(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCJ_3

ID   BURCJ_3; SV 1; empty ; DNA; empty ; PRO; 875977 BP.
XX
AC   NC_011002;
XX
PR   Project: 57953;
XX
DE   Burkholderia cenocepacia J2315 chromosome chromosome 3, complete sequence.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-875977
RX   PUBMED; 18931103.
RA   Holden,M.T., Seth-Smith,H.M., Crossman,L.C., Sebaihia,M., Bentley,S.D.,
RA   Cerdeno-Tarraga,A.M., Thomson,N.R., Bason,N., Quail,M.A., Sharp,S.,
RA   Cherevach,I., Churcher,C., Goodhead,I., Hauser,H., Holroyd,N., Mungall,K.,
RA   Scott,P., Walker,D., White,B., Rose,H., Iversen,P., Mil-Homens,D.,
RA   Rocha,E.P., Fialho,A.M., Baldwin,A., Dowson,C., Barrell,B.G., Govan,J.R.,
RA   Vandamme,P., Hart,C.A., Mahenthiralingam,E. and Parkhill,J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191 (1), 261-277 (2009)
XX
RN   [2]
RP   1-875977
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-SEP-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-875977
RA   Holden,M.T.G.;
RT   "Direct Submission";
RL   Submitted (20-JUN-2007) Holden M.T.G., The Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, The Wellcome Trust Genome Campus, CB10
RL   1SA, UNITED KINGDOM
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM747722.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..875977
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216591"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /strain="J2315"
FT                   /organism="Burkholderia cenocepacia J2315"
FT                   /chromosome="3"
FT   gene            1..1317
FT                   /db_xref="GeneID:6407573"
FT                   /locus_tag="BCAS0001"
FT   CDS_pept        1..1317
FT                   /locus_tag="BCAS0001"
FT                   /gene_family="HOG000220945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:191639870"
FT                   /db_xref="GeneID:6407573"
FT                   /translation="MPRKPASKGSDKQVSLFQTPEPPDLLRKAVQAIHIAPKSGKIGLQ
FT                   QRKMFSSLIKNALRQEAFEPGRTSFSISIASLSHESGLNSNNTKYVKDTVNSLISTVVN
FT                   WDYLAADRSTVWKASGLLAGAELEQSVLKYSFSDQIRSELLNPEIYALIDMRIAREFRR
FT                   SHSLALWENTVRYEGIGITAKIPLPKFRDLILGQDKASQSYKEYKLFKSKVLVPCIQEV
FT                   NEVSDHTLELIEHKSGRSVEAVQFKVTRKQSTDTVEDGDVKNEALVEEVAKFGIPRSEA
FT                   RRLITQYGVQRIKAAIAYTLNRTTKKNATPVDNVAAYFRKALTHGYTLADGQGTETAAP
FT                   AKESAQSKQEQIRDKYLAAKVEEAGAYFRELEIDDQTKLIERYNETVAGSKDLTLSPKK
FT                   KASKLAQTSFFRWLALDTWGEPTSDDLLEFLLKSSLAGN"
FT                   /protein_id="YP_001989037.1"
FT   misc_feature    73..741
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:174750"
FT                   /locus_tag="BCAS0001"
FT   gene            complement(1413..2444)
FT                   /db_xref="GeneID:6804499"
FT                   /locus_tag="BCAS0002"
FT   CDS_pept        complement(1413..2444)
FT                   /locus_tag="BCAS0002"
FT                   /gene_family="HOG000267496" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative chromosome partitioning protein"
FT                   /transl_table="11"
FT                   /note="homology to YyaA doesn't extend to N and C termini"
FT                   /db_xref="GI:197294854"
FT                   /db_xref="GeneID:6804499"
FT                   /translation="MAKDTSKDKKPTGNLHLAAGLLRGLAQENAALETRLPEPTAAPAA
FT                   VVEATPASAPAAATPAGTADLGAPQKVLVKDCIPNPFNPRVFYSESSLHELALTLKREG
FT                   QIEPIKVTRLPEFPGKLVVIDGQRRLRATSINGDETINATFRTDHTPEQLYTIAYRANH
FT                   DHERQTIFDDAVAWKRLLDEKVFSDQNTLAEKIGKDKASISKTLSLNALPNTLLERMAS
FT                   ANDVVGLQAAYFLKLIYERLGEPTADRLLTAVIDRKKSVRDLENFLRAQSDGTKKAGRT
FT                   RYSVRHDFALESRAIGQLKTYPDGRLDLQLKGVDASHQEALADKLKTVIDAYVADLATA
FT                   TSK"
FT                   /protein_id="YP_002153395.1"
FT   misc_feature    complement(2007..2234)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="BCAS0002"
FT   misc_feature    complement(1767..2231)
FT                   /note="ParB-like partition proteins; Region: parB_part;
FT                   TIGR00180"
FT                   /db_xref="CDD:161748"
FT                   /locus_tag="BCAS0002"
FT   misc_feature    complement(1956..2237)
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 1.3e-10"
FT                   /locus_tag="BCAS0002"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   gene            complement(2437..3132)
FT                   /db_xref="GeneID:6804500"
FT                   /locus_tag="BCAS0003"
FT   CDS_pept        complement(2437..3132)
FT                   /locus_tag="BCAS0003"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParA protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294855"
FT                   /db_xref="GeneID:6804500"
FT                   /translation="MAFKIAVSNQKGGTGKTTISVNIAAAFEAGGNKVALIDADPQGTS
FT                   VRWVTSGENTLPMTVLSLAPAGRGIGGEIKKQDANFDVIVVDCPGNLEDPRIASVLEVA
FT                   DFCLVPLSPSPADLYSTVAMIRMIESMRAVRNPQLSSALMLNSVNGKTKMREEILKILR
FT                   AEEIGEHLLDSQIAQREVYRQTFALGTTIHHHNRYLKGLKEARAEIERLVTEMAQYIAS
FT                   TRATGAAHG"
FT                   /protein_id="YP_002153396.1"
FT   misc_feature    complement(2473..3120)
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="BCAS0003"
FT   misc_feature    complement(2695..3120)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAS0003"
FT   misc_feature    complement(3082..3102)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAS0003"
FT   misc_feature    complement(order(2872..2874,3082..3084))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="BCAS0003"
FT   misc_feature    complement(2581..3120)
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 1.5e-22"
FT                   /locus_tag="BCAS0003"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   repeat_region   3782..3797
FT                   /note="inverted repeat; palindrome"
FT   repeat_region   complement(4507..4522)
FT                   /note="inverted repeat; palindrome"
FT   repeat_region   complement(4763..5947)
FT                   /note="putative IS element - ISBcen8"
FT                   /mobile_element="insertion sequence:ISBcen8"
FT   gene            complement(4783..5748)
FT                   /db_xref="GeneID:6804501"
FT                   /locus_tag="BCAS0004"
FT   CDS_pept        complement(4783..5748)
FT                   /locus_tag="BCAS0004"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294856"
FT                   /db_xref="GeneID:6804501"
FT                   /translation="MSAPSAVTVGIDVAKAHVDVSVLGANLDIRRFNNDAEGHSALAVA
FT                   LQPLNVQLVVMEATGGYETELACALQGAGLPVAVVNPRQARDFARSMGRLAKTDAIDAR
FT                   MLAELASVLLRRDDLSRLLRPVPDERQQWLAALVTRRRQLLTMLLSERQRLQITPVGLH
FT                   SSLLAIIAAIQAQLDDIDAQMVAHVRQHFGELDRLLQSTHGIGPVSSACLIAELPELGR
FT                   LNRRQIAALVGVAPIACDSGLRNGRRRVQGGRFAIRRVLYMATLTATRYNPAIRAFYQR
FT                   LKAAGKLSKVALVACMRKLLTMLNAMVKTNTPWDDSLHRA"
FT                   /protein_id="YP_002153397.1"
FT   misc_feature    complement(4786..5724)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="BCAS0004"
FT   misc_feature    complement(5281..5541)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="BCAS0004"
FT   misc_feature    complement(4909..5160)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="BCAS0004"
FT   misc_feature    complement(4912..5241)
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family, score 2e-19"
FT                   /locus_tag="BCAS0004"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   misc_feature    complement(5113..5145)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0004"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(5233..5541)
FT                   /note="HMMPfam hit to PF01548, Transposase, score 2.9e-12"
FT                   /locus_tag="BCAS0004"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   gene            complement(6086..7102)
FT                   /db_xref="GeneID:6804502"
FT                   /locus_tag="BCAS0005"
FT   CDS_pept        complement(6086..7102)
FT                   /locus_tag="BCAS0005"
FT                   /gene_family="HOG000203205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294857"
FT                   /db_xref="GeneID:6804502"
FT                   /translation="MHPASARYISGQQDDDIAIAAFDQASHRSTGRSRENELRRTLAER
FT                   VARWTEGVDHLDTAIPNLSFHRREAPTQPMECMVEPSFGLVVQGAKRVMQSGDAYIYDA
FT                   DRFLITSLDLPGSTQIIEASPDKPFLGLGLKLDFRVMAELMMQVAPDHDDAPAGRGLVV
FT                   GDMTEPLYDALNRLLALLDDPHAIAVLGPYIEREIYYRLLTSDQGGRLRQIASTGSQCN
FT                   RVSRAIRWLRAHYDESLRVDDLAAQVQMSSSTFHHHFRQLTGMSPLQYQKWIRLNEARR
FT                   LMLAERLDAASAAFRVGYASPTQFNREYSRLFGNSPRRDIDSLRGGADVALSIVASY"
FT                   /protein_id="YP_002153398.1"
FT   misc_feature    complement(6470..6931)
FT                   /note="AraC-type transcriptional regulator N-terminus;
FT                   Region: AraC_N; pfam06719"
FT                   /db_xref="CDD:148365"
FT                   /locus_tag="BCAS0005"
FT   misc_feature    complement(6128..6436)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="BCAS0005"
FT   misc_feature    complement(6287..6412)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BCAS0005"
FT   misc_feature    complement(6287..6427)
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 1.7e-13"
FT                   /locus_tag="BCAS0005"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(6302..6436)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /locus_tag="BCAS0005"
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(6323..6388)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1047.000, SD 2.75 at aa 239-260, sequence
FT                   LRVDDLAAQVQMSSSTFHHHFR"
FT                   /locus_tag="BCAS0005"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(6470..6931)
FT                   /note="HMMPfam hit to PF06719, AraC-type transcriptional
FT                   regulator N-termin, score 2.8e-65"
FT                   /locus_tag="BCAS0005"
FT                   /inference="protein motif:HMMPfam:PF06719"
FT   gene            complement(7234..8358)
FT                   /db_xref="GeneID:6804503"
FT                   /locus_tag="BCAS0006"
FT   CDS_pept        complement(7234..8358)
FT                   /locus_tag="BCAS0006"
FT                   /gene_family="HOG000267494" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294858"
FT                   /db_xref="GeneID:6804503"
FT                   /translation="MASPLVLIHRILGFAAARRGRTLSGSSPQHDGERFANVAPRPAEG
FT                   LGKTLGIAWNMLVNKPRHTVPAGTLPVDSLTRAELEAAPDRSLYRLGHSTLLLKLRGEF
FT                   WLTDPVFAERASPFRRIGPKRFHAPPIALEDLPPLRGVILSHDHYDHLDRDTVLALAAT
FT                   TGVFVTTLGVGDRLIEWGIDANKVRQLDWWQSVDVAGVTLTATPAQHFSGRSLFDGNST
FT                   LWASWVIVDDDLRLFFSGDTGYFDGFREIGERLGPFDVTLIETGAYDTQWPYVHMQPEE
FT                   TVQAHIDLRGRWLIPIHNGTFDLAMHRWQEPFERVTALALVRGIELSTPRMGERLDLDT
FT                   PHRGERWWRTVDERAAAPAAKSRRWQFCTSQATK"
FT                   /protein_id="YP_002153399.1"
FT   misc_feature    complement(7339..8112)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="BCAS0006"
FT   gene            8442..9095
FT                   /db_xref="GeneID:6804504"
FT                   /locus_tag="BCAS0007"
FT   CDS_pept        8442..9095
FT                   /locus_tag="BCAS0007"
FT                   /gene_family="HOG000267483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294859"
FT                   /db_xref="GeneID:6804504"
FT                   /translation="MDTSTPPQRLTDRKRAAIVDAAIEEFLAAGYDATSMDRIAARADV
FT                   SKRTVYNHFPGKETLFAAILNKLWEATRTGSSPTYRADVPLREQLLALLDRKLRLMNDE
FT                   AFLALARVAIGAAIHSPERARDMVERLSEREEDLTVWVRAAAAAGRLSVTDPVFAAHQL
FT                   HGAVKAFAFWPQITMGQPPLTAQEQQKVAESAADMFLAYYARPDDGVAPHRQQD"
FT                   /protein_id="YP_002153400.1"
FT   misc_feature    8493..8633
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="BCAS0007"
FT   misc_feature    8493..8633
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2.1e-20"
FT                   /locus_tag="BCAS0007"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    8541..8606
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1610.000, SD 4.67 at aa 34-55, sequence
FT                   TSMDRIAARADVSKRTVYNHFP"
FT                   /locus_tag="BCAS0007"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   gene            9291..9782
FT                   /db_xref="GeneID:6804505"
FT                   /locus_tag="BCAS0008"
FT   CDS_pept        9291..9782
FT                   /locus_tag="BCAS0008"
FT                   /gene_family="HOG000030538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294860"
FT                   /db_xref="GeneID:6804505"
FT                   /translation="MKTLLIVYHTMTGGTQQMAAAAAAAAREQPGVDVRLQRADATSAA
FT                   DVLAADAYLFATPENLAAMSGLMKDFFDRCYYAALDRVNGRPYAAMICAGSDGQNALRQ
FT                   IDRIATGWRLKNVAPGLIVCTHAQTPERILATKTIDSEALARCAELGAGLAAGLALGVF
FT                   "
FT                   /protein_id="YP_002153401.1"
FT   misc_feature    9291..>9515
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="BCAS0008"
FT   misc_feature    <9447..9605
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="BCAS0008"
FT   misc_feature    9291..9728
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 0.0032"
FT                   /locus_tag="BCAS0008"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   gene            complement(9888..10472)
FT                   /db_xref="GeneID:6804506"
FT                   /locus_tag="BCAS0009"
FT   CDS_pept        complement(9888..10472)
FT                   /locus_tag="BCAS0009"
FT                   /gene_family="HOG000264109" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294861"
FT                   /db_xref="GeneID:6804506"
FT                   /translation="MVSQDDTPHDGITREEIHHRQIDMRGYRRSDGLFEVTACLADRKT
FT                   SDFTPPGGARTVVARTPLHDLGVTLVFDVDMVVRAVSTFIRSHPYAQCPGGGDSLQALV
FT                   GLNIGAGWNSEVRKRLPSCDTCTHLKELLGPIATTAYQTMVGMRRSSLDYRDGEGKPLK
FT                   IDSCYAYGASRDLVKRLWPEYHQPSTTVKDS"
FT                   /protein_id="YP_002153402.1"
FT   misc_feature    complement(10044..10421)
FT                   /note="Protein of unknown function (DUF2889); Region:
FT                   DUF2889; pfam11136"
FT                   /db_xref="CDD:151580"
FT                   /locus_tag="BCAS0009"
FT   gene            11113..11784
FT                   /db_xref="GeneID:6804507"
FT                   /locus_tag="BCAS0010"
FT   CDS_pept        11113..11784
FT                   /locus_tag="BCAS0010"
FT                   /gene_family="HOG000267461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative activator of osmoprotectant transporter"
FT                   /transl_table="11"
FT                   /note="Similar to Escherichia coli prop effector proQ
FT                   SWALL:PROQ_ECOLI (SWALL:P45577) (232 aa) fasta scores: E():
FT                   0.015, 30.66% id in 150 aa; homology doesn't extend to N
FT                   and C termini"
FT                   /db_xref="GI:197294862"
FT                   /db_xref="GeneID:6804507"
FT                   /translation="MGFEQLAELRAQLAAKAKQERNAKRPAAPTDAGAKPKSGDQPSRG
FT                   AKPGAGAKAQHRAKPASAKPSAPVDPVIVAIGKLQRKFPRAFPKNPAPKVPLKVGIWDD
FT                   LAREAQAVGLSEAELREAMSTWCRGNRYWSCLVEDAVRVDLQGNEAGRVTHDDAARARR
FT                   LKARRPNKGAAQSAKGAPQQPKAEQQAEAAAAPQPAEAEAETKVQTDVAPQDEQQAAGN
FT                   E"
FT                   /protein_id="YP_002153403.1"
FT   misc_feature    <11347..11574
FT                   /note="FinO bacterial conjugation repressor domain;  the
FT                   basic protein FinO is part of the the two component FinOP
FT                   system which is responsible for repressing bacterial
FT                   conjugation; the FinOP system represses the transfer (tra)
FT                   operon of the F-plasmid which...; Region: FinO_conjug_rep;
FT                   cl00174"
FT                   /db_xref="CDD:174017"
FT                   /locus_tag="BCAS0010"
FT   misc_feature    11299..11772
FT                   /note="HMMPfam hit to PF04352, ProQ activator of
FT                   osmoprotectant transporter, score 1.6e-28"
FT                   /locus_tag="BCAS0010"
FT                   /inference="protein motif:HMMPfam:PF04352"
FT   gene            12269..13330
FT                   /db_xref="GeneID:6804508"
FT                   /locus_tag="BCAS0011"
FT   CDS_pept        12269..13330
FT                   /locus_tag="BCAS0011"
FT                   /gene_family="HOG000267460" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294863"
FT                   /db_xref="GeneID:6804508"
FT                   /translation="MNPRHSAIFVALAAAALFGAATPLAKALIGAMSPFMVAGLFYFGS
FT                   GVGLGIGILLRGWRSRRAPAADAAPLRRTDLPWLAGAIAAGGVAGPALLMLGLSSTPAA
FT                   TSALLLNLEGVLTAVIAWVVFRENVDTQIFVGMVAIVAGGTLLSWTPDRAGVPVGAWLI
FT                   VGACLCWAIDNNLTRKVAANDAMVIACLKGLIAGPVNIGIALATGATLPAIPVTAAAML
FT                   TGLGGYGISLVLFVVALRHLGSARTGAYFSIAPLFGVVLSLLIWPALPPATFWIAAALM
FT                   ALGIWLHVRERHEHAHEHERLEHTHRHRHDDHHQHSHDFPYDGDEPHTHPHVHLPITHS
FT                   HAHFPDIHHRHRH"
FT                   /protein_id="YP_002153404.1"
FT   sig_peptide     12269..12343
FT                   /note="Signal peptide predicted for BCAS0011 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.436 between residues 25 and 26"
FT                   /locus_tag="BCAS0011"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    12770..13129
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="BCAS0011"
FT   misc_feature    join(12287..12355,12365..12433,12494..12562,12575..12643,
FT                   12662..12715,12728..12784,12821..12889,12917..12985,
FT                   13004..13072,13082..13135)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BCAS0011 by TMHMM2.0 at aa 7-29, 33-55, 76-98, 103-125,
FT                   132-149, 154-172, 185-207, 217-239, 246-268 and 272-289"
FT                   /locus_tag="BCAS0011"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    12314..12715
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 3.7e-15"
FT                   /locus_tag="BCAS0011"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    12737..12769
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0011"
FT                   /inference="protein motif:Prosite:PS00013"
FT   gene            complement(13637..14227)
FT                   /db_xref="GeneID:6804509"
FT                   /locus_tag="BCAS0012"
FT   CDS_pept        complement(13637..14227)
FT                   /locus_tag="BCAS0012"
FT                   /gene_family="HOG000267449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative NifQ protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294864"
FT                   /db_xref="GeneID:6804509"
FT                   /translation="MTASADRTYEQALQSLQSATANADVPDARLFGTLVAARAGRNELT
FT                   LLGLSPDQFAWLLARQFPHLRSADIAALAPTVTPPALPATHAAFVATLHARLMDDANPA
FT                   VARDDADCLAAIIAHACLRPDHLWRDLGLDGRDAVSAMLERFFPALAARNVAHLRWKKF
FT                   LAQEVAASLGVAPGPAPGCPGCEDFGFCFPRAR"
FT                   /protein_id="YP_002153405.1"
FT   misc_feature    complement(13649..14158)
FT                   /note="NifQ; Region: NifQ; pfam04891"
FT                   /db_xref="CDD:147188"
FT                   /locus_tag="BCAS0012"
FT   misc_feature    complement(13649..14158)
FT                   /note="HMMPfam hit to PF04891, NifQ, score 8.5e-18"
FT                   /locus_tag="BCAS0012"
FT                   /inference="protein motif:HMMPfam:PF04891"
FT   gene            complement(14303..14728)
FT                   /db_xref="GeneID:6804510"
FT                   /locus_tag="BCAS0013"
FT   CDS_pept        complement(14303..14728)
FT                   /locus_tag="BCAS0013"
FT                   /gene_family="HOG000267438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative molybdenum transport protein"
FT                   /transl_table="11"
FT                   /note="Similar to Azotobacter vinelandii potential
FT                   molybdenum-pterin-binding-protein ModG SWALL:Q44529
FT                   (EMBL:Z49882) (142 aa) fasta scores: E(): 3.6e-17, 48.57%
FT                   id in 140 aa, and to the C-terminal region Azotobacter
FT                   vinelandii molybdenum transport protein ModE modE
FT                   SWALL:MODE_AZOVI (SWALL:P37733) (270 aa) fasta scores: E():
FT                   5.8e-15, 47.14% id in 140 aa"
FT                   /db_xref="GI:197294865"
FT                   /db_xref="GeneID:6804510"
FT                   /translation="MRTSARNQFAGQIGAVKPGAVNDEITLRTQDGLEIVAVITHGSAA
FT                   SLGLAAGTKAFALVKASSVIVMVDVDSSKVSARNCVTGTVASVAKGAVNSEVVIKAAGG
FT                   AEIVAIVTNDSVDRLGLASGTAASAIFKASSVIVGVE"
FT                   /protein_id="YP_002153406.1"
FT   misc_feature    complement(14546..14728)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BCAS0013"
FT   misc_feature    complement(14306..14500)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BCAS0013"
FT   misc_feature    complement(14315..14506)
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 1.7e-13"
FT                   /locus_tag="BCAS0013"
FT                   /inference="protein motif:HMMPfam:PF03459"
FT   misc_feature    complement(14531..14722)
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 1e-16"
FT                   /locus_tag="BCAS0013"
FT                   /inference="protein motif:HMMPfam:PF03459"
FT   gene            complement(14897..16384)
FT                   /db_xref="GeneID:6804511"
FT                   /locus_tag="BCAS0014"
FT   CDS_pept        complement(14897..16384)
FT                   /locus_tag="BCAS0014"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294866"
FT                   /db_xref="GeneID:6804511"
FT                   /translation="MKRHGLRVAATLAPLALALGACKSVGPDYTLPQHAYVNAPLANHA
FT                   LDDANGALVSRDAVPGNWWQLYDDPVLDGLVRDALKSNTDLRVAAANLARSRAALVVAN
FT                   EQGGFSGGAEAAVQRAQESAEQYLLENKLPVVNEGTVGINVSYELDLFGKLRRGVEAAR
FT                   ADSEAVKAAGDLARITVVADVVRAYVEACSAGDELAIAKQSLALQQQRVKLSQRLRDAG
FT                   RGNQTDVTRGVTQVRTLSADIPRFEGRRKVAQYQLAALLARAPADLPKAAAECERLPKL
FT                   RQPIPIGDGAALLRRRPDVREAERQLAAATARIGVATAALYPSVSIGASAGSVGVAADL
FT                   FSSTTNRWSFGPLISWSFPVNGQRARVREAEAATGGALAHFDGVVLNALRETQSSLATY
FT                   AADVQRTDALRTAYESARNSAAETHRLYAAGRESFIADLDATRTLTSVQAQVAAAEGQV
FT                   AADQVRLFLALGGGWESDGATAAGSAAATPASGPSAP"
FT                   /protein_id="YP_002153407.1"
FT   sig_peptide     complement(16307..16384)
FT                   /note="Signal peptide predicted for BCAS0014 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.364 between residues 26 and 27"
FT                   /locus_tag="BCAS0014"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(14969..16315)
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="BCAS0014"
FT   misc_feature    complement(15617..>16027)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="BCAS0014"
FT   misc_feature    complement(14975..15529)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 1e-25"
FT                   /locus_tag="BCAS0014"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    complement(15599..16171)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 5.1e-18"
FT                   /locus_tag="BCAS0014"
FT                   /inference="protein motif:HMMPfam:PF02321"
FT   misc_feature    complement(16319..16351)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0014"
FT                   /inference="protein motif:Prosite:PS00013"
FT   gene            complement(16381..17358)
FT                   /db_xref="GeneID:6804512"
FT                   /locus_tag="BCAS0015"
FT   CDS_pept        complement(16381..17358)
FT                   /locus_tag="BCAS0015"
FT                   /gene_family="HOG000112073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux system transport protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294867"
FT                   /db_xref="GeneID:6804512"
FT                   /translation="MKKTWLSAGQVLLTLIVVVVAGLVLWRIINYYMFSPWTRDGHVRA
FT                   DVIQVAPDVSGLITSVQVADNQEVKRGQVLFVIDQARYALAERLAEATLAQRRATLAQA
FT                   KREYARNLQLGNLVASEQVEESRTRVEQGEASVADAQVSLDTAKLNLQRTTIVSPVDGY
FT                   LNDRAPRVGEYVPAGRAVLSVVDRNSFRVDGYFEETKLRGIHIGQPVDIIVMGEPHALR
FT                   GHVQSIVAAIEDRDRTQGANLLPNVNPAFSWVRLAQRVPVRVVLDEVPDDFRMIAGRTA
FT                   TVSMRGADARRNDNAKPVGASTASASAPVPAASGTAASATGASQ"
FT                   /protein_id="YP_002153408.1"
FT   misc_feature    complement(16471..17358)
FT                   /note="p-hydroxybenzoic acid efflux subunit AaeA;
FT                   Provisional; Region: PRK10559"
FT                   /db_xref="CDD:170530"
FT                   /locus_tag="BCAS0015"
FT   sig_peptide     complement(17296..17358)
FT                   /note="Signal peptide predicted for BCAS0015 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884) with cleavage site
FT                   probability 0.775 between residues 21 and 22"
FT                   /locus_tag="BCAS0015"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(16510..17223)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 4.9e-16"
FT                   /locus_tag="BCAS0015"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   misc_feature    complement(17272..17340)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BCAS0015 by TMHMM2.0 at aa 7-29"
FT                   /locus_tag="BCAS0015"
FT                   /inference="protein motif:TMHMM:2.0"
FT   gene            complement(17360..17572)
FT                   /db_xref="GeneID:6804513"
FT                   /locus_tag="BCAS0016"
FT   CDS_pept        complement(17360..17572)
FT                   /locus_tag="BCAS0016"
FT                   /gene_family="HOG000259373" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294868"
FT                   /db_xref="GeneID:6804513"
FT                   /translation="MIGEIDIFGVFVPAPLVLMLIAYLINIVVRAVLERVGFYRLVWHR
FT                   SIFDLGIYVFVLAAVVIVSHQLVAT"
FT                   /protein_id="YP_002153409.1"
FT   misc_feature    complement(17393..17566)
FT                   /note="Protein of unknown function (DUF1656); Region:
FT                   DUF1656; cl11658"
FT                   /db_xref="CDD:175342"
FT                   /locus_tag="BCAS0016"
FT   misc_feature    complement(17384..17572)
FT                   /note="HMMPfam hit to PF07869, Protein of unknown function
FT                   (DUF1656), score 7.7e-21"
FT                   /locus_tag="BCAS0016"
FT                   /inference="protein motif:HMMPfam:PF07869"
FT   misc_feature    complement(join(17384..17452,17486..17554))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BCAS0016 by TMHMM2.0 at aa 7-29 and 41-63"
FT                   /locus_tag="BCAS0016"
FT                   /inference="protein motif:TMHMM:2.0"
FT   gene            complement(17607..19730)
FT                   /db_xref="GeneID:6804514"
FT                   /locus_tag="BCAS0017"
FT   CDS_pept        complement(17607..19730)
FT                   /locus_tag="BCAS0017"
FT                   /gene_family="HOG000267427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative fusaric acid resistance transporter
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294869"
FT                   /db_xref="GeneID:6804514"
FT                   /translation="MTYPSLRDWLFSGKTFAASMLALYLGLYFQLPRPYWAMASVYIVS
FT                   NPFVGATRSKALYRALGTALGAAAAIFFVPPFVETPLLFSIIVATWCGTLLYLAISDRT
FT                   ARSYVFMLAGYTMPLVALPTVTDPSTVFDVAIARTEEIVLGIVCASVVGSAVFPNRLAP
FT                   TLIERTDAWFKDAAFYGRETLSGHLAGKALSACRQRLAATITGLEFLLSQLGYDHAHPR
FT                   VLARAQALAGRMQLFLPLMSSLADPLIALMRDLHVRPPALDALLADAAKWFDAPLPAVQ
FT                   TDAGGDMAHDPVADDLRARIAALQPPDSALASWDGALMSNALWRLRQVIDIWQDCRSLR
FT                   ALIANESGVWQPRYRHWRLGGTERFFDRGMMLFSTLTVVFAIVFACWLWISSGWHDGAA
FT                   AVTLVAVSCSFFAALDEPAPLVFKFFLSTTASVVFAGLYLFVVLPHVHDFAMLVLMFAG
FT                   PFILIGTLLPRPQFNMVTMLVAVNTATFISIQSAYEADFFVFLNSNLAGVAGLLFAYVW
FT                   TRATRPFGAELAVRRLLRSGWEDVARSASTQPLDDQRNHASRMLDRVTQLLPRLGASDD
FT                   HRHPSIESFRDLRIALNALDLRRSRRRLSGDVPDAIDRVLAGVTDHYTRCAAANARQPA
FT                   PPALLATIDDALRRVAGRTLPDAAPTDGTAAPAVPATHRRLRDTLHALVGLRLSLYPAA
FT                   SAQAPQPPDGARA"
FT                   /protein_id="YP_002153410.1"
FT   misc_feature    complement(17658..19709)
FT                   /note="Fusaric acid resistance protein family; Region:
FT                   FUSC; pfam04632"
FT                   /db_xref="CDD:147003"
FT                   /locus_tag="BCAS0017"
FT   misc_feature    complement(join(18180..18248,18327..18386,18405..18473,
FT                   18558..18626,19260..19328,19356..19409,19428..19487,
FT                   19497..19565,19620..19688))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BCAS0017 by TMHMM2.0 at aa 15-37, 56-78, 82-101, 108-125,
FT                   135-157, 369-391, 420-442, 449-468 and 495-517"
FT                   /locus_tag="BCAS0017"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(18294..18650)
FT                   /note="HMMPfam hit to PF04632, Fusaric acid resistance
FT                   protein conserved re, score 4.3e-15"
FT                   /locus_tag="BCAS0017"
FT                   /inference="protein motif:HMMPfam:PF04632"
FT   misc_feature    complement(18507..18539)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0017"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(18573..18605)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0017"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(18585..18632)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /locus_tag="BCAS0017"
FT                   /inference="protein motif:Prosite:PS00038"
FT   gene            complement(19727..20206)
FT                   /db_xref="GeneID:6804515"
FT                   /locus_tag="BCAS0018"
FT   CDS_pept        complement(19727..20206)
FT                   /locus_tag="BCAS0018"
FT                   /gene_family="HOG000221454" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MarR family regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294870"
FT                   /db_xref="GeneID:6804515"
FT                   /translation="MTNLHDLRLAVSSLLVLTARKWRRTSDGVLTAYNVSEACATPLLM
FT                   AGRLGEGVRQGTLAEHVGIEGPSLVRLLDQLCAAGLARRDEDPHDRRAKTISLTAAGRA
FT                   VTAKMEEDLRALRAQVLKGVSRADLEATLRVLNAFNAADPHPPASRPPHSDDSAS"
FT                   /protein_id="YP_002153411.1"
FT   misc_feature    complement(19820..>20056)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BCAS0018"
FT   misc_feature    complement(19892..20104)
FT                   /note="HMMPfam hit to PF01047, MarR family, score 4.6e-08"
FT                   /locus_tag="BCAS0018"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   gene            20532..21392
FT                   /db_xref="GeneID:6804516"
FT                   /locus_tag="BCAS0019"
FT   CDS_pept        20532..21392
FT                   /locus_tag="BCAS0019"
FT                   /gene_family="HOG000267416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294871"
FT                   /db_xref="GeneID:6804516"
FT                   /translation="MSTSSSQPATPASLDAWLGKTETLGDDITAFPLNALAATLDRPSP
FT                   GDVVPPMWHWLYFLPIAPLAELGPDGHPKRGGFLPPVPLPRRMWAGGRLTFHAPLRAGR
FT                   RATRESTIANIEDKTGRSGRLVFVTVQHRIESGGALCVEEEHDIVYRDAPQPGAPAPKP
FT                   VAPPAGETWSRTVTADAVMLFRYSALTFNGHRIHYDRRYVTQEEGYPGLVVHGPLIATL
FT                   LVDLVHRERPDATLASFAFRAVRPTFDSEPFTLCGKPSDDGRTIELWAKDRDGWLTMQT
FT                   TATLA"
FT                   /protein_id="YP_002153412.1"
FT   misc_feature    20580..21383
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3777"
FT                   /db_xref="CDD:33572"
FT                   /locus_tag="BCAS0019"
FT   misc_feature    21036..21389
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:174252"
FT                   /locus_tag="BCAS0019"
FT   misc_feature    order(21174..21179,21258..21269)
FT                   /note="active site 2"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="BCAS0019"
FT   misc_feature    order(21192..21194,21201..21206,21213..21215,21234..21242)
FT                   /note="active site 1"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="BCAS0019"
FT   gene            21431..22594
FT                   /db_xref="GeneID:6804517"
FT                   /locus_tag="BCAS0020"
FT   CDS_pept        21431..22594
FT                   /locus_tag="BCAS0020"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294872"
FT                   /db_xref="GeneID:6804517"
FT                   /translation="MQTTQHDPYQDIREAVRDLCSHFPGEYFRQIDDARGYPDAFVDAL
FT                   TKAGWLAALIPQEYGGSGLGLTEASIIMEEINRAGGNSGACHGQMYNMGTLLRHGSAEQ
FT                   KRAYLPKIASGELRLQSMGVTEPTTGTDTTKIRTTAERRGDRYVINGQKVWISRVQHSD
FT                   LMILLARTTPLADVKKKSEGMSIFVVDLREAIGHGLTVRPIPNMVNHETNELFFDNLEI
FT                   PADNLIGEEGQGFKYILDGLNAERTLIAAECIGDGYWFIDKVSQYVKERVVFGRPIGQN
FT                   QGVQFPIARAFVNVEAASLMRFDAARRFDAHAPCGAQANMAKLLAADASWEAANACLQF
FT                   HGGFGFACEYDVERKFRETRLYQVAPISTNLILAYVAEHLLDLPRSF"
FT                   /protein_id="YP_002153413.1"
FT   misc_feature    21431..22591
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BCAS0020"
FT   misc_feature    21458..22576
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BCAS0020"
FT   misc_feature    order(21698..21700,21794..21796,21800..21802,21893..21895,
FT                   21899..21901,22520..22528,22532..22534,22538..22540)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BCAS0020"
FT   misc_feature    21437..21778
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal doma, score 1.9e-13"
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:HMMPfam:PF02771"
FT   misc_feature    21791..21946
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 1.3e-22"
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:HMMPfam:PF02770"
FT   misc_feature    22124..22573
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 5.2e-37"
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:HMMPfam:PF00441"
FT   misc_feature    22169..22531
FT                   /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
FT                   C-terminal doma, score 7e-07"
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:HMMPfam:PF08028"
FT   misc_feature    22442..22474
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    22445..22504
FT                   /note="PS00073 Acyl-CoA dehydrogenases signature 2."
FT                   /locus_tag="BCAS0020"
FT                   /inference="protein motif:Prosite:PS00073"
FT   gene            22607..23785
FT                   /db_xref="GeneID:6804518"
FT                   /locus_tag="BCAS0021"
FT   CDS_pept        22607..23785
FT                   /locus_tag="BCAS0021"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative CoA-transferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294873"
FT                   /db_xref="GeneID:6804518"
FT                   /translation="MRPLDGIKVITLEHAIAAPFCTRQLADLGARVIKIERPGSGDFAR
FT                   GYDERVHGLSSHFVWVNRSKESLTLDVKQPAAAAVLDALLADADVLVQNLAPGAAERLG
FT                   LGYDALKHTHPRLIVCDISGYGDDGPYRDRKAYDLLIQSEAGFLSITGSPGQPAKAGCS
FT                   IADIAAGMYAYTNILSALLMRGRTGAGCRIDVSMLESMVEWMGYPLYYAIDGQSPPAPS
FT                   GASHATICPYGPFPAGDGKTVMLGLQNEREWKLFCEQVLRQPALADDPRFNANSKRHAA
FT                   RDAVDALIVDAFATLTAAEVMQRLDAAGIANAQMNTLDDVWRHPQLQARERWRSVDTAA
FT                   GPVPALLPPGLPAGVEPRMDAVPALGQHTDAILAELGYDRARIAALRANGTI"
FT                   /protein_id="YP_002153414.1"
FT   misc_feature    22607..23782
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:176929"
FT                   /locus_tag="BCAS0021"
FT   misc_feature    22613..23782
FT                   /note="crotonobetainyl-CoA:carnitine CoA-transferase;
FT                   Provisional; Region: PRK03525"
FT                   /db_xref="CDD:167542"
FT                   /locus_tag="BCAS0021"
FT   misc_feature    22808..23374
FT                   /note="HMMPfam hit to PF02515, CoA-transferase family III,
FT                   score 4.1e-59"
FT                   /locus_tag="BCAS0021"
FT                   /inference="protein motif:HMMPfam:PF02515"
FT   gene            23805..25202
FT                   /db_xref="GeneID:6804519"
FT                   /locus_tag="BCAS0022"
FT   CDS_pept        23805..25202
FT                   /locus_tag="BCAS0022"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative MmgE/Prp family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294874"
FT                   /db_xref="GeneID:6804519"
FT                   /translation="MTHPIPAIATAPGRTLATFASQLRFDAIPADVVARTVNLYVDWLG
FT                   SALAGKGARPVETIAAFARRAGGSPGGPGTADVLIDRTPATPYFAAMTNGAASHFAEQD
FT                   DVHNGAVFHPATVVFPVALALAQARGASGRDFIAAAVAGYEVGIRVGEFLGRSHYKVFH
FT                   TTGTAGTVAAAATAGRLLGLPPERMLDAFGSAGTQASGLWEFLRDAADSKQLHTAMAAA
FT                   NGLMAAELARDGFRGATRILEGAQGMAAGMSTDADPARLTDRLGARWATAETSFKYHAS
FT                   CRHTHPAADALLAVMARERLAAADIGTVVTHVHQGALDVLGAVTVPSTVHQAKFNMGTV
FT                   LALAALHGHAGVDEFERDYAAAHVAAFRDRVSMAFDDEVDRAYPARWIGKVTVTTRDGR
FT                   TFTGRVDEPKGDPGNTLSRDEIARKVRTLAAFSGAASGAEVERLLADAWQVASCDAIGT
FT                   LFPEASA"
FT                   /protein_id="YP_002153415.1"
FT   misc_feature    23850..25151
FT                   /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
FT                   /db_xref="CDD:174454"
FT                   /locus_tag="BCAS0022"
FT   misc_feature    23832..25181
FT                   /note="HMMPfam hit to PF03972, MmgE/PrpD family, score
FT                   1.5e-111"
FT                   /locus_tag="BCAS0022"
FT                   /inference="protein motif:HMMPfam:PF03972"
FT   gene            25199..26002
FT                   /db_xref="GeneID:6804520"
FT                   /locus_tag="BCAS0023"
FT   CDS_pept        25199..26002
FT                   /locus_tag="BCAS0023"
FT                   /gene_family="HOG000242281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HpcH/HpaI aldolase/citrate lyase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294875"
FT                   /db_xref="GeneID:6804520"
FT                   /translation="MTSASARSWLFVPGNRPERFEKARAAGADAVIVDLEDAVPPDGKP
FT                   AARDAVVAQLDAARPVWVRVNAADTAWFADDLAALAAHPGVAGVMLPKCDTRAQVDAVL
FT                   AHAHRALELLPIVETATGIAGLDQVCAAPRVVRVAFGTLDFQVDLGIDGDGEALNAFRS
FT                   RIVLASRLAGIAPPVDGVSTVIDDPAAIERHARYARGFGFGGKLCIHPKQIDAVHRAYA
FT                   WTDAEQAWARRVLDAVDASGGAAVALDGRMVDMPVILKARRILRG"
FT                   /protein_id="YP_002153416.1"
FT   misc_feature    25220..25996
FT                   /note="Malate synthase catalyzes the Claisen condensation
FT                   of glyoxylate and acetyl-CoA to malyl-CoA , which
FT                   hydrolyzes to malate and CoA. This reaction is part of the
FT                   glyoxylate cycle, which allows certain organisms, like
FT                   plants and fungi, to derive their...; Region: malate_synt;
FT                   cl09155"
FT                   /db_xref="CDD:175021"
FT                   /locus_tag="BCAS0023"
FT   misc_feature    25217..25831
FT                   /note="HMMPfam hit to PF03328, HpcH/HpaI aldolase/citrate
FT                   lyase family, score 2.2e-33"
FT                   /locus_tag="BCAS0023"
FT                   /inference="protein motif:HMMPfam:PF03328"
FT   gene            26181..27593
FT                   /db_xref="GeneID:6804521"
FT                   /locus_tag="BCAS0024"
FT   CDS_pept        26181..27593
FT                   /locus_tag="BCAS0024"
FT                   /gene_family="HOG000261631" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:197294876"
FT                   /db_xref="GeneID:6804521"
FT                   /translation="MGRTEVSAGWRDAIGAVHGIESKYKRLVKAIASDIENGALAPGAR
FT                   LAPQRDVASSLGVSVQTVTNAYKELERQGLIRCEVGRGSFVAARVTESMSNYILDTTER
FT                   ELVDFSIARIVHTPEHDAAWRGVCAALAGTDDQPWIRSFRPIAGLDAHRDAGAAWLASL
FT                   NMPVHRESLLVTNGAAHGIFLALASIVGPGDTVLCESLTDHGVIGSANVLGFTLKGLEM
FT                   DEHGIRPEHFEEMCDGERISALVCTPTLNNPTVSMMTESRRRSIARIATRYGVYVIEDD
FT                   VYGPLPEKTGTPIASLIPELGFYCTSMTKSVLTGLRTGYLAMPRRLALRVESVLRVSSW
FT                   MATSPIAEIATRWIADGTARRLVELQRQRLAVRQEMVKAALGPYVLGAHPNALSAWLRV
FT                   PDYWQAERIVRELRTRKIAVTSPDPFLVGGTERPNAVRVCIGAETSDAACNAALETIAG
FT                   VFEQYPHLNDFH"
FT                   /protein_id="YP_002153417.1"
FT   misc_feature    26244..26441
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    order(26244..26246,26250..26252,26319..26321,26325..26330,
FT                   26352..26366,26370..26375,26382..26384,26412..26417,
FT                   26421..26432)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    26247..27572
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    26499..27551
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    order(26709..26717,26787..26789,26934..26936,27027..27029,
FT                   27099..27101,27105..27110,27129..27131)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    order(26718..26720,26817..26819,27006..27008,27123..27131,
FT                   27216..27218,27225..27227)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    27108..27110
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BCAS0024"
FT   misc_feature    26247..26438
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR fam, score 9.5e-13"
FT                   /locus_tag="BCAS0024"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    26319..26384
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1454.000, SD 4.14 at aa 47-68, sequence
FT                   APQRDVASSLGVSVQTVTNAYK"
FT                   /locus_tag="BCAS0024"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    26490..27548
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.1e-07"
FT                   /locus_tag="BCAS0024"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   gene            27692..28672
FT                   /db_xref="GeneID:6804522"
FT                   /locus_tag="BCAS0025"