPANIVAALAAGNSLPVLVFGVIFGAALAAAPERAEPAIAVF
FT                   EALLSGLFKMVQWVIAWSPLAIFAAIAQLLSAKGFTGAHSLVELLGVAYLGMAILAVVL
FT                   TIVIRVAGQSPLAVLRKVKEPLILGFTTRSSEITYPLHLKKLVELGVPYGVASTILPLA
FT                   YIFNRDGAVLYTALAVGYLADAYHLVWSWPLVITILILTIITIDGAANVPSGAIVAITI
FT                   VLTSIGLPADAVLLLLGVDAFFDMGRTALNVYGSTAAAAVAVRLSGSDSIAAETVPRQA
FT                   SV"
FT                   /protein_id="YP_839568.1"
FT   sig_peptide     complement(77901..77966)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.961 at
FT                   residue 22"
FT                   /locus_tag="Bcen2424_5942"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(76815..77921)
FT                   /note="Sodium:dicarboxylate symporter family; Region: SDF;
FT                   cl00573"
FT                   /db_xref="CDD:174292"
FT                   /locus_tag="Bcen2424_5942"
FT   gene            complement(77983..78645)
FT                   /db_xref="GeneID:4454500"
FT                   /locus_tag="Bcen2424_5943"
FT   CDS_pept        complement(77983..78645)
FT                   /locus_tag="Bcen2424_5943"
FT                   /gene_family="HOG000266493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bcn:Bcen_5579 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="GI:116686322"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:4454500"
FT                   /translation="MTSKVSTDAELAYEEIRARIFDGRFAPGQKVSHRGLSDELGFGQM
FT                   PVRSALHLLESEGLVVVIEKSGTYVASPTTSDLREIFEMRLALESTAAFLAARSGVTAG
FT                   LRDAAAKMQELLDRDVADIMLEQRIGWVFHQELFAAARNVRISSAYGLLRAQTLALNEL
FT                   PRGDAETVRRGTIEHLHIFHAIEANDGELARQHMWNHIVDGTPARIKLLKARHEHEK"
FT                   /protein_id="YP_839569.1"
FT   misc_feature    complement(78001..78645)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="Bcen2424_5943"
FT   misc_feature    complement(78433..78621)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen2424_5943"
FT   misc_feature    complement(order(78442..78453,78457..78462,78490..78492,
FT                   78499..78504,78508..78522,78544..78549,78619..78621))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcen2424_5943"
FT   misc_feature    complement(78043..78408)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Bcen2424_5943"
FT   gene            78796..79260
FT                   /db_xref="GeneID:4454501"
FT                   /locus_tag="Bcen2424_5944"
FT   CDS_pept        78796..79260
FT                   /locus_tag="Bcen2424_5944"
FT                   /gene_family="HOG000085386" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcn:Bcen_5580 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:116686323"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4454501"
FT                   /translation="MTSQGVRFTICAVRAEETYPLRAAILMAGDEEGSALHGDHAPTTL
FT                   HFAVRDNDTIVAVASVCKEGQSGVPNAEAWRLRGMAVHPSVRGLGFGRLLVNLSIRHVR
FT                   EQRGTLLWCTARESAYQFYEMLGFNRDPIPISLHGRDDMKFYLMQRPIEC"
FT                   /protein_id="YP_839570.1"
FT   misc_feature    78931..79137
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Bcen2424_5944"
FT   misc_feature    order(79033..79041,79069..79074)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Bcen2424_5944"
FT   gene            79306..79617
FT                   /db_xref="GeneID:4454502"
FT                   /locus_tag="Bcen2424_5945"
FT   CDS_pept        79306..79617
FT                   /locus_tag="Bcen2424_5945"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5581 hypothetical protein"
FT                   /db_xref="GI:116686324"
FT                   /db_xref="GeneID:4454502"
FT                   /translation="MSRSWLPARKTRSTGARLSRFARAKIEIACGAFSPQKNHPKLSAA
FT                   VSHAESAYDLYGHALINRAFHFDYRNPKANGTVTTGTAGLLLAMAVPCSRLSSPHDPT"
FT                   /protein_id="YP_839571.1"
FT   gene            80029..81195
FT                   /db_xref="GeneID:4454503"
FT                   /locus_tag="Bcen2424_5946"
FT   CDS_pept        80029..81195
FT                   /locus_tag="Bcen2424_5946"
FT                   /gene_family="HOG000114656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="porin"
FT                   /transl_table="11"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_5582
FT                   porin, gram-negative type"
FT                   /db_xref="GI:116686325"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="GeneID:4454503"
FT                   /translation="MKNKKINISVIAVAAFAASSAAMAQSSVTLYGMLDAGIGYTSNIN
FT                   GHSRFGLDGGAAGSNKWGLRGQEDLGGGLQAVFKIENGFNIATGGIGGQGPIGTTRSLF
FT                   NRQAYVGLASSQYGALRMGRQLDAVTEMVQVLTGDAISASTFSTPGDVDNNDNTTNQNN
FT                   AVKYISPIIHGFQAEAAYSFGGVAGSTGSGQSWSAAATYAQGGLTVAGGYFRAANQGEN
FT                   GWTNATAQPSFGGALGYPSSGYNGGNAFKSAGIAQVAAQYEVGPYTAGLRYSNAQYKGN
FT                   DGQPSIHFNVLGALLQYRVTPALSLATGYTYVYGSAATPTQAAEGRTMASINQVSLGAT
FT                   YSLSKSTALYAMGAYVHAKGAQASAADFGNTSSGGNQVQVNIGMFHGF"
FT                   /protein_id="YP_839572.1"
FT   sig_peptide     80029..80103
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT                   /locus_tag="Bcen2424_5946"
FT                   /product="hypothetical protein"
FT   misc_feature    80113..81192
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen2424_5946"
FT   misc_feature    order(80125..80127,80209..80211,80344..80346,80440..80442,
FT                   80506..80508)
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen2424_5946"
FT   misc_feature    order(80128..80130,80134..80142,80224..80238,80254..80256,
FT                   80260..80268,80272..80274,80278..80289,80341..80346,
FT                   80350..80364,80392..80400,80506..80508,80512..80517,
FT                   81055..81060,81067..81069,81178..81180,81184..81186,
FT                   81190..81192)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcen2424_5946"
FT   gene            complement(81228..82193)
FT                   /db_xref="GeneID:4454504"
FT                   /locus_tag="Bcen2424_5947"
FT   CDS_pept        complement(81228..82193)
FT                   /locus_tag="Bcen2424_5947"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5583 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:116686326"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4454504"
FT                   /translation="MERKSHVMSESRDVAKHRGELPPLNALRAFDAVARHGSFAGAAAE
FT                   LHVTHWAVGKQIRLLEDWFGLPLFDRRPRGVALTDEGAALLNDVSHAFERLGTAVVRLR
FT                   HNTFTHRISGVVRVNVPMSFAFCWLLPRLADFHSRYPDIDVRVSTTSRKLRYVADAFDI
FT                   GVRSGPEQGAGVVSRPLMPDLRVPACNPALLRQHPIQSVADLRHHTLLHSATTRSAWSH
FT                   WLKEAGASDLRAARHVEFDHVNLQLGAAIEGLGVALASLPLIGRDLAEGRLVCPIASPV
FT                   WRADDYMLVTNADRADDAAVSAFEEWMEGMASRQGGTTPE"
FT                   /protein_id="YP_839573.1"
FT   misc_feature    complement(81252..82133)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:170976"
FT                   /locus_tag="Bcen2424_5947"
FT   misc_feature    complement(81948..82124)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcen2424_5947"
FT   misc_feature    complement(81270..81851)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen2424_5947"
FT   misc_feature    complement(order(81747..81767,81771..81824,81828..81851))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen2424_5947"
FT   misc_feature    complement(order(81405..81407,81465..81473,81822..81824,
FT                   81828..81833))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcen2424_5947"
FT   gene            82311..83531
FT                   /db_xref="GeneID:4454505"
FT                   /locus_tag="Bcen2424_5948"
FT   CDS_pept        82311..83531
FT                   /locus_tag="Bcen2424_5948"
FT                   /gene_family="HOG000266504" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcn:Bcen_5584 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:116686327"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4454505"
FT                   /translation="MRLPVFSPPVTRETAPPRRRALWLSCVAHAMHDGYTDMIYALLPV
FT                   WQSEFGLDFAALAILRGVYAGTMATLQLSAGRLAQRLGSRATLALGTLLAALGYALAGM
FT                   SGGLLGLGVALAISGGGSSTQHPIASGAVSRFYGRDARGPLSIYNFSGDLGKSALPAAI
FT                   SLLVTLMPWRHALWIVAGLGCVVAAVIALWFPAVPRGGANTTAKEHASAQRGGTGKSGF
FT                   SALFSIGVLDTAVRMGLLTFLPFLLKAKGVSPQLLGTALALVFIGGAAGKFMCGWLGAR
FT                   LGMVRTVLLTEGGTAACIIAVMYLPLAPSMVLLPILGMMLNGTSSVLYGTVPELSAPER
FT                   TERAFAIFYTGTIASGALSPVLYGFLGDRIGVHGATYATALTALAIFPLALALRPHLAD
FT                   DPTGGTP"
FT                   /protein_id="YP_839574.1"
FT   misc_feature    82374..83432
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5948"
FT   misc_feature    order(82416..82418,82425..82433,82437..82442,82491..82493,
FT                   82500..82505,82512..82514,82524..82529,82533..82538,
FT                   82674..82679,82686..82691,82698..82703,82710..82712,
FT                   82743..82748,82755..82760,82776..82778,83004..83006,
FT                   83013..83018,83025..83030,83037..83039,83079..83081,
FT                   83091..83093,83103..83105,83112..83114,83124..83126,
FT                   83262..83264,83271..83276,83283..83285,83295..83300,
FT                   83307..83309,83340..83345,83352..83357,83364..83369,
FT                   83376..83378)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcen2424_5948"
FT   gene            83528..84424
FT                   /db_xref="GeneID:4454506"
FT                   /locus_tag="Bcen2424_5949"
FT   CDS_pept        83528..84424
FT                   /locus_tag="Bcen2424_5949"
FT                   /gene_family="HOG000050226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein; KEGG: bcn:Bcen_5585
FT                   2-dehydropantoate 2-reductase"
FT                   /db_xref="GI:116686328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="GeneID:4454506"
FT                   /translation="MTKSGYPSVALVGPGAIGTTVAAALHEAGRTPVICGRSAHAELKL
FT                   RFDGGEIVVPGPVLTDPQAVKETVDLVFVAVKSTQTASAAPWVAALCDANTVICVLQNG
FT                   VEQKAAFAPYAAGAAIVPSVVWFPAQRESGASVWLRAKPRLTLPDTPASNVVVSALRGT
FT                   RCAPEVAEDFISLAWRKLLQNAVAGLMVLTGRRAGMFSRSDITELSLAYLKECLAVARA
FT                   EGAKLGDEVPQEIVDAFHGFPPDLGTSILADRQGNHPLEWDCRNGVVQRYGRTHGIPTP
FT                   ISDLVVPLLAAASDGPG"
FT                   /transl_table="11"
FT                   /protein_id="YP_839575.1"
FT   sig_peptide     83528..83596
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.542 at
FT                   residue 23"
FT                   /locus_tag="Bcen2424_5949"
FT                   /product="2-dehydropantoate 2-reductase"
FT   misc_feature    83546..84421
FT                   /note="2-dehydropantoate 2-reductase; Provisional; Region:
FT                   PRK12921"
FT                   /db_xref="CDD:171816"
FT                   /locus_tag="Bcen2424_5949"
FT   misc_feature    83552..83980
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcen2424_5949"
FT   misc_feature    84041..84403
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="Bcen2424_5949"
FT   gene            complement(84559..85158)
FT                   /db_xref="GeneID:4454507"
FT                   /locus_tag="Bcen2424_5950"
FT   CDS_pept        complement(84559..85158)
FT                   /locus_tag="Bcen2424_5950"
FT                   /gene_family="HOG000266525" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bcn:Bcen_5586
FT                   ThiJ/PfpI"
FT                   /db_xref="GI:116686329"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:4454507"
FT                   /translation="MHIAIVTFQGFNELDSLIALGVLNRIRKPGWRVTLACPEPSVTSM
FT                   NGITVHAQSTLADACTADAVIIGSGIQTRDVVNDAALMAQLRFDPARQLIGAQCSGTLI
FT                   LAKLGLLGTIPACTDLTTKPWVIEAGVDVLNQPFFARGNVATAGGCLASPYLAAWLIAR
FT                   LEGEDAARGALHYVAPVGEKDEYVSRALTNIKPYLR"
FT                   /protein_id="YP_839576.1"
FT   misc_feature    complement(84646..85152)
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain; Region: GAT_1; cl00020"
FT                   /db_xref="CDD:173987"
FT                   /locus_tag="Bcen2424_5950"
FT   misc_feature    complement(84862..84864)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153222"
FT                   /locus_tag="Bcen2424_5950"
FT   gene            85568..86725
FT                   /db_xref="GeneID:4454508"
FT                   /locus_tag="Bcen2424_5951"
FT   CDS_pept        85568..86725
FT                   /locus_tag="Bcen2424_5951"
FT                   /gene_family="HOG000266526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5587 hypothetical protein"
FT                   /db_xref="GI:116686330"
FT                   /db_xref="GeneID:4454508"
FT                   /translation="MNNIIKSALCAAFVPFVLAGCGGGDDGGGTQTGTLHVAMTDAPSC
FT                   GFDHVYVTVSQVRVNANANAADNDAGWSTVSLATPQKIDLLSLTNGVLADLGQTALPAG
FT                   QYQQVRLVLAQNQGNNLANSVVPTGGVEQALATPSATQSGYKIIQPFTVQPNTLVDLVL
FT                   DFNACKSIVQRGNGSYALKPVVTAIPTVVSGAISGYVASAEAGATVYAEQGGKVVRGTV
FT                   ADSSGKFVLSPLIQSSTQGNYDVVIVQNNFASGIVRSVPVVVNTTTAVSASTAPITLPA
FT                   STTSTVSGTVTASVNAFVRALQTVDANAYEITSINANMDTGAYSLSVPAAAPIVGTYSG
FT                   SLPVALAAAPAAAGQYTIEADAASGATQSANVNATTSQSNVNFSF"
FT                   /protein_id="YP_839577.1"
FT   sig_peptide     85568..85642
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.458 at
FT                   residue 25"
FT                   /locus_tag="Bcen2424_5951"
FT                   /product="hypothetical protein"
FT   gene            86785..86946
FT                   /db_xref="GeneID:4454509"
FT                   /locus_tag="Bcen2424_5952"
FT   CDS_pept        86785..86946
FT                   /locus_tag="Bcen2424_5952"
FT                   /gene_family="HOG000266539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5588 putative lipoprotein"
FT                   /db_xref="GI:116686331"
FT                   /db_xref="GeneID:4454509"
FT                   /translation="MKKGVIALLAAASMVGALSGCVAYVPGPPVVVAPQGGPGNGFCPP
FT                   GQAKKGNC"
FT                   /protein_id="YP_839578.1"
FT   sig_peptide     86785..86856
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 24"
FT                   /locus_tag="Bcen2424_5952"
FT                   /product="hypothetical protein"
FT   gene            complement(87028..87501)
FT                   /db_xref="GeneID:4454510"
FT                   /locus_tag="Bcen2424_5953"
FT   CDS_pept        complement(87028..87501)
FT                   /locus_tag="Bcen2424_5953"
FT                   /gene_family="HOG000109158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5589 hypothetical protein"
FT                   /db_xref="GI:116686332"
FT                   /db_xref="GeneID:4454510"
FT                   /translation="MEAAMQWITRQRPKIDRVACPWLIARFIDETPEFLYVPPGDVLRI
FT                   ANETGAIPYDIPGVELTHVGEQCSFDAFLDKYGLADDRALQHMARIIRGADTSRLDLTP
FT                   QSSGLYAISLGLSDMFSDDHDMLEHGLVMYDALYAWCRHCQAEGHAWPPKMAE"
FT                   /protein_id="YP_839579.1"
FT   misc_feature    complement(87076..87483)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcen2424_5953"
FT   gene            complement(87504..88676)
FT                   /db_xref="GeneID:4454682"
FT                   /locus_tag="Bcen2424_5954"
FT   CDS_pept        complement(87504..88676)
FT                   /locus_tag="Bcen2424_5954"
FT                   /gene_family="HOG000263790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bcn:Bcen_5590 chromate transporter"
FT                   /db_xref="GI:116686333"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4454682"
FT                   /translation="MNTHRDRPAYTLWQLTRYFAWLGATGFGGPVALAGYMHRDLVDTR
FT                   GWIADADYKEGLALAQLAPGPLAAQLAIYLGYVHYRIVGATLVGIAFVLPSFLMVVLLG
FT                   YAYTQFGGLTWMQSVFYGVGAAVIGIIAISARKLTAKSIGHDKLLWAIYLALVAVTVIT
FT                   ESEVAWLFLAAGLVVWFTRAPPKWLRQRRVNAVMALPVSATGAWLGIVDWPQLAQLAAF
FT                   FAKAGAFVFGSGLAIVPFLYGGVVTEHHWLNEKQFVDAVAVAMITPGPVVITVGFIGYL
FT                   VAGLPGACVAAAGTFLPCYLFTVLPAPYFKKYGRLPAILAFVDGVTAAAVGAITGSVIV
FT                   LARRSIVDVPTALMALAAIVLLVRFKKLSEPVVVGGAAVIGLIVYPLLHH"
FT                   /protein_id="YP_839580.1"
FT   misc_feature    complement(88080..88655)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcen2424_5954"
FT   misc_feature    complement(87564..88622)
FT                   /note="chromate transporter, chromate ion transporter (CHR)
FT                   family; Region: 2A51; TIGR00937"
FT                   /db_xref="CDD:162120"
FT                   /locus_tag="Bcen2424_5954"
FT   misc_feature    complement(<87720..87977)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcen2424_5954"
FT   gene            complement(88696..89658)
FT                   /db_xref="GeneID:4454683"
FT                   /locus_tag="Bcen2424_5955"
FT   CDS_pept        complement(88696..89658)
FT                   /locus_tag="Bcen2424_5955"
FT                   /gene_family="HOG000266560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative chromate resistance signal peptide
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5591 putative chromate resistance
FT                   signal peptide protein"
FT                   /db_xref="GI:116686334"
FT                   /db_xref="GeneID:4454683"
FT                   /translation="MNPVPTSWLLLIVSLPTSGATARMRIWRTVKALGCGALRDGAYLL
FT                   PAHAEQAAQLRELADEARNGDGQAWLLDVRADDPADEDAYKRLFDRAGDYAAWLAELSE
FT                   ARQTLPDLTAADLNRLQRRHARTYEAIRSIDFFPGETSLRAQAQWRDFTAAIEALRSPG
FT                   EPHAAQRGIPRRDPAQYQGRLWATRRHLWVDRVASAWLIRRFIDPHARFVWLDNLADCP
FT                   ADALGFDFDGAPFTHVGDRVSFEVLIASFGLDDNAGLVRLGAMVHALDVGGATVPEAGG
FT                   FEAILAGARKRLADDDALLMEIGAVLDSLYVHFRGNRNP"
FT                   /protein_id="YP_839581.1"
FT   sig_peptide     complement(89599..89658)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.472 at
FT                   residue 20"
FT                   /locus_tag="Bcen2424_5955"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(88714..89106)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcen2424_5955"
FT   gene            90021..90350
FT                   /db_xref="GeneID:4454684"
FT                   /locus_tag="Bcen2424_5956"
FT   CDS_pept        90021..90350
FT                   /locus_tag="Bcen2424_5956"
FT                   /gene_family="HOG000221269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5592 hypothetical protein"
FT                   /db_xref="GI:116686335"
FT                   /db_xref="GeneID:4454684"
FT                   /translation="MQLDGKRRPAHETAPMTIDPGSIPYYLVLRAGWPPYVLNSDRQVL
FT                   RRQASPLLLAFARTRGAIAHVDDSAWNGFSDSEGLTVVERRETGFFSLVAGNETERQLQ
FT                   LLTTL"
FT                   /protein_id="YP_839582.1"
FT   gene            90609..90941
FT                   /db_xref="GeneID:4454685"
FT                   /locus_tag="Bcen2424_5957"
FT   CDS_pept        90609..90941
FT                   /locus_tag="Bcen2424_5957"
FT                   /gene_family="HOG000221324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5593 hypothetical protein"
FT                   /db_xref="GI:116686336"
FT                   /db_xref="GeneID:4454685"
FT                   /translation="MCSPMRLVVAERQEFVMSMHVYRGFEIYPLIYPHVAAPQGCPHNY
FT                   DAGFDAAVKICLRGTTDTLTQSQTFRLRDTAPFDNAGDARRASVRYAENIIDDNRGKQG
FT                   FFSSAG"
FT                   /protein_id="YP_839583.1"
FT   gene            90945..91199
FT                   /db_xref="GeneID:4454686"
FT                   /locus_tag="Bcen2424_5958"
FT   CDS_pept        90945..91199
FT                   /locus_tag="Bcen2424_5958"
FT                   /gene_family="HOG000266561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_5594 hypothetical protein"
FT                   /db_xref="GI:116686337"
FT                   /db_xref="GeneID:4454686"
FT                   /translation="MLAGATQFFGILEDEMIIDELLGLIRRNEVTRIDTVVPARIADSA
FT                   MCHQPELHMFMAVRALSIGAGYSEFESDEIASAVMTRLG"
FT                   /protein_id="YP_839584.1"
FT   gene            91233..91445
FT                   /db_xref="GeneID:4454687"
FT                   /locus_tag="Bcen2424_5959"