(data stored in ACNUC7421 zone)

HOGENOMDNA: BURCJ_4

ID   BURCJ_4; SV 1; empty ; DNA; empty ; PRO; 92661 BP.
XX
AC   NC_011003;
XX
PR   Project: 57953;
XX
DE   Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence.
XX
OS   Burkholderia cenocepacia J2315
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-92661
RX   PUBMED; 18931103.
RA   Holden,M.T., Seth-Smith,H.M., Crossman,L.C., Sebaihia,M., Bentley,S.D.,
RA   Cerdeno-Tarraga,A.M., Thomson,N.R., Bason,N., Quail,M.A., Sharp,S.,
RA   Cherevach,I., Churcher,C., Goodhead,I., Hauser,H., Holroyd,N., Mungall,K.,
RA   Scott,P., Walker,D., White,B., Rose,H., Iversen,P., Mil-Homens,D.,
RA   Rocha,E.P., Fialho,A.M., Baldwin,A., Dowson,C., Barrell,B.G., Govan,J.R.,
RA   Vandamme,P., Hart,C.A., Mahenthiralingam,E. and Parkhill,J.;
RT   "The genome of Burkholderia cenocepacia J2315, an epidemic pathogen of
RT   cystic fibrosis patients";
RL   J. Bacteriol. 191 (1), 261-277 (2009)
XX
RN   [2]
RP   1-92661
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-SEP-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-92661
RA   Holden,M.T.G.;
RT   "Direct Submission";
RL   Submitted (20-JUN-2007) Holden M.T.G., The Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, The Wellcome Trust Genome Campus, CB10
RL   1SA, UNITED KINGDOM
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM747723.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..92661
FT                   /note="representative of the ET12 epidemic lineage"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216591"
FT                   /country="United Kingdom:Edinburgh"
FT                   /isolation_source="cystic fibrosis patient"
FT                   /strain="J2315"
FT                   /plasmid="pBCJ2315"
FT                   /organism="Burkholderia cenocepacia J2315"
FT   gene            1..672
FT                   /db_xref="GeneID:6926527"
FT                   /locus_tag="pBCA001"
FT   CDS_pept        1..672
FT                   /locus_tag="pBCA001"
FT                   /gene_family="HOG000222487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative partition protein"
FT                   /transl_table="11"
FT                   /note="Similar to Pseudomonas syringae pv. maculicola
FT                   putative partition protein ParA SWALL:Q93TE7
FT                   (EMBL:AF359557) (216 aa) fasta scores: E(): 1.7e-10, 28.44%
FT                   id in 218 aa, and to Xanthomonas axonopodis partition
FT                   protein A ParA SWALL:Q8NKZ8 (EMBL:AE008924) (208 aa) fasta
FT                   scores: E(): 1.6e-11, 31.96% id in 219 aa"
FT                   /db_xref="GI:206479927"
FT                   /db_xref="GeneID:6926527"
FT                   /translation="MVITIGAEKGGVAKTRLATHIAALAAAEDVDVVLLDTDKQGSAMS
FT                   WSRIRNEEGVTPAIPVLALPANPARELANLANKYTLVVVDIGAQNYRTMLECALLSDLV
FT                   LVPCGPDQQEVESTLNVFATLKDMGPRHESGEIPAYVVLTRVSPVEGSKATAELRAYLK
FT                   SEDIRVFDSQIPQREAWRATGKTGRAVHELKGRDRSKKAIDEMEAVYREIIERINGAEV
FT                   E"
FT                   /protein_id="YP_001989038.1"
FT   misc_feature    1..657
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="pBCA001"
FT   misc_feature    4..432
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="pBCA001"
FT   misc_feature    25..45
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="pBCA001"
FT   misc_feature    order(43..45,253..255)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="pBCA001"
FT   misc_feature    535..558
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /locus_tag="pBCA001"
FT                   /inference="protein motif:Prosite:PS00017"
FT   gene            765..1637
FT                   /db_xref="GeneID:6926396"
FT                   /locus_tag="pBCA002"
FT   CDS_pept        765..1637
FT                   /locus_tag="pBCA002"
FT                   /gene_family="HOG000222476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative partitioning protein"
FT                   /transl_table="11"
FT                   /note="Weakly similar to Bacillus subtilis stage 0
FT                   sporulation protein J Spo0J SWALL:SP0J_BACSU (SWALL:P26497)
FT                   (282 aa) fasta scores: E(): 1.1e-07, 29.71% id in 249 aa,
FT                   and to the C-terminal region of Ralstonia solanacearum
FT                   putative partitioning protein ParB or rsp0004 or rs01976
FT                   SWALL:Q8XTV0 (EMBL:AL646076) (334 aa) fasta scores: E():
FT                   2.1e-13, 28.12% id in 256 aa"
FT                   /db_xref="GI:206479928"
FT                   /db_xref="GeneID:6926396"
FT                   /translation="MAPSLATISQLRGGEVGSSQGATKYEIGQTYEVPIGKIKSNSVNP
FT                   RAIYTASAVSEMAESLTARGQGQSASAYVDEAGDIVLIDGERRLRGARAAGLPTLRVEI
FT                   RPKPASERELYEEARAANVERKDQSPLDDALKWKELLSRKIYPTQVALAKALNLGEDHV
FT                   SRTLSLAQLPSRIVQAAAEYPELLSLKMLNAIREFWEVKGEEETLELVLDAAKTGIGYR
FT                   DVAARRKAAAKGTVKRPRSTREQLSFRGAKGEFKSFEEDGRIELKLKGLAPDVAAEISE
FT                   KILALFPKE"
FT                   /protein_id="YP_002235439.1"
FT   misc_feature    855..1328
FT                   /note="ParB-like partition proteins; Region: parB_part;
FT                   TIGR00180"
FT                   /db_xref="CDD:161748"
FT                   /locus_tag="pBCA002"
FT   misc_feature    855..1133
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 6.4e-09"
FT                   /locus_tag="pBCA002"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   gene            2363..3220
FT                   /db_xref="GeneID:6926397"
FT                   /locus_tag="pBCA003"
FT   CDS_pept        2363..3220
FT                   /locus_tag="pBCA003"
FT                   /gene_family="HOG000222463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to Escherichia coli p285 protein TrfA
FT                   SWALL:Q52323 (EMBL:X00713) (285 aa) fasta scores: E():
FT                   5.7e-19, 29.68% id in 283 aa, and to the C-terminal region
FT                   of Escherichia coli TrfA transcriptional repressor protein
FT                   SWALL:TRFA_ECOLI (SWALL:P07676) (382 aa) fasta scores: E():
FT                   7.3e-19, 29.68% id in 283 aa"
FT                   /db_xref="GI:206479929"
FT                   /db_xref="GeneID:6926397"
FT                   /translation="MANSIVDQVKAIAARASSAGVETQSHPTQIPLWPANVRGMPNALA
FT                   RSALFNVNKSNAPRSRMEKALIASVDGVEISFSGEELRQDDADVFLEVLHLARDTQLNE
FT                   KVEFTGYSVLKSLGWGTSVKCYDRLVTTLERLQAGQVKVRFTGNKKGFVGSLIRKFLWK
FT                   EGTETGTDGKTRWVAYVEPEIVALFSDDDYTRLAREQRQRLRYELSKWLHTYYHTHAVP
FT                   FAHSVRFLHRQCGSQTKELFHFRANLKKALDELVKEGFLVSWTIDKSDLVHVVRASSRG
FT                   AIAA"
FT                   /protein_id="YP_002235440.1"
FT   misc_feature    2459..3190
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="pBCA003"
FT   misc_feature    2363..3190
FT                   /note="HMMPfam hit to PF07042, TrfA protein, score 3.2e-18"
FT                   /locus_tag="pBCA003"
FT                   /inference="protein motif:HMMPfam:PF07042"
FT   gene            complement(4209..7358)
FT                   /db_xref="GeneID:6926398"
FT                   /locus_tag="pBCA004"
FT   CDS_pept        complement(4209..7358)
FT                   /locus_tag="pBCA004"
FT                   /gene_family="HOG000021783" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA polymerase subunit alpha"
FT                   /transl_table="11"
FT                   /note="Similar to the C-terminal region of Staphylococcus
FT                   aureus DNA polymerase III alpha subunit DnaE
FT                   SWALL:DP3A_STAAU (SWALL:Q9F1K0) (1065 aa) fasta scores:
FT                   E(): 6.9e-61, 25.64% id in 1045 aa, and to the full length
FT                   Pseudomonas aeruginosa probable DNA polymerase alpha chain
FT                   pa0669 SWALL:Q9I5Q2 (EMBL:AE004502) (1031 aa) fasta scores:
FT                   E(): 3.6e-188, 52.96% id in 1044 aa"
FT                   /db_xref="GI:206479930"
FT                   /db_xref="GeneID:6926398"
FT                   /translation="MDAGSFGALPAYAELQVASDFSFLHGASRAEEYVARAAQLGYSAI
FT                   AITDECSLAGVVRAHVEAKSANMPLIIGSHFQLTAADGSSALAFTALAMNRDGYGNLCE
FT                   FISLGRMRGKKGSYRLAPLDVDHPEAPYAHLRGLPDCLAILSPDFPANEQRLDAQVEWF
FT                   ARVFGDRAWIALTLHARAMDDIHRGVLERVAARHGVPVVATSWPLMHVRSRKPLQDVLT
FT                   GIRVGRPVTECGYELAPNAERHLRSRLRLANLYPAGALEETVRVARRCTFSLDDLKYEY
FT                   PDELVPAGTDPATYLREQTYIGARRRFPAGIPVDVQAQIEHELQLIADMHYEAYFLTVY
FT                   DIVQFAREQGILCQGRGSAANSAVCYCLGVTEVDPSRQSMLFERFISKERNSPPDIDVD
FT                   FEHQKREIVMQYIYRKYGRDRAALTAAVTTYRPRSALREAGKALGVDTAIVERVAKQHH
FT                   WFDSRADLLQRFAEAGLDPEAPLNQQWAAFAAQLLGYPRHLSQHSGGFVISRGKLTRLV
FT                   PVENAAMEDRSIIQWDKDDIEALGILKIDVLALGMLSMVRRALDMISEKRGETFELQDI
FT                   PAQDKATYDMLCEGDSMGVFQVESRAQMSMLPRLRPQCFYDLVIEVAIVRPGPVQGGMV
FT                   HPFLRRRQGLEPVTFPSEGMEKALARTLGVPIFQEQVMQVAMLAAGFSAGEADQLRRAM
FT                   AAWKRKGGLEPYHERLVSGMLERGYDREFAESIFAQIKGFGEYGFPESHAASFALLVYS
FT                   SAWLRRHEPAVFLAALLNSQPMGFYTPSQLLQDARRRGVEVLPVDVNVSTWDSAIEGST
FT                   TSAPVRLGFSLLRGMREDVAGRIELARAARPFVDVADLARRAQLDRHDLQVLARANALR
FT                   SLAGGNRRAALWLAAAAVPDRDLLRGTERDDAVPALPQASEGHEIVTDYRAMGFTLGRH
FT                   PLALLRDRLALDRLQSAEQLATLRSGQLARACGLVTVRQRPGTANGVLFMTLEDETGQV
FT                   NVILWPGLLEKFRKDALGASLLAVYGVWQAEGKVRHLIASKLVDRTELLGALPTTAREF
FT                   C"
FT                   /protein_id="YP_002235441.1"
FT   misc_feature    complement(4215..7337)
FT                   /note="error-prone DNA polymerase; Validated; Region:
FT                   dnaE2; PRK05672"
FT                   /db_xref="CDD:168166"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(7140..7319)
FT                   /note="DNA polymerase alpha chain like domain; Region:
FT                   POLIIIAc; cl02625"
FT                   /db_xref="CDD:174726"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(5205..6476)
FT                   /note="Bacterial DNA polymerase III alpha subunit; Region:
FT                   DNA_pol3_alpha; pfam07733"
FT                   /db_xref="CDD:149024"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(4248..4481)
FT                   /note="DnaE_OBF: A subfamily of OB folds corresponding to
FT                   the C-terminal OB-fold nucleic acid binding domain of
FT                   Thermus aquaticus and Escherichia coli type C replicative
FT                   DNA polymerase III alpha subunit (DnaE). The DNA polymerase
FT                   holoenzyme of E. coli...; Region: DnaE_OBF; cd04485"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(order(4263..4265,4317..4319,4323..4325,
FT                   4329..4331,4479..4481))
FT                   /note="generic binding surface II; other site"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(order(4278..4286,4305..4313,4332..4334,
FT                   4377..4379,4383..4391,4407..4409,4413..4424,4458..4466))
FT                   /note="generic binding surface I; other site"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="pBCA004"
FT   misc_feature    complement(4257..4484)
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 5.5e-08"
FT                   /locus_tag="pBCA004"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    complement(4698..4742)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /locus_tag="pBCA004"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(5205..6632)
FT                   /note="HMMPfam hit to PF07733, Bacterial DNA polymerase III
FT                   alpha sub, score 8.6e-239"
FT                   /locus_tag="pBCA004"
FT                   /inference="protein motif:HMMPfam:PF07733"
FT   misc_feature    complement(6720..7322)
FT                   /note="HMMPfam hit to PF02811, PHP domain, score 4.9e-06"
FT                   /locus_tag="pBCA004"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   gene            complement(7365..8843)
FT                   /db_xref="GeneID:6926399"
FT                   /locus_tag="pBCA005"
FT   CDS_pept        complement(7365..8843)
FT                   /locus_tag="pBCA005"
FT                   /gene_family="HOG000222372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsp0799 or rs01908 SWALL:Q8XRN2 (EMBL:AL646080)
FT                   (523 aa) fasta scores: E(): 5.1e-31, 45.61% id in 524 aa,
FT                   and to Xanthomonas axonopodis hypothetical protein xac1198
FT                   SWALL:Q8PN75 (EMBL:AE011749) (472 aa) fasta scores: E():
FT                   1.8e-28, 34% id in 497 aa"
FT                   /db_xref="GI:206479931"
FT                   /db_xref="GeneID:6926399"
FT                   /translation="MQVWIGVHLPHLNLEVFRPRSPAPSPDDARGLVVLEGGRVVALDR
FT                   AARKLGVVAGMRRGGVLSLAPDAQIRERDAARERELVLGVAYALLQFTPSVVDADEDVV
FT                   VLDVTASLRLFHGLRALRQRVRDVVASFGVTSAISVASSGPAAWMVARGLRGGLALSAR
FT                   SLRRALARVPLVVAPDARRYANWFEDLGCETLADLQRLPRAGLKKRCGTQLLDWLDQVA
FT                   GTAPAAYDWLEMPPSFDTRVELMDRVEHAEALLFVARRLILQLTGWLTAKQLDVAAFAL
FT                   LLEHERGREAIAPTEIEIALGAPTRFEEHLTRLVKERLGHVELAGPVIAVRLVARSVQE
FT                   AAAPSDSLFPEPGGTPQDHARLLELLTARLGAENVLVPAPMADYRPEPAARWVPMRDAP
FT                   KPAPLPADLPRPAWLLAKPVPLLTRQHRPFYGTPLRMVSPGERIEGGWQDGQTVTRDYF
FT                   VAEDDHGVCYWIYKERPTASDESEARFFLHGLFG"
FT                   /protein_id="YP_002235442.1"
FT   misc_feature    complement(7824..8831)
FT                   /note="DNA Polymerase Y-family; Region: PolY_like; cd03468"
FT                   /db_xref="CDD:176458"
FT                   /locus_tag="pBCA005"
FT   misc_feature    complement(order(8379..8381,8535..8540,8700..8702,
FT                   8709..8711,8805..8810,8817..8822))
FT                   /note="active site"
FT                   /db_xref="CDD:176458"
FT                   /locus_tag="pBCA005"
FT   misc_feature    complement(order(7920..7922,7926..7940,8028..8030,
FT                   8115..8132,8208..8210,8295..8300,8301..8306,8535..8537,
FT                   8544..8546))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176458"
FT                   /locus_tag="pBCA005"
FT   gene            complement(8764..9480)
FT                   /db_xref="GeneID:6926400"
FT                   /locus_tag="pBCA006"
FT   CDS_pept        complement(8764..9480)
FT                   /locus_tag="pBCA006"
FT                   /gene_family="HOG000222360" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to N-terminal region of Ralstonia
FT                   solanacearum hypothetical protein rsp0798 or rs01909
FT                   SWALL:Q8XRN3 (EMBL:AL646080) (272 aa) fasta scores: E():
FT                   5.2e-32, 49.36% id in 235 aa. N-terminal region is similar
FT                   to many proteins including: Pseudomonas putida putative
FT                   cell division inhibitor SulA, pp3117 SWALL:AAN68725
FT                   (EMBL:AE016785) (206 aa) fasta scores: E(): 1.6e-20, 46.5%
FT                   id in 200 aa. C-terminal region of the CDS overlaps the
FT                   down stream CDS"
FT                   /db_xref="GI:206479932"
FT                   /db_xref="GeneID:6926400"
FT                   /translation="MHPALAHPEAIHPALWRASQLARPSVRGVDTGHLELTAELPGGGW
FT                   PAGALIELLAPQPGIGELRLLAPVLARTAGKPVMLIQPPHALQPLALAYWGIDPSGFVT
FT                   LPAPRTADALWAAEQALRAGTCAAVLLWQSHVRADALRRLNLAAQSGQALFYLFRPVAA
FT                   ARDASPAPLRLALAPKRDGIDVTFLKRRGPARDTPLFVPLSPSPILLNRHASLDRRASA
FT                   APQPRSVPATIAGAVA"
FT                   /protein_id="YP_002235443.1"
FT   misc_feature    complement(<9088..9378)
FT                   /note="Cell division inhibitor SulA; Region: SulA; cl01880"
FT                   /db_xref="CDD:174680"
FT                   /locus_tag="pBCA006"
FT   intron          9512..11432
FT                   /note="putative group II intron"
FT   gene            9881..11413
FT                   /db_xref="GeneID:6926401"
FT                   /locus_tag="pBCA007"
FT   CDS_pept        9881..11413
FT                   /locus_tag="pBCA007"
FT                   /gene_family="HOG000162267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative maturase-Group II intron"
FT                   /transl_table="11"
FT                   /note="Similar to Serratia marcescens reverse transcriptase
FT                   RetA SWALL:O52209 (EMBL:AF027768) (495 aa) fasta scores:
FT                   E(): 2.4e-151, 71.63% id in 497 aa, and to Bradyrhizobium
FT                   japonicum Blr1915 protein blr1915 SWALL:BAC47180
FT                   (EMBL:AP005941) (491 aa) fasta scores: E(): 8.1e-128,
FT                   63.24% id in 487 aa"
FT                   /db_xref="GI:206479933"
FT                   /db_xref="GeneID:6926401"
FT                   /translation="MTNGWEKSDSPIVAKKLANKPGQPDAESVERRGGAKGNTEWSRTR
FT                   RTQSRISVSQRLDRVRQAARQRKKEKFTALYHLIDLDLLATAFFWLKRKAAAGVDGVTW
FT                   HDYEQDLDRNLEDLHGRLRRQAYRALPSRRRYIPKADGKQRPLGIAALEDKIVQRALVA
FT                   VLNAVYEMDFLGFSYGFRPQRSQHDALDALATGIARTSVSWILDADISRFFDTVDHDWL
FT                   IRFVEHRIGDQRVIRLIRKWLKAGAMEDGVIEPTDEGTPQGSVISPLLANIYLHYVFDL
FT                   WANQWRKRHAEGNVVIVRYADDVVVGFDKPHDAKRFRRAMQQRLEQFGLSVHPEKTRLI
FT                   EFGRFAARNRASRGLGKPETFNFLGFTHISGRAKDGRFMLMRKTRSDRLRTALKGIKDE
FT                   LRHRWHQSIPEQGDWLRRVVQGYFNYHAVPTNFAALRAFRARVIDLWRLALRRRSQKDD
FT                   TTWAKMHRLAKQWIPKARILHPWPVVRFDANHPRQEPGARIAHAGICAGGAQ"
FT                   /protein_id="YP_002235444.1"
FT   misc_feature    9995..10906
FT                   /note="Retron-type reverse transcriptase [DNA replication,
FT                   recombination, and repair]; Region: COG3344"
FT                   /db_xref="CDD:33153"
FT                   /locus_tag="pBCA007"
FT   misc_feature    10277..10984
FT                   /note="RT_G2_intron: Reverse transcriptases (RTs) with
FT                   group II intron origin. RT transcribes DNA using RNA as
FT                   template. Proteins in this subfamily are found in bacterial
FT                   and mitochondrial group II introns. Their most probable
FT                   ancestor was a retrotransposable...; Region: RT_G2_intron;
FT                   cd01651"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="pBCA007"
FT   misc_feature    order(10505..10522,10664..10669,10778..10780,10784..10789,
FT                   10970..10975)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="pBCA007"
FT   misc_feature    order(10505..10522,10664..10666,10784..10786)
FT                   /note="putative NTP binding site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="pBCA007"
FT   misc_feature    10667..10669
FT                   /note="putative nucleic acid binding site; other site"
FT                   /db_xref="CDD:73157"
FT                   /locus_tag="pBCA007"
FT   misc_feature    10262..10984
FT                   /note="HMMPfam hit to PF00078, Reverse transcriptase
FT                   (RNA-dependent DNA pol, score 1.5e-62"
FT                   /locus_tag="pBCA007"
FT                   /inference="protein motif:HMMPfam:PF00078"
FT   gene            11358..11432
FT                   /db_xref="GeneID:6926402"
FT                   /locus_tag="pBCAr007"
FT   misc_RNA        11358..11432
FT                   /note="domain=Rfam:RF00029;Intron_gpII;Score=37.78;positio
FT                   ns 1 to 77; Group II catalytic intron (RF00029) as
FT                   predicted by Rfam, score 37.78"
FT                   /db_xref="GeneID:6926402"
FT                   /locus_tag="pBCAr007"
FT   gene            complement(11469..12431)
FT                   /db_xref="GeneID:6926485"
FT                   /locus_tag="pBCA008"
FT   CDS_pept        complement(11469..12431)
FT                   /locus_tag="pBCA008"
FT                   /gene_family="HOG000222339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Poor database matches. Internal region is weakly
FT                   similar to the N-terminal region of Bradyrhizobium
FT                   japonicum Blr2564 protein SWALL:BAC47829 (EMBL:AP005944)
FT                   (254 aa) fasta scores: E(): 0.0048, 26.25% id in 179 aa"
FT                   /db_xref="GI:206479934"
FT                   /db_xref="GeneID:6926485"
FT                   /translation="MPERDTLSEEQWLWETTMCYSAKIQANYREYVRRYGADMDIETFR
FT                   RIFFARASGADIKIPKAVDAAFAGVDDEISAAIAAYRSQRTRKLETELFEQRARLAAAE
FT                   KKLAVKITKKASEDVRIATDKIDAATRGLNDLRRQDLQERDSRIFPGWYAPVLIEVDGK
FT                   RMVVPMRYRCRIPGWTEADEKQKNGSYNARADSLSTAWRKVFGFTHGLLLVDAFFENVK
FT                   RDGQNVVLRFDPTPPQHMQVACLWTRTEIPGGDDLWSFAAITDDPPPEVAAAGHDRCIV
FT                   PIKSSNVDAWLAPDPSRRAQLREILADRERPYYEHQLAA"
FT                   /protein_id="YP_002235445.1"
FT   misc_feature    complement(11520..12065)
FT                   /note="Uncharacterized ACR, COG2135; Region: DUF159;
FT                   cl03646"
FT                   /db_xref="CDD:174792"
FT                   /locus_tag="pBCA008"
FT   repeat_region   12642..12651
FT                   /note="Inverted repeat, pBCinv1"
FT   repeat_region   complement(12667..12676)
FT                   /note="Inverted repeat, pBCinv1"
FT   repeat_region   12686..12707
FT                   /note="Inverted repeat, pBCinv2"
FT   repeat_region   complement(12709..12730)
FT                   /note="Inverted repeat, pBCinv2"
FT   gene            complement(13076..13978)
FT                   /db_xref="GeneID:6926403"
FT                   /locus_tag="pBCA009"
FT   CDS_pept        complement(13076..13978)
FT                   /locus_tag="pBCA009"
FT                   /gene_family="HOG000222328" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Poor database matches. C-terminus is similar to the
FT                   C-terminal region of Pseudomonas alcaligenes RepA
FT                   SWALL:O30879 (EMBL:U88088) (276 aa) fasta scores: E():
FT                   8.8e-21, 40.33% id in 238 aa"
FT                   /db_xref="GI:206479935"
FT                   /db_xref="GeneID:6926403"
FT                   /translation="MNFPFLDPLLPDQSNPVGVGAPDQLTAAAAPIGAHRMRVAKTVLP
FT                   ERVWPDDIPSPAPANAPRILRELKTRLSRYLDKPAQWLAQLNAANGSRRQQRSERRLAC
FT                   VQLARAMIKYCDLRTMRIGVPGAAGWIDFTLPYLAAQAGLSERRAERALRDLQKARLVK
FT                   VRRQCELEETEQGVRYKGVASIKYLTSTLFESFGLGKWLRHERTRAHLRAQRRANQQRK
FT                   RTQQGSALGAQLVEQLAGIEARARRQAAAAGAAQREAVDLDRAIKLRVGELLHAHPDWD
FT                   RDTLYAAARRQLAPPGDSV"
FT                   /protein_id="YP_002235446.1"
FT   gene            complement(14316..15089)
FT                   /db_xref="GeneID:6926404"
FT                   /locus_tag="pBCA010"
FT   CDS_pept        complement(14316..15089)
FT                   /locus_tag="pBCA010"
FT                   /gene_family="HOG000222452" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Weakly similar to Rhizobium meliloti hypothetical
FT                   protein SWALL:Q91UR0 (EMBL:AJ304453) (239 aa) fasta scores:
FT                   E(): 0.01, 24.28% id in 243 aa"
FT                   /db_xref="GI:206479936"
FT                   /db_xref="GeneID:6926404"
FT                   /translation="MKRPNYRSALLAACVAVAAFLVTACFGHRAWPIVAATLLAIPLAS
FT                   LFVKATNRWRRQQAVDRPSVTITEATVWELRLNDVPAAEVPEHVVRRIEHELAQERQWD
FT                   LRVASILSYAGAVLCQLAYTALCIPLAIFAFAGLSWATNPAGFAHLARQILNASETELR
FT                   AVVDGLAWTAIGFSGMVLVMWHAFGGRTRIPDHYDEAWHEEIRLAARIAPRGEFTLHLS
FT                   GQVVPAGFRVTRGPRLTVHYWPNSRRSSPNRHDVA"
FT                   /protein_id="YP_002235447.1"
FT   gene            complement(14526..15071)
FT                   /db_xref="GeneID:6926405"
FT                   /locus_tag="pBS010"
FT   misc_feature    complement(join(14526..14585,14691..14759,14946..14999,
FT                   15012..15071))
FT                   /note="4 probable transmembrane helices predicted for
FT                   pBS010 by TMHMM2.0 at aa 7-26, 31-48, 111-133 and 169-188"
FT                   /locus_tag="pBS010"
FT                   /inference="protein motif:TMHMM:2.0"
FT   gene            complement(15126..20077)
FT                   /db_xref="GeneID:6926486"
FT                   /locus_tag="pBCA011"
FT                   /pseudo
FT   misc_feature    complement(15126..20077)
FT                   /note="C-terminal region is similar to Escherichia coli O6
FT                   putative adhesin c4424 SWALL:Q8FCB2 (EMBL:AE016768) (1778
FT                   aa) fasta scores: E(): 3.5e-33, 29.02% id in 1795 aa. CDS
FT                   contains a probable frameshift mutation"
FT                   /db_xref="PSEUDO:CAR57718.1"
FT                   /locus_tag="pBCA011"
FT                   /pseudo
FT   misc_feature    complement(15129..15356)
FT                   /note="HMMPfam hit to PF03895, YadA-like C-terminal region,
FT                   score 1.2e-15"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF03895"
FT   misc_feature    complement(15471..15554)
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00015"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(15555..15638)
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0023"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(16020..16082)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   4.6e-06"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(16263..16334)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.7e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(16428..16490)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.3e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(16836..16898)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.00012"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(17079..17150)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.3e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(17895..17966)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.4e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(18303..18374)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score 7e-06"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(18711..18782)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   0.0001"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(18876..18938)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score 3e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(19119..19190)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   6.4e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(19260..19322)
FT                   /note="HMMPfam hit to PF05662, Haemagglutinin, score
FT                   1.8e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05662"
FT   misc_feature    complement(19371..19451)
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.15"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(join(19668..19694,19694..19750))
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 1.1"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(19784..19870)
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 0.85"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   misc_feature    complement(19880..19963)
FT                   /note="HMMPfam hit to PF05658, Hep_Hag, score 3e-05"
FT                   /pseudo
FT                   /locus_tag="pBCA011"
FT                   /inference="protein motif:HMMPfam:PF05658"
FT   gene            complement(20000..20077)
FT                   /db_xref="GeneID:6926406"
FT                   /locus_tag="pBS011"
FT   gene            complement(20224..21036)
FT                   /db_xref="GeneID:6926487"
FT                   /locus_tag="pBCA012"
FT   CDS_pept        complement(20224..21036)
FT                   /locus_tag="pBCA012"
FT                   /gene_family="HOG000268824" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206479937"
FT                   /db_xref="GeneID:6926487"
FT                   /translation="MSQHVKDYLTPDEAMQMLHAQLSHGADLYRFLLTRRVMHLTGGVV
FT                   QHGPLAGFNIGRHATWREEDNASKVLGFYEQEVCALLDRLSGRCDVLVDLGGADGFYAV
FT                   GMVERGHFRESHCFEIEDQSRANIAAIAADNGVAGRVHLYGAATSTFARDLTAAGVDFR
FT                   RAAVLVDIESNEFEVLNTQCLHDLRHSHVIVEIHDFMRPHDGAQRYAELRERAQVDFHV
FT                   HSFTTGARDPSSIPFLRNGWTDTDRWLLCSESRATLMTWLYLEPKETC"
FT                   /protein_id="YP_002235448.1"
FT   gene            complement(21075..21347)
FT                   /db_xref="GeneID:6926407"
FT                   /locus_tag="pBCA013"
FT   CDS_pept        complement(21075..21347)
FT                   /locus_tag="pBCA013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to Bradyrhizobium japonicum Blr6028 protein
FT                   SWALL:Q89HG3 (EMBL:AP005957) (100 aa) fasta scores: E():
FT                   2.5, 35.52% id in 76 aa, and to the N-terminal region of
FT                   Shewanella oneidensis HlyD family secretion protein so3483
FT                   SWALL:Q8EBM7 (EMBL:AE015784) (369 aa) fasta scores: E():
FT                   4.4, 38.02% id in 71 aa"
FT                   /db_xref="GI:206479938"
FT                   /db_xref="GeneID:6926407"
FT                   /translation="MIRILALALLVVAVTRPVFAAASMAAEPDARPTPLMGVPVMTGLS
FT                   RVSQPAAVIVAPSVSASHPTAAVRDDVVATARKTLSGNEEVLSPQ"
FT                   /protein_id="YP_002235449.1"
FT   gene            complement(21270..21347)
FT                   /db_xref="GeneID:6926408"
FT                   /locus_tag="pBS013"
FT   gene            complement(21408..21902)
FT                   /db_xref="GeneID:6926488"
FT                   /locus_tag="pBCA014"
FT   CDS_pept        complement(21408..21902)
FT                   /locus_tag="pBCA014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Weakly similar to Proteus vulgaris conserved
FT                   hypothetical protein Orf137 SWALL:Q8L2A0 (EMBL:AP004237)
FT                   (151 aa) fasta scores: E(): 0.013, 22.51% id in 151 aa, and
FT                   to Coxiella burnetii hypothetical protein cbu1865
FT                   SWALL:Q83AL8 (EMBL:AE016965) (175 aa) fasta scores: E():
FT                   4.3, 26.75% id in 157 aa"
FT                   /db_xref="GI:206479939"
FT                   /db_xref="GeneID:6926488"
FT                   /translation="MQDLPAWYDASPCWLVNLPQFATAAATVGLIGVISVLLSAYTPLW
FT                   PFGFGLMLIPIAIAVNAAVDAAATHIVIDPARVTVKTGIATRRTASVELYRLVNVDAVT
FT                   AWWQRPLGFGTLILETSDAYRPVWVLPGVRNVEFMREVLTRQALELRSARGVREVNMGR
FT                   L"
FT                   /protein_id="YP_002235450.1"
FT   misc_feature    complement(21480..21674)
FT                   /note="Bacterial membrane flanked domain; Region: DUF304;
FT                   cl01348"
FT                   /db_xref="CDD:154346"
FT                   /locus_tag="pBCA014"
FT   gene            complement(21711..21866)
FT                   /db_xref="GeneID:6926409"
FT                   /locus_tag="pBS014"
FT   misc_feature    complement(join(21711..21770,21798..21866))
FT                   /note="2 probable transmembrane helices predicted for
FT                   pBS014 by TMHMM2.0 at aa 13-35 and 45-64"
FT                   /locus_tag="pBS014"
FT                   /inference="protein motif:TMHMM:2.0"
FT   gene            complement(21977..22144)
FT                   /db_xref="GeneID:6926489"
FT                   /locus_tag="pBCA015"
FT   CDS_pept        complement(21977..22144)
FT                   /locus_tag="pBCA015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Poor database matches. Weakly similar to the
FT                   C-terminal region of Streptomyces griseoflavus hypothetical
FT                   protein GilN SWALL:AAP69592 (EMBL:AY233211) (297 aa) fasta
FT                   scores: E(): 6.4, 39.21% id in 51 aa"
FT                   /db_xref="GI:206479940"
FT                   /db_xref="GeneID:6926489"
FT                   /translation="MKLNNERFVVGTRGWDVAEAKRVPAGVARATLQNATWRIPISGAP
FT                   APVVRERDPS"
FT                   /protein_id="YP_002235451.1"
FT   gene            complement(22141..23457)
FT                   /db_xref="GeneID:6926410"
FT                   /locus_tag="pBCA016"
FT   CDS_pept        complement(22141..23457)
FT                   /locus_tag="pBCA016"
FT                   /gene_family="HOG000222317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Similar to Rhizobium etli hypothetical protein yp034
FT                   SWALL:Q8KL58 (EMBL:U80928) (404 aa) fasta scores: E():
FT                   2.7e-62, 43.21% id in 398 aa, and to Rhizobium loti
FT                   hypothetical protein mlr9246 SWALL:Q981T1 (EMBL:AP003015)
FT                   (412 aa) fasta scores: E(): 7.4e-54, 40% id in 395 aa. CDS
FT                   is extended at the C-terminus in comparison to orthologues;
FT                   none"
FT                   /db_xref="GI:206479941"
FT                   /db_xref="GeneID:6926410"
FT                   /translation="MMSARYELFGEVYDADTRDLYSHLAQAYEQKVRPLCRCRDPEPGV
FT                   PMYIARFDGRFLIKRMPGTAGQHKLGCDSYDYPPELSGLGDVEGSAIVEDLESGQVTLK
FT                   FGFALSKGAARKMPEPSGKEPDSIKADSKKLTLRGTLHYLWEQAGLNRWSPAMAGKRSW
FT                   YVVRKYLLQAAADKQAKRMNLTDMLYIPESFVLDQKDQIQQRRTEHLTHISVSESGEPH
FT                   FILVIGELKEIATARFGFKLVLKHLPDYGLMLEEATHKRLKDRFEVELELWNALEGTHL
FT                   MVIATASLSRTGIATVQECSLMLTTEQWIPFDDSSEHALLQALVRRRYVKCLRYNLPSS
FT                   RPLASAVLTDVEQATALYVVPPSADEAYQTALDALLVDSELDAWIWKPLEGTMPALPDP
FT                   ATNWRKLVAAQAARASQHDAHLPFDGEPPHAGQQGKHDA"
FT                   /protein_id="YP_002235452.1"
FT   misc_feature    complement(22288..23445)
FT                   /note="Protein of unknown function (DUF1173); Region:
FT                   DUF1173; pfam06666"
FT                   /db_xref="CDD:148331"
FT                   /locus_tag="pBCA016"
FT   misc_feature    complement(22288..23445)
FT                   /note="HMMPfam hit to PF06666, Protein of unknown function
FT                   (DUF1173), score 1.1e-140"
FT                   /locus_tag="pBCA016"
FT                   /inference="protein motif:HMMPfam:PF06666"
FT   gene            complement(23454..24866)
FT                   /db_xref="GeneID:6926411"
FT                   /locus_tag="pBCA017"
FT   CDS_pept        complement(23454..24866)
FT                   /locus_tag="pBCA017"
FT                   /gene_family="HOG000229806" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="N-terminus is similar to the N-terminal regions of
FT                   Xanthomonas axonopodis hypothetical protein xacb0057
FT                   SWALL:Q8PRH5 (EMBL:AE008925) (395 aa) fasta scores: E():
FT                   4.9e-25, 37.7% id in 313 aa, and Pseudomonas alcaligenes
FT                   hypothetical protein SWALL:Q9XAX4 (EMBL:U88088) (522 aa)
FT                   fasta scores: E(): 7.5e-23, 30.19% id in 414 aa"
FT                   /db_xref="GI:206479942"
FT                   /db_xref="GeneID:6926411"
FT                   /translation="MPRELTDNELHRLYRAVEVADISRTAHQETPIAIMTGGQPGSGKT
FT                   GLTGIALQELALRGGAVVIDADRMREYNPDYRRLMASDPEHAADLTHPTAAQWANQLRD
FT                   RAIFERRNLVVDGTMRDPNDVARVAKQLKDAGYIVDARVMAVPGDVSFAHARLRYESLD
FT                   NEAQAGRVVNQRQHDAAYAGVPQSLERLEANKLVDRITIYDTARREVYQNVLEGGQWKA
FT                   PPQAAQTLVAVRDRGRTRDERADYVDALTTIEAQTAVRNSVSPGRGPQDRADWIEKIDA
FT                   ARKELAQFEQSPTYARAKAFDDGPSVATLARHPELDGAYKQLADLRKSFSPETPEGERD
FT                   RQYSAAVASLSEQLHRGEIPKGDVGPEDSRRVINSAARERNLVVREPEPDRIVQGEVLA
FT                   RSSQHTLVHVAGSDNIAFVYTRAQLERDIEPGEKLGLAHEQHGATRVMTQQQAQEMTDL
FT                   TRDRDAGMERSR"
FT                   /protein_id="YP_002235453.1"
FT   misc_feature    complement(24237..24803)
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="pBCA017"
FT   misc_feature    complement(24174..24854)
FT                   /note="HMMPfam hit to PF06414, Zeta toxin, score 9.5e-62"
FT                   /locus_tag="pBCA017"
FT                   /inference="protein motif:HMMPfam:PF06414"
FT   misc_feature    complement(24732..24755)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /locus_tag="pBCA017"
FT                   /inference="protein motif:Prosite:PS00017"
FT   gene            complement(24877..25143)
FT                   /db_xref="GeneID:6926412"
FT                   /locus_tag="pBCA018"
FT   CDS_pept        complement(24877..25143)
FT                   /locus_tag="pBCA018"
FT                   /gene_family="HOG000222240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206479943"
FT                   /db_xref="GeneID:6926412"
FT                   /translation="MQKNALFNHGIVRYEVALGVVGAVISKCADQIGDALRQTPPDMET
FT                   VTHLQAKQRELEVLRTAIDPFDVEKINSVIAQYGPLVRGEQIL"
FT                   /protein_id="YP_002235454.1"
FT   gene            25685..26167
FT                   /db_xref="GeneID:6926413"
FT                   /locus_tag="pBCA019"
FT   CDS_pept        25685..26167
FT                   /locus_tag="pBCA019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:206479944"
FT                   /db_xref="GeneID:6926413"
FT                   /translation="MNHGVSSLWHPKHTGTYRTHPAQERDTTVGKGFEMKAFLRVVWHP
FT                   LRYLLRFAWFRRFAPVWLVATLLLWAGTVELLNRVGWIGAVTVLNDLIVVRVVIALVEA
FT                   LVGTTFRRSATSAVATSFDDVSFAPKSPSVPMYVTAHGVTPTPVGDEWTTATKLIS"
FT                   /protein_id="YP_002235455.1"
FT   gene            25865..26014
FT                   /db_xref="GeneID:6926414"
FT                   /locus_tag="pBS019"
FT   misc_feature    join(25865..25933,25961..26014)
FT                   /note="2 probable transmembrane helices predicted for
FT                   pBS019 by TMHMM2.0 at aa 61-83 and 93-110"
FT                   /locus_tag="pBS019"
FT                   /inference="protein motif:TMHMM:2.0"
FT   gene            complement(26157..29195)
FT                   /db_xref="GeneID:6926490"
FT                   /locus_tag="pBCA020"