(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCJ_1

ID   BURCJ_1; SV 1; empty ; DNA; empty ; PRO; 3870082 BP.
XX
AC   NC_011000;
XX
PR   Project: 57953;
XX
DE   Burkholderia cenocepacia J2315 chromosome chromosome 1, complete sequence.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3870082
RX   PUBMED; 18931103.
RA   Holden,M.T., Seth-Smith,H.M., Crossman,L.C., Sebaihia,M., Bentley,S.D.,
RA   Cerdeno-Tarraga,A.M., Thomson,N.R., Bason,N., Quail,M.A., Sharp,S.,
RA   Cherevach,I., Churcher,C., Goodhead,I., Hauser,H., Holroyd,N., Mungall,K.,
RA   Scott,P., Walker,D., White,B., Rose,H., Iversen,P., Mil-Homens,D.,
RA   Rocha,E.P., Fialho,A.M., Baldwin,A., Dowson,C., Barrell,B.G., Govan,J.R.,
RA   Vandamme,P., Hart,C.A., Mahenthiralingam,E. and Parkhill,J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191 (1), 261-277 (2009)
XX
RN   [2]
RP   1-3870082
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-SEP-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3870082
RA   Holden,M.T.G.;
RT   "Direct Submission";
RL   Submitted (20-JUN-2007) Holden M.T.G., The Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, The Wellcome Trust Genome Campus, CB10
RL   1SA, UNITED KINGDOM
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM747720.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3870082
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216591"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /strain="J2315"
FT                   /organism="Burkholderia cenocepacia J2315"
FT                   /chromosome="1"
FT   gene            431..1645
FT                   /db_xref="GeneID:6930672"
FT                   /locus_tag="BCAL0001"
FT   CDS_pept        431..1645
FT                   /locus_tag="BCAL0001"
FT                   /gene_family="HOG000253763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558404"
FT                   /db_xref="UniProtKB/TrEMBL:B3KYE3"
FT                   /db_xref="GeneID:6930672"
FT                   /translation="MKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDASTDETSRLLMDVALGLLLFELGSRLDLRWIRRNPWLVASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPLYLLAGSFIVAYLVARSCNYLFRH
FT                   MTATMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWGDIALGGLLAIVLIVTRLVAKLAGVVAFAKPSGLGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCSIVILQLVSPFVVYRCLSAVGE
FT                   RSDGN"
FT                   /protein_id="YP_001989035.1"
FT   misc_feature    548..1501
FT                   /note="Sodium/hydrogen exchanger family; Region:
FT                   Na_H_Exchanger; pfam00999"
FT                   /db_xref="CDD:144551"
FT                   /locus_tag="BCAL0001"
FT   misc_feature    join(473..541,560..628,770..838,899..958,1001..1069,
FT                   1127..1222,1265..1333,1346..1414,1442..1501,1535..1603)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAL0001 by TMHMM2.0 at aa 15-37, 44-66, 114-136, 157-176,
FT                   191-213, 233-264, 279-301, 306-328, 338-357 and 369-391"
FT                   /locus_tag="BCAL0001"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    479..1603
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
FT                   family, score 8.4e-11"
FT                   /locus_tag="BCAL0001"
FT                   /inference="protein motif:HMMPfam:PF00999"
FT   gene            1660..2775
FT                   /db_xref="GeneID:6930673"
FT                   /locus_tag="BCAL0002"
FT   CDS_pept        1660..2775
FT                   /locus_tag="BCAL0002"
FT                   /gene_family="HOG000220942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxylate-amine ligase"
FT                   /transl_table="11"
FT                   /note="ATP-dependent; carboxylate-amine ligase with weak
FT                   glutamate--cysteine ligase activity"
FT                   /db_xref="GI:206558405"
FT                   /db_xref="GeneID:6930673"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHSHEQAVSELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFVLTWDSFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLTDRPLKLSEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAALGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT                   /protein_id="YP_002229165.1"
FT   misc_feature    1660..2772
FT                   /note="Glutamate-cysteine ligase family 2(GCS2); Region:
FT                   GCS2; cl00954"
FT                   /db_xref="CDD:174478"
FT                   /locus_tag="BCAL0002"
FT   misc_feature    1696..2541
FT                   /note="uncharacterized enzyme; Region: gshA_cyan_rel;
FT                   TIGR02050"
FT                   /db_xref="CDD:162674"
FT                   /locus_tag="BCAL0002"
FT   misc_feature    1696..2535
FT                   /note="HMMPfam hit to PF04107, Glutamate-cysteine ligase
FT                   family 2(GCS2), score 1.3e-60"
FT                   /locus_tag="BCAL0002"
FT                   /inference="protein motif:HMMPfam:PF04107"
FT   gene            3283..3921
FT                   /db_xref="GeneID:6930674"
FT                   /locus_tag="BCAL0003"
FT   CDS_pept        3283..3921
FT                   /locus_tag="BCAL0003"
FT                   /gene_family="HOG000253784" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MarR family regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558406"
FT                   /db_xref="GeneID:6930674"
FT                   /translation="MSEGVYGNQAAGRVTHSLLRLSTAMRSEAWDWAEGAGLTPTQGEI
FT                   LVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLETKGLVEKRRALDDGRALAVRLSAR
FT                   GRTAAKKALQWPEFLTKAVGKLGADEQGTLYRALLKTLRELQVAGATPPQRMCLTCTHF
FT                   QPGKPSKKTVHHCAALDIAMSDSDLRLDCSVQEEADAATQKKTWKIFAG"
FT                   /protein_id="YP_002229166.1"
FT   misc_feature    3343..3714
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   MarR; COG1846"
FT                   /db_xref="CDD:32031"
FT                   /locus_tag="BCAL0003"
FT   misc_feature    3391..3624
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BCAL0003"
FT   misc_feature    3394..3606
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.1e-12"
FT                   /locus_tag="BCAL0003"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    3397..3543
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 1.4e-05"
FT                   /locus_tag="BCAL0003"
FT                   /inference="protein motif:HMMPfam:PF01022"
FT   gene            3950..4660
FT                   /db_xref="GeneID:6930675"
FT                   /locus_tag="BCAL0004"
FT   CDS_pept        3950..4660
FT                   /locus_tag="BCAL0004"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase"
FT                   /transl_table="11"
FT                   /note="Catalyzes the transfer of the ammonia group from
FT                   glutamine to a new carbon-nitrogen group"
FT                   /db_xref="GI:206558407"
FT                   /db_xref="GeneID:6930675"
FT                   /translation="MNAEVVAIRHVHFEDLGSFEQVLGERGRRVRYVDVGSSRVEVLDV
FT                   LEPSLLVVLGGPLSVYDDAQYPTIAPLLALVRQRIDAGLPILGICLGAQFIARALGARV
FT                   YPAAQHELGWAPLTLTDAGRASPLRHLDGATTSMLHWHGDTFDLPGGAIHLASTPACRH
FT                   QAFAWGQHVLALQCHPEIRTDRFEPWLIANAGEIAATPGVDARQLRADTAQHGPVLEAA
FT                   ARRMFAEWLGSVGL"
FT                   /protein_id="YP_002229167.1"
FT   misc_feature    3959..4543
FT                   /note="GMP synthase - Glutamine amidotransferase domain
FT                   [Nucleotide transport and metabolism]; Region: GuaA;
FT                   COG0518"
FT                   /db_xref="CDD:30864"
FT                   /locus_tag="BCAL0004"
FT   misc_feature    3971..4507
FT                   /note="Subgroup of proteins having the Type 1 glutamine
FT                   amidotransferase (GATase1) domain; Region: GATase1_1;
FT                   cd01741"
FT                   /db_xref="CDD:153212"
FT                   /locus_tag="BCAL0004"
FT   misc_feature    order(4217..4219,4481..4483,4487..4489)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153212"
FT                   /locus_tag="BCAL0004"
FT   misc_feature    3983..4543
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 4.3e-13"
FT                   /locus_tag="BCAL0004"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   misc_feature    4202..4237
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /locus_tag="BCAL0004"
FT                   /inference="protein motif:Prosite:PS00442"
FT   gene            4871..5983
FT                   /db_xref="GeneID:6930676"
FT                   /locus_tag="BCAL0005"
FT   CDS_pept        4871..5983
FT                   /locus_tag="BCAL0005"
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558408"
FT                   /db_xref="GeneID:6930676"
FT                   /translation="MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGHL
FT                   ALSGAGLLCIEATAVEPDGRITHGDLGLWDDVTEAALKPVLAAIRKHSPVRIAMQLSHA
FT                   GRKASSAAPWEGGQLVPVADGGWLPHGPSAVPHKDGETPPLALDAAGLNRIREAFAASA
FT                   KRAARLGIDAIEVHAAHGYLLHQFLSPLANQRTDEYGGSRDNRMRFPLEIFEIVRAAFP
FT                   EDQPVGVRVSATDWVEGGWELDDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPLSPGYQ
FT                   VPFAQAVKRAVGMPTIAVGLINEPAHANRLIEAGDADFVAMARAMLYDPRWPWHAAAEL
FT                   GAQVTAPPQYWRSQPREHKALFGDVAFGQR"
FT                   /protein_id="YP_002229168.1"
FT   misc_feature    4871..5893
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    4880..5887
FT                   /note="Old yellow enzyme (OYE) YqjM-like FMN binding
FT                   domain. YqjM is involved in the oxidative stress response
FT                   of Bacillus subtilis.  Like the other OYE members, each
FT                   monomer of YqjM contains FMN as a non-covalently bound
FT                   cofactor and uses NADPH as a reducing...; Region:
FT                   OYE_YqiM_FMN; cd02932"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    order(4934..4939,4943..4945,4949..4951,5039..5041,
FT                   5168..5170,5399..5401,5408..5410,5414..5416,5558..5560,
FT                   5660..5662,5711..5713,5768..5773,5831..5833,5837..5845,
FT                   5852..5854)
FT                   /note="active site"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    order(4934..4939,4943..4945,5039..5041,5168..5170,
FT                   5399..5401,5408..5410,5558..5560,5660..5662,5711..5713,
FT                   5768..5773,5831..5833,5837..5845,5852..5854)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    order(4943..4945,4949..4951,5399..5401,5408..5410,
FT                   5414..5416)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    order(4946..4948,4976..4981,4985..4990,4997..4999,
FT                   5009..5011,5708..5710,5714..5716,5771..5773,5789..5791,
FT                   5858..5863)
FT                   /note="homotetramer interface; other site"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    5414..5416
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:73380"
FT                   /locus_tag="BCAL0005"
FT   misc_feature    4877..5899
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidas, score 4.2e-68"
FT                   /locus_tag="BCAL0005"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   gene            6161..6691
FT                   /db_xref="GeneID:6930677"
FT                   /locus_tag="BCAL0006"
FT   CDS_pept        6161..6691
FT                   /locus_tag="BCAL0006"
FT                   /gene_family="HOG000253795" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative protein lysine methyltransferase
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558409"
FT                   /db_xref="GeneID:6930677"
FT                   /translation="MSSRRIAVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEALR
FT                   RHPHDPSEPNHTFYFALDEGGVIDGKIDGNSARWINHSCAPNCEAEEVKGRVYIHALRD
FT                   IEPEEELFYDYGLVIDAKLTKKLKREYACHCGAESCRGTLLATSDEGGKKKKKKDKKDG
FT                   KSASGSKDKKHKK"
FT                   /protein_id="YP_002229169.1"
FT   misc_feature    6203..6508
FT                   /note="SET domain; Region: SET; cl02566"
FT                   /db_xref="CDD:154986"
FT                   /locus_tag="BCAL0006"
FT   misc_feature    6161..6529
FT                   /note="HMMPfam hit to PF00856, SET domain, score 1.3e-24"
FT                   /locus_tag="BCAL0006"
FT                   /inference="protein motif:HMMPfam:PF00856"
FT   gene            complement(6845..8329)
FT                   /db_xref="GeneID:6930678"
FT                   /locus_tag="BCAL0007"
FT   CDS_pept        complement(6845..8329)
FT                   /locus_tag="BCAL0007"
FT                   /gene_family="HOG000223178" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component regulatory system, sensor kinase
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558410"
FT                   /db_xref="GeneID:6930678"
FT                   /translation="MSPDPAVTTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHV
FT                   IDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKL
FT                   PLQGINVRRMHHAYVFEAEYDNRAVRVAQVRVDDVEGGKPMVVEVAQPVRHRYRIAAEF
FT                   LVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRP
FT                   LTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDPHQTFAAVRE
FT                   LRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALASHVDLGF
FT                   QRSDDPGDDEKLIVRGNPVLLREVIANLLDNALKYVPLARPDGARITVNVARAALEGNQ
FT                   PAAEIVVEDNGPGVPANQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGTV
FT                   SYEDAPEGGSRFVVRVPLAARTEKPASETPAAAPTH"
FT                   /protein_id="YP_002229170.1"
FT   sig_peptide     complement(8228..8329)
FT                   /note="Signal peptide predicted for BCAL0007 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.871) with cleavage site
FT                   probability 0.792 between residues 34 and 35"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(7838..8239)
FT                   /note="Two-component sensor kinase N-terminal; Region:
FT                   2CSK_N; pfam08521"
FT                   /db_xref="CDD:149540"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(6887..7897)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(7427..7618)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(order(7442..7444,7454..7456,7463..7465,
FT                   7475..7477,7484..7486,7496..7498,7544..7546,7553..7555,
FT                   7565..7567,7574..7576,7586..7588,7598..7600))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(7580..7582)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(6908..7249)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(order(6920..6922,6926..6931,6944..6946,
FT                   6950..6952,6998..7009,7091..7096,7100..7102,7106..7108,
FT                   7112..7114,7208..7210,7217..7219,7229..7231))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(7217..7219)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(order(7001..7003,7007..7009,7094..7096,
FT                   7100..7102))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BCAL0007"
FT   misc_feature    complement(6899..7264)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.6e-36"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(7415..7612)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 3.6e-14"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(7622..7831)
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.7e-06"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(join(7781..7849,8213..8272))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAL0007 by TMHMM2.0 at aa 20-39 and 161-183"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(7838..8266)
FT                   /note="HMMPfam hit to PF08521, Two-component sensor kinase
FT                   N-terminal, score 3.8e-48"
FT                   /locus_tag="BCAL0007"
FT                   /inference="protein motif:HMMPfam:PF08521"
FT   gene            complement(8450..9142)
FT                   /db_xref="GeneID:6930679"
FT                   /locus_tag="BCAL0008"
FT   CDS_pept        complement(8450..9142)
FT                   /locus_tag="BCAL0008"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component regulatory system, response
FT                   regulator protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558411"
FT                   /db_xref="GeneID:6930679"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQTASV"
FT                   /protein_id="YP_002229171.1"
FT   misc_feature    complement(8474..9142)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(8795..9133)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(order(8837..8842,8849..8851,8906..8908,
FT                   8966..8968,8990..8992,9119..9124))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(8990..8992)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(order(8966..8974,8978..8983))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(8834..8842)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(8480..8755)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(order(8489..8491,8504..8506,8531..8536,
FT                   8558..8560,8567..8569,8621..8626,8681..8683))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BCAL0008"
FT   misc_feature    complement(8480..8701)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1.5e-22"
FT                   /locus_tag="BCAL0008"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(8804..9142)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6.5e-36"
FT                   /locus_tag="BCAL0008"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   gene            9265..9495
FT                   /db_xref="GeneID:6930680"
FT                   /locus_tag="BCAL0008A"
FT   CDS_pept        9265..9495
FT                   /locus_tag="BCAL0008A"
FT                   /gene_family="HOG000146509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206558412"
FT                   /db_xref="GeneID:6930680"
FT                   /translation="MSDISIHDLEAAINFWRARSPSSGDELKLCEEASALSKPYALLIV
FT                   QRESALQLEGLDPKARKAYETYVRLKDGLES"
FT                   /protein_id="YP_002229172.1"
FT   misc_feature    9265..9468
FT                   /note="Protein of unknown function (DUF3717); Region:
FT                   DUF3717; pfam12512"
FT                   /db_xref="CDD:152946"
FT                   /locus_tag="BCAL0008A"
FT   gene            complement(9588..9896)
FT                   /db_xref="GeneID:6930681"
FT                   /locus_tag="BCAL0009"