(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCJ_2

ID   BURCJ_2; SV 1; empty ; DNA; empty ; PRO; 3217062 BP.
XX
AC   NC_011001;
XX
PR   Project: 57953;
XX
DE   Burkholderia cenocepacia J2315 chromosome chromosome 2, complete sequence.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3217062
RX   PUBMED; 18931103.
RA   Holden,M.T., Seth-Smith,H.M., Crossman,L.C., Sebaihia,M., Bentley,S.D.,
RA   Cerdeno-Tarraga,A.M., Thomson,N.R., Bason,N., Quail,M.A., Sharp,S.,
RA   Cherevach,I., Churcher,C., Goodhead,I., Hauser,H., Holroyd,N., Mungall,K.,
RA   Scott,P., Walker,D., White,B., Rose,H., Iversen,P., Mil-Homens,D.,
RA   Rocha,E.P., Fialho,A.M., Baldwin,A., Dowson,C., Barrell,B.G., Govan,J.R.,
RA   Vandamme,P., Hart,C.A., Mahenthiralingam,E. and Parkhill,J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191 (1), 261-277 (2009)
XX
RN   [2]
RP   1-3217062
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-SEP-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3217062
RA   Holden,M.T.G.;
RT   "Direct Submission";
RL   Submitted (20-JUN-2007) Holden M.T.G., The Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, The Wellcome Trust Genome Campus, CB10
RL   1SA, UNITED KINGDOM
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM747721.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3217062
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216591"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /strain="J2315"
FT                   /organism="Burkholderia cenocepacia J2315"
FT                   /chromosome="2"
FT   gene            230..829
FT                   /db_xref="GeneID:6927816"
FT                   /locus_tag="BCAM0001"
FT   CDS_pept        230..829
FT                   /locus_tag="BCAM0001"
FT                   /gene_family="HOG000220918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor"
FT                   /transl_table="11"
FT                   /note="Bacteria have multiple sigma factors which are
FT                   active under specific conditions; the sigma factor binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription"
FT                   /db_xref="GI:206561869"
FT                   /db_xref="UniProtKB/TrEMBL:B3KYE4"
FT                   /db_xref="GeneID:6927816"
FT                   /translation="MPSAYDDPTYLAQLRRDLLRFARLQLRDADAAEDAVQEALAAAWS
FT                   HAGDFAGQSAHKTWVFGILRNKLIDVLRARQRMVSLTALDAELDGESVLDRELFKDNGH
FT                   WAAHAKPRPWPKPETLLQQQQFWTLFQACLDQLPEQIGRVFMMREFLDVEIVDICSELT
FT                   LTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEMY"
FT                   /protein_id="YP_001989036.1"
FT   misc_feature    230..823
FT                   /note="RNA polymerase sigma factor; Provisional; Region:
FT                   PRK12545"
FT                   /db_xref="CDD:139054"
FT                   /locus_tag="BCAM0001"
FT   misc_feature    257..463
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   1.7e-12"
FT                   /locus_tag="BCAM0001"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   misc_feature    596..628
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAM0001"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    608..769
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   5.8e-05"
FT                   /locus_tag="BCAM0001"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   gene            831..1022
FT                   /db_xref="GeneID:6927817"
FT                   /locus_tag="BCAM0001A"
FT   CDS_pept        831..1022
FT                   /locus_tag="BCAM0001A"
FT                   /gene_family="HOG000220932" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561870"
FT                   /db_xref="GeneID:6927817"
FT                   /translation="MTRLLSDALDRRLTLHERLQVRVHLPTCSGCRAYRGQIALLRTAA
FT                   KAAAGREPDGDDGSSGGG"
FT                   /protein_id="YP_002232633.1"
FT   gene            complement(1160..1516)
FT                   /db_xref="GeneID:6927818"
FT                   /locus_tag="BCAM0002"
FT   CDS_pept        complement(1160..1516)
FT                   /locus_tag="BCAM0002"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsC family arsenate reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561871"
FT                   /db_xref="GeneID:6927818"
FT                   /translation="MITIYHNPRCSKSRETLALVESLNTAGAPLNVVEYLKTPPTVEEL
FT                   DTLHKQLGRPVRDMLRDGEEPYKALNLARADLTDAEAYGAIVAHPVLLQRPIVVYRGKA
FT                   AIGRPPESVKALFE"
FT                   /protein_id="YP_002232634.1"
FT   misc_feature    complement(1169..1513)
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="BCAM0002"
FT   misc_feature    complement(order(1193..1195,1232..1234,1334..1336,
FT                   1487..1489))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="BCAM0002"
FT   misc_feature    complement(1163..1504)
FT                   /note="HMMPfam hit to PF03960, ArsC family, score 2.1e-34"
FT                   /locus_tag="BCAM0002"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   gene            2538..3200
FT                   /db_xref="GeneID:6927819"
FT                   /locus_tag="BCAM0003"
FT   CDS_pept        2538..3200
FT                   /locus_tag="BCAM0003"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative partition protein ParA"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561872"
FT                   /db_xref="GeneID:6927819"
FT                   /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADRQNT
FT                   LVHWSSASGDSDNGIPFPVVNLAEADGQIHREIKKFINDYDIIVVDCPPSITEKVSGVV
FT                   LLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKR
FT                   ALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGGKLAAAEIRACADEIVAMLP"
FT                   /protein_id="YP_002232635.1"
FT   misc_feature    2550..3185
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="BCAM0003"
FT   misc_feature    2550..2981
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAM0003"
FT   misc_feature    2571..2591
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAM0003"
FT   misc_feature    order(2589..2591,2808..2810)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAM0003"
FT   misc_feature    2553..3092
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 9.2e-18"
FT                   /locus_tag="BCAM0003"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   gene            3224..4285
FT                   /db_xref="GeneID:6927820"
FT                   /locus_tag="BCAM0004"
FT   CDS_pept        3224..4285
FT                   /locus_tag="BCAM0004"
FT                   /gene_family="HOG000220933" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative partitioning protein ParB"
FT                   /transl_table="11"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   partitioning protein parB SWALL:Q8XTV0 (EMBL:AL646076) (334
FT                   aa) fasta scores: E(): 4.7e-19, 28.71% id in 310 aa;
FT                   homology does not extend to the N terminus"
FT                   /db_xref="GI:206561873"
FT                   /db_xref="GeneID:6927820"
FT                   /translation="MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSETPTPAPT
FT                   KSAKKDIAPPPAPEFTIDPSIDESQQYRAWRLENRYAPGQVIELPLKAIKHSPFNPRHF
FT                   YLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIVI
FT                   DVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELSEHLGLDESTVAV
FT                   ALSIGKLPEAIMQEMVARPDRFGSNMAYQVGRYHNARGTEATLRLINKIVSDDLSTRQV
FT                   SDIVKGRVAAQETPKPAGRQRYAQRLEIKLGGKSVGDLKSYGEDRIELRLRGLPKDKRD
FT                   AILEQLERMLLSE"
FT                   /protein_id="YP_002232636.1"
FT   misc_feature    3473..4171
FT                   /note="Stage 0 sporulation protein J (antagonist of Soj)
FT                   containing ParB-like nuclease domain [Transcription];
FT                   Region: Spo0J; COG1475"
FT                   /db_xref="CDD:31664"
FT                   /locus_tag="BCAM0004"
FT   misc_feature    3482..3724
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="BCAM0004"
FT   misc_feature    3482..3763
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 1.4e-11"
FT                   /locus_tag="BCAM0004"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   misc_feature    3833..3898
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1577.000, SD 4.56 at aa 204-225, sequence
FT                   QSQKELSEHLGLDESTVAVALS"
FT                   /locus_tag="BCAM0004"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   gene            complement(4378..5745)
FT                   /db_xref="GeneID:6927821"
FT                   /locus_tag="BCAM0005"
FT   CDS_pept        complement(4378..5745)
FT                   /locus_tag="BCAM0005"
FT                   /gene_family="HOG000220945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative replication protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561874"
FT                   /db_xref="GeneID:6927821"
FT                   /translation="MATTKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKL
FT                   FNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSS
FT                   QKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLR
FT                   SSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLR
FT                   PAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVK
FT                   LGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAPALFKDALKKGYAPPVE
FT                   SVDALPAGTPSAKVAAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGDAEREVARESFES
FT                   EALPTMGSHLRDDWRKRGLDSKLAETAFFDWLAQKTWGEPTDGDLLSFTLNQSRAA"
FT                   /protein_id="YP_002232637.1"
FT   misc_feature    complement(4990..5643)
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:174750"
FT                   /locus_tag="BCAM0005"
FT   gene            complement(6784..6996)
FT                   /db_xref="GeneID:6927822"
FT                   /locus_tag="BCAM0005A"
FT   CDS_pept        complement(6784..6996)
FT                   /locus_tag="BCAM0005A"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="no significant database hits"
FT                   /db_xref="GI:206561875"
FT                   /db_xref="GeneID:6927822"
FT                   /translation="MEPALCLTAQFSACADIGENLQDPLHAPILPIFWADLAKGEVSRD
FT                   STGICCEDFREANAILHSKSALGGL"
FT                   /protein_id="YP_002232638.1"
FT   gene            7550..8731
FT                   /db_xref="GeneID:6927823"
FT                   /locus_tag="BCAM0006"
FT   CDS_pept        7550..8731
FT                   /locus_tag="BCAM0006"
FT                   /gene_family="HOG000220968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Contains coiled-coiled domains, residues 112 to 296"
FT                   /db_xref="GI:206561876"
FT                   /db_xref="GeneID:6927823"
FT                   /translation="MTLDEMRQVIREELESLRASGARRQELSLHACKRLFFDLGIRPSA
FT                   ANVRDLTQTGSASDIPKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEEAL
FT                   KAARDSLDGDREQVRADMAEAEQRLRDATVRQETLEGALARGEARNEQLQARVTELEVQ
FT                   LASQTTHGSASEATLLTTVARLEKELAAAAGRIEAEQAQNAALRDRIDALQAELQQRTE
FT                   HYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSSAKARA
FT                   DRLEEQLRTQSDELERATRDVSSLRANRGMNPEIAALIRRLAEAGQLDADAYAAIGTAL
FT                   DHEIPAPTQCPHCDGEPELSHGDEGFEVACPECEHASGTWPSRFEAVARFAHT"
FT                   /protein_id="YP_002232639.1"
FT   misc_feature    7622..7984
FT                   /note="Plasmid replication region DNA-binding N-term;
FT                   Region: KfrA_N; pfam11740"
FT                   /db_xref="CDD:152176"
FT                   /locus_tag="BCAM0006"
FT   misc_feature    <7871..8545
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="BCAM0006"
FT   gene            complement(8868..9887)
FT                   /db_xref="GeneID:6927824"
FT                   /locus_tag="BCAM0007"
FT   CDS_pept        complement(8868..9887)
FT                   /locus_tag="BCAM0007"
FT                   /gene_family="HOG000220979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phage integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561877"
FT                   /db_xref="GeneID:6927824"
FT                   /translation="MSLPAAPDTAAHPEEKDLFDRDASDWVASPEAAFDAWLAMQDYRR
FT                   SSADVYRAQWGAFLAWMRAHQKNLATVDTPTIANFVGELPIKKTQRMRYLRLIERVLDH
FT                   IRRTEYASTNPARFIAQDGEANWRKARDNEPTGFLTPAERATLLAYLFSPIGVSGSAYW
FT                   KERRDRALVAAFLGAGIKTGEARSLTISCINTSGTSLRIESTHPDYSRETHLASFAIAL
FT                   LEAWLTERKRQEIPGELVFPASHAGRPMHKATMLRAIDAIVESAGLTSSRTARASPQTL
FT                   RNTYAAELFEHDVPPERVGKWLGFMRPISSNRLHRAWKNWRDGLADHNGDASDRDETH"
FT                   /protein_id="YP_002232640.1"
FT   misc_feature    complement(9012..9806)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:166866"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(8976..9398)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(order(9042..9044,9051..9053,9270..9272,
FT                   9345..9347))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(order(9042..9044,9051..9053,9345..9347))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(order(9042..9044,9345..9347))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(order(9051..9056,9270..9272,9342..9347))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="BCAM0007"
FT   misc_feature    complement(8919..9437)
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 0.00032"
FT                   /locus_tag="BCAM0007"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   gene            complement(9990..10367)
FT                   /db_xref="GeneID:6927825"
FT                   /locus_tag="BCAM0008"
FT   CDS_pept        complement(9990..10367)
FT                   /locus_tag="BCAM0008"
FT                   /gene_family="HOG000220995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561878"
FT                   /db_xref="GeneID:6927825"
FT                   /translation="MTEEQDLAALSFKAAAHDLELIVRHIAGRYIRQRVPLTWRLLHAI
FT                   EAEALADLGFASRHDAGMRQLFERPSDMTFPETDDPIDFGRSNALPAVFSFAVLAYEAA
FT                   ATAHDTARPARALRPSKAWGD"
FT                   /protein_id="YP_002232641.1"
FT   misc_feature    complement(10074..10364)
FT                   /note="Protein of unknown function (DUF2471); Region:
FT                   DUF2471; pfam10616"
FT                   /db_xref="CDD:151139"
FT                   /locus_tag="BCAM0008"
FT   gene            complement(10509..11120)
FT                   /db_xref="GeneID:6927826"
FT                   /locus_tag="BCAM0009"
FT   CDS_pept        complement(10509..11120)
FT                   /locus_tag="BCAM0009"
FT                   /gene_family="HOG000263462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206561879"
FT                   /db_xref="GeneID:6927826"
FT                   /translation="MASSSGSRRPPAAAAPQPPAATPPRVGEQIQRLRNERKLTLDDLS
FT                   RAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKAPETIRVDGPHDIPT
FT                   LAGHDGRYQLRVWGPIDLAGKFEWYELTLPGGGALVSNAHEPGTREHLTVLQGAMEIEA
FT                   AAASRRLKTGDTARYPADEPHAIRNPGKAEARALLIVIHR"
FT                   /protein_id="YP_002232642.1"
FT   misc_feature    complement(10869..11042)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="BCAM0009"
FT   misc_feature    complement(order(10941..10943,11016..11018,11028..11030))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="BCAM0009"
FT   misc_feature    complement(order(10944..10946,11019..11021))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="BCAM0009"
FT   misc_feature    complement(order(10938..10943,10953..10955,10962..10964,
FT                   10995..11000))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="BCAM0009"
FT   misc_feature    complement(10521..10736)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BCAM0009"
FT   misc_feature    complement(10521..10736)
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 1.4e-11"
FT                   /locus_tag="BCAM0009"
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   misc_feature    complement(10869..11033)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5.1e-17"
FT                   /locus_tag="BCAM0009"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    complement(10941..11006)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1501.000, SD 4.30 at aa 39-60, sequence
FT                   LTLDDLSRAAGVSKSMLSEIER"
FT                   /locus_tag="BCAM0009"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   gene            11279..12478
FT                   /db_xref="GeneID:6927827"
FT                   /locus_tag="BCAM0010"