(data stored in ACNUC8465 zone)

HOGENOMDNA: BURCM_4

ID   BURCM_4; SV 1; empty ; DNA; empty ; PRO; 1281472 BP.
XX
AC   NC_008392;
XX
PR   Project: 58303;
XX
DE   Burkholderia cepacia AMMD chromosome 3, complete sequence.
XX
OS   Burkholderia ambifaria AMMD
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1281472
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Bruce,D., Chain,P., Malfatti,S.,
RA   Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Kim,E., Parke,J., Coenye,T., Konstantinidis,K., Ramette,A.,
RA   Tiedje,J. and Richardson,P.;
RT   "Complete sequence of Chromosome 3 of Burkholderia cepacia AMMD";
RL   Unpublished
XX
RN   [2]
RP   1-1281472
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (28-SEP-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1281472
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Bruce,D., Chain,P., Malfatti,S.,
RA   Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Kim,E., Parke,J., Coenye,T., Konstantinidis,K., Ramette,A.,
RA   Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (22-AUG-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000442.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000046
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1281472
FT                   /strain="AMMD"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia ambifaria AMMD"
FT                   /chromosome="3"
FT                   /db_xref="taxon:339670"
FT   gene            complement(82..906)
FT                   /db_xref="GeneID:4314534"
FT                   /locus_tag="Bamb_5574"
FT   CDS_pept        complement(82..906)
FT                   /locus_tag="Bamb_5574"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IclR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: pfl:PFL_2281
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="GI:115360318"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="GeneID:4314534"
FT                   /translation="MTRKTSGARPKAFLDPDETPDALFNQSLEKGIAVLRAFSAQRRSM
FT                   TLPEVAEATSITKSSAQRMIYTLEKLGYVRKHPRTKRYQLAPRVMQIGFNYLAADTLID
FT                   VANPFLSELTNVIGETTNLTEPDGLDMVYVARFVCMKFVPIHMPIGSRIPMYCTASGRA
FT                   YLAALPDDESRALLAASDRVTHTQYTVTDLEEIGRRLVLGRRNGYASNREELFIGDMTI
FT                   AAAVLDGERRPVGAVHVVAPTSRWTLADAEARLAPAVIDCARSISNSIRTLA"
FT                   /protein_id="YP_777455.1"
FT   misc_feature    complement(568..834)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bamb_5574"
FT   misc_feature    complement(106..831)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Bamb_5574"
FT   misc_feature    complement(103..462)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Bamb_5574"
FT   gene            1061..1825
FT                   /db_xref="GeneID:4314535"
FT                   /locus_tag="Bamb_5575"
FT   CDS_pept        1061..1825
FT                   /locus_tag="Bamb_5575"
FT                   /gene_family="HOG000031896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: rso:RSc3410 probable amino acid-binding
FT                   periplasmic (pbp) ABC transporter protein"
FT                   /db_xref="GI:115360319"
FT                   /db_xref="InterPro:IPR001311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:4314535"
FT                   /translation="MFQFAKRFASVFATGLLLAGAPAWAVAATTYEVGSTATGVPFTFL
FT                   DVKSNSIQGLLVDAITATGKAASFDVKIEQTTFSSLIPSLTTKKIDIISAAMLKTPARE
FT                   QVVDFSDTVYSYGEGLIVRADDKRQYTSMDDLKGEIVGAQVGTAFVDALNKKGIFKEVR
FT                   TYDSVADIMRDVALGRIKAGFGDHPIIAYQLQHNPNPQLRLVSGYQPSVKGQLCFVVRK
FT                   GDTATLEQLNAGIKKIKADGTLTQIVKKWQVE"
FT                   /protein_id="YP_777456.1"
FT   sig_peptide     1061..1138
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.962 at
FT                   residue 26"
FT                   /locus_tag="Bamb_5575"
FT                   /product="hypothetical protein"
FT   misc_feature    1157..1813
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bamb_5575"
FT   misc_feature    1157..1813
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="Bamb_5575"
FT   misc_feature    order(1175..1177,1292..1294,1367..1369,1502..1504,
FT                   1616..1618)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bamb_5575"
FT   misc_feature    order(1565..1567,1577..1579,1595..1597)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bamb_5575"
FT   misc_feature    1694..1711
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bamb_5575"
FT   gene            1855..2511
FT                   /db_xref="GeneID:4314536"
FT                   /locus_tag="Bamb_5576"
FT   CDS_pept        1855..2511
FT                   /locus_tag="Bamb_5576"
FT                   /gene_family="HOG000267552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc3409
FT                   probable amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="GI:115360320"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="GeneID:4314536"
FT                   /translation="MFFQNAVEFLPILLKGAVVTIEITFCSFVLSTVLGLLLALMRVSD
FT                   NRVLSNTAATFINVIRGLPIIVQLFYIYFVLPDLGVQLSAFQAGFIGLGIAYSVYQAEN
FT                   FRAGIQAIDHGQIEAAQSIGMRGTMIMRRVVLPQAFRIALPPYGNTLVMMLKDSSLAST
FT                   ITVAEMTRAGQLIASSTFQNMTVFTLVALLYLGLSLPLVYGLRRLERRLGLKGKR"
FT                   /protein_id="YP_777457.1"
FT   misc_feature    1903..2415
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bamb_5576"
FT   misc_feature    order(1951..1956,1963..1968,1981..1983,2011..2022,
FT                   2026..2055,2062..2067,2071..2073,2137..2142,2146..2148,
FT                   2152..2154,2161..2166,2170..2172,2182..2187,2194..2196,
FT                   2245..2247,2287..2292,2299..2301,2320..2331,2338..2343,
FT                   2380..2385,2413..2415)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bamb_5576"
FT   misc_feature    order(2029..2073,2320..2337)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bamb_5576"
FT   misc_feature    order(2071..2073,2131..2133,2338..2340,2374..2376,
FT                   2383..2385,2413..2415)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bamb_5576"
FT   misc_feature    order(2197..2235,2251..2256,2266..2268)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bamb_5576"
FT   gene            2508..3254
FT                   /db_xref="GeneID:4314537"
FT                   /locus_tag="Bamb_5577"
FT   CDS_pept        2508..3254
FT                   /locus_tag="Bamb_5577"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pfl:PFL_2284 amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="GI:115360321"
FT                   /db_xref="InterPro:IPR001687"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4314537"
FT                   /translation="MIKVDSIHKRFHDQHVLKGVSLNVERGQVVCLIGPSGSGKSTLLR
FT                   CINGLERHDAGEITVEGRTVDAKSKQIHELRAQVGMVFQRFNLFPHRTALENVFEGPVF
FT                   VKKQARAQAREHARHLLDKVGLAHRMNAHPAELSGGQQQRVAIARALAMEPKAILFDEP
FT                   TSALDPELVGEVLGVMRQLADDGMTMIVVTHEMAFAREVADRVCFLHDGAIHEEGSAAE
FT                   LFDRPRHARTREFLGKMPALAEAPRI"
FT                   /protein_id="YP_777458.1"
FT   misc_feature    2508..3221
FT                   /note="ABC-type polar amino acid transport system, ATPase
FT                   component [Amino acid transport and metabolism]; Region:
FT                   GlnQ; COG1126"
FT                   /db_xref="CDD:31323"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    2511..3149
FT                   /note="HisP and GlnQ are the ATP-binding components of the
FT                   bacterial periplasmic histidine and glutamine permeases,
FT                   repectively.  Histidine permease is a multisubunit complex
FT                   containing the HisQ and HisM integral membrane subunits and
FT                   two copies of HisP...; Region: ABC_HisP_GlnQ_permeases;
FT                   cd03262"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    2607..2630
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    order(2616..2621,2625..2633,2757..2759,2988..2993,
FT                   3087..3089)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    2748..2759
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    2916..2945
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    2976..2993
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    3000..3011
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   misc_feature    3075..3095
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="Bamb_5577"
FT   gene            3263..4561
FT                   /db_xref="GeneID:4314538"
FT                   /locus_tag="Bamb_5578"
FT   CDS_pept        3263..4561
FT                   /locus_tag="Bamb_5578"
FT                   /gene_family="HOG000185563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pfl:PFL_2285 oxidoreductase, FAD-binding"
FT                   /db_xref="GI:115360322"
FT                   /db_xref="InterPro:IPR000205"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:4314538"
FT                   /translation="MNLAEVEVAKPLPPSLWAATAEPAVVTPRLDSSTVVDVTIVGAGY
FT                   TGLSTALHLAEQGLRVCVIDANEPGWGASGRNGGQVIPGLKYDPDELIRRYGPHDGNAL
FT                   VQMAGGAADTVFDLVARHGIRCDATRAGWIQPTHSHKLLKTLYARAGQWEARGAPVELL
FT                   DRAQVSKRLGTDAFVGGWVDRRAGSVQPLSYARGLARAAQAAGAEIHGGTRAAGVERGA
FT                   NGWRIRTAHGPVIESKQVLLATNGYTDGLWPRLAQSVIAANSFIVATKPLADDVGATIL
FT                   AGGEVTSDSRRLLLYFRKDADGRLLMGGRGPFRDPRSAGDWVHLERAAQLMFPHIKDIE
FT                   FEFRWAGRIAITRNFLPHVHVPAEGMTIALGYNGRGIAMATTLGKHLAALIGGTTRGLP
FT                   LPPTSIEPVPFHALQRLYISAGVAWYGLLDALS"
FT                   /protein_id="YP_777459.1"
FT   misc_feature    3314..4441
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Bamb_5578"
FT   misc_feature    3371..4288
FT                   /note="FAD dependent oxidoreductase; Region: DAO;
FT                   pfam01266"
FT                   /db_xref="CDD:144747"
FT                   /locus_tag="Bamb_5578"
FT   gene            5095..6573
FT                   /db_xref="GeneID:4314516"
FT                   /locus_tag="Bamb_5579"
FT   CDS_pept        5095..6573
FT                   /locus_tag="Bamb_5579"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="benzaldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.28"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: pfo:Pfl_2977
FT                   aldehyde dehydrogenase"
FT                   /db_xref="GI:115360323"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4314516"
FT                   /translation="MDSSISTNTALFNADVWCGKTFNGRWHASPLSADVIEPATGNTLG
FT                   RIGLADSTAIADASAAAHRAQPAWFGLPYDERAAVLRRAAAVAETHFDAIVDWLVRESG
FT                   STRAKASFETSVTIKALHEAAGLPSRAAGEVLPSAAGRLSLARRRPRGVVGVISPFNFP
FT                   LYLAMRAVAPALALGNAVVLKPDPRTAVCGGVAIARVFELAGLPAGVLHVLPGDGAAGA
FT                   ALVADPHVAMIQFTGSTAAGRKVGEAAGRHLKKVSLELGGKNSLIVLDDADLDRAVANT
FT                   AWGAYLHQGQICMATGRVLVQRAIHDRFVAKLVEKAQSLRVGDPATGDVGLGPLINAAQ
FT                   RDHAASVVDAARRAGARVETGGGHRDLFFEPTVLSGVAPGNPAFDEEIFGPVAIVVPFD
FT                   TDEDAIALANRTEYGLSMAILSADVGRALRIGERLNTGLLHINDQTVNDEAINPFGGVG
FT                   ASGNGSSIGGAANWEEFTQWQWLTIKGEAPLYPI"
FT                   /transl_table="11"
FT                   /protein_id="YP_777460.1"
FT   misc_feature    5215..6543
FT                   /note="NAD(P)+-dependent aldehyde dehydrogenase
FT                   superfamily; Region: ALDH-SF; cl11961"
FT                   /db_xref="CDD:176616"
FT                   /locus_tag="Bamb_5579"
FT   misc_feature    order(5563..5577,5599..5601,5644..5646,5650..5655,
FT                   5797..5808,5815..5817,5824..5829,5869..5877,5971..5973,
FT                   6253..6255,6259..6261,6337..6339,6454..6456)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="Bamb_5579"
FT   misc_feature    order(5575..5577,5869..5871,5962..5964,5971..5973)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="Bamb_5579"
FT   gene            6588..7715
FT                   /db_xref="GeneID:4314517"
FT                   /locus_tag="Bamb_5580"
FT   CDS_pept        6588..7715
FT                   /locus_tag="Bamb_5580"
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   aci:ACIAD1429 aryl-alcohol dehydrogenase"
FT                   /db_xref="GI:115360324"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:4314517"
FT                   /translation="MYTENDTRAVTAAVARAAGAPFSIEPARIRAPRGDEVLVRVVATG
FT                   LCHTDLIVRDQYYPVPLPAVLGHEGAGVVEAVGPNVKMLAAGDHVVLTYGACGHCASCV
FT                   GGHGAYCRQFFALNFGGADADGQTALRDAAGEPLHDHFFAQSSFASYALARENNAIKVP
FT                   KEAPLELLGPLGCGIQTGAGAVINSLAVRTGSSFASFGAGAVGMSAVMAARIAGATAII
FT                   AVDIVPSRLALALELGATHAINSKEVDVADAIREITGGGVDYALESTGLPAVLSQGIDA
FT                   LGSRGTIGVVGAPKLGTKAEFDVNSLLLGGHTIRGIVEGDSVPQTFIPQLVQLHLQGRF
FT                   PFDRLVKFYPLEQINQAAADSSSGITLKPILRLPH"
FT                   /protein_id="YP_777461.1"
FT   misc_feature    6642..7706
FT                   /note="Zn-dependent alcohol dehydrogenases, class III
FT                   [Energy production and conversion]; Region: AdhC; COG1062"
FT                   /db_xref="CDD:31262"
FT                   /locus_tag="Bamb_5580"
FT   misc_feature    6642..7703
FT                   /note="Benzyl alcohol dehydrogenase; Region:
FT                   benzyl_alcohol_DH; cd08278"
FT                   /db_xref="CDD:176239"
FT                   /locus_tag="Bamb_5580"
FT   misc_feature    order(6726..6728,6732..6734,6789..6791,7113..7115)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176239"
FT                   /locus_tag="Bamb_5580"
FT   misc_feature    order(6729..6734,7113..7115,7125..7127,7191..7202,
FT                   7260..7268,7275..7277,7320..7322,7389..7394,7458..7466,
FT                   7536..7544)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176239"
FT                   /locus_tag="Bamb_5580"
FT   misc_feature    order(6876..6878,6885..6887,6894..6896,6918..6920)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176239"
FT                   /locus_tag="Bamb_5580"
FT   gene            7884..9053
FT                   /db_xref="GeneID:4314518"
FT                   /locus_tag="Bamb_5581"
FT   CDS_pept        7884..9053
FT                   /locus_tag="Bamb_5581"
FT                   /gene_family="HOG000268499" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG: pfo:Pfl_2976
FT                   possible transcriptional regulator, fis family"
FT                   /db_xref="GI:115360325"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:4314518"
FT                   /translation="MNTAPESPARLVDLDRLRARFAAGEPLPETALPASVARSWLRSRD
FT                   AGLRPWQHARYEMQRELDESRADRRLYRCVAQEIEPLWAAFGGREWTIFCVNPRGTIVH
FT                   ARRSPQCDDALLTPIVAGRRIVEPNIGTTAPSCVIHDGAEAVVAGAQHYLDEFSRVFCL
FT                   AVPLVGLDGEVIGALDITGIGRRNVAQLREQFRHAALSAEQRLYAMLRDCHLLQVQHDP
FT                   RWLGTPLAGVIALDGAGRVRAVSRLARQMLDLAPAGPVAPYDLRQLFPGATPAQQRRLL
FT                   TPARTPQRIARDDGSHVWVRTLRAPLDRATMSRHADVLEDAADVCTAAPAASPQASLHE
FT                   QSLEAIRRALREHDGNVSAAARQLGISRTTLYAKLKRLEAAGIGTDGLH"
FT                   /protein_id="YP_777462.1"
FT   misc_feature    7974..>8846
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Bamb_5581"
FT   misc_feature    8913..9017
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Bamb_5581"
FT   gene            complement(9358..10590)
FT                   /db_xref="GeneID:4314519"
FT                   /locus_tag="Bamb_5582"
FT   CDS_pept        complement(9358..10590)
FT                   /locus_tag="Bamb_5582"
FT                   /gene_family="HOG000268498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar efflux transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_C7038 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="GI:115360326"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4314519"
FT                   /translation="MRRAGCPRHQPSSNSRMATPDAVSSEQSWWGVLALALTAFIFNTT
FT                   EFVPVALLSAIGDSLQMQPTAVGLMLTIYAWAVAVVSLPLTFVTRHVERRKLLSCALLV
FT                   FIGSHVLTGVAWNFTVLMLGRLGIACAHAVFWSISVPLAVRLAPSDRKSRALGLLAMGT
FT                   ATAMVAGIPLGRVIGEALGWRVTFLVIGGAAAVALLALRMTLPTLHSEGAGSLASIGTF
FT                   LRKPALVSLYAITVLVISAHFTSYTYIEPFVQSVNHASSSRITYVLILFGVAGVPAALC
FT                   FNRVFPERPADFLIASIIALSACLLILFPSALNIVTLSVHTLVWGGAIVCFGLAMQAWV
FT                   LKLAPEATDLAVSIFSGLYNVGIGAGALLGNHIAGAFGLPWIGTFGGVVGIFSAGIAWA
FT                   ALRLHERRAVA"
FT                   /protein_id="YP_777463.1"
FT   misc_feature    complement(9361..10527)
FT                   /note="sugar efflux transporter; Provisional; Region:
FT                   PRK03545"
FT                   /db_xref="CDD:167544"
FT                   /locus_tag="Bamb_5582"
FT   misc_feature    complement(9397..10497)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bamb_5582"
FT   misc_feature    complement(order(9502..9504,9511..9516,9523..9528,
FT                   9535..9540,9571..9573,9580..9585,9595..9597,9601..9603,
FT                   9610..9612,9754..9756,9766..9768,9775..9777,9787..9789,
FT                   9799..9801,9841..9843,9850..9855,9862..9867,9874..9876,
FT                   10090..10092,10108..10113,10120..10125,10159..10161,
FT                   10168..10173,10180..10185,10192..10197,10333..10338,
FT                   10342..10347,10357..10359,10366..10371,10378..10380,
FT                   10429..10434,10438..10446,10453..10455))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bamb_5582"
FT   gene            10736..11410
FT                   /db_xref="GeneID:4314520"
FT                   /locus_tag="Bamb_5583"
FT   CDS_pept        10736..11410
FT                   /locus_tag="Bamb_5583"
FT                   /gene_family="HOG000248344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD family hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bur:Bcep18194_C7037 HAD-superfamily hydrolase
FT                   subfamily IA, variant 3"
FT                   /db_xref="GI:115360327"
FT                   /db_xref="InterPro:IPR005833"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="GeneID:4314520"
FT                   /translation="MRIETSFLFDLDGTLVDSVYQHVLAWKEALDAEGIELSVWRIHRK
FT                   IGMSGGLFLNQLLRETAGDIDAERVERLARLHAAAYQRLRAQVRPLPGARELLGALTNA
FT                   GISWAIATSGRMETAAINLEALGVDPEKNVVVTRDQVKYAKPDPDLFLTAAAKLNVPIE
FT                   HTVVVGDSIWDMLAASRCRALGVGLLSGGYGSDELERAGALRVYDDPADLLWHLDEIAA
FT                   RP"
FT                   /protein_id="YP_777464.1"
FT   misc_feature    10748..11248
FT                   /note="beta-phosphoglucomutase family hydrolase; Region:
FT                   PGMB-YQAB-SF; TIGR02009"
FT                   /db_xref="CDD:162658"
FT                   /locus_tag="Bamb_5583"
FT   misc_feature    10976..11278
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bamb_5583"
FT   misc_feature    11069..11071
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bamb_5583"
FT   gene            complement(11531..11773)
FT                   /db_xref="GeneID:4314521"
FT                   /locus_tag="Bamb_5584"
FT   CDS_pept        complement(11531..11773)
FT                   /locus_tag="Bamb_5584"
FT                   /gene_family="HOG000268222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7036 hypothetical protein"
FT                   /db_xref="GI:115360328"
FT                   /db_xref="GeneID:4314521"
FT                   /translation="MQHQQDAQVRDPYRGHEIRVWARRNARGAWDDEVQVYVDGARIEL
FT                   YVPEPAGTEWLTEDEALRAGVERGRYLVDKRVDDD"
FT                   /protein_id="YP_777465.1"
FT   gene            11974..12669
FT                   /db_xref="GeneID:4314522"
FT                   /locus_tag="Bamb_5585"
FT   CDS_pept        11974..12669
FT                   /locus_tag="Bamb_5585"
FT                   /gene_family="HOG000080250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MgtC/SapB transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: mgtC; MgtC family
FT                   membrane protein"
FT                   /db_xref="GI:115360329"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="GeneID:4314522"
FT                   /translation="MIGHLELLGRLLLAALLGSVIGLERERLNWAAGLRTHMLVCVGSA
FT                   LVMLVSTFGFEDVHGQSGVVLDPSRVAAQVVSGIGFLGAGSILLRGEVVRGLTTAASLW
FT                   AVAGVGLAVGGGMYVASLGATVIVLVILAGVKPLERRFITQRQQRTLRLVVQRGGLTLG
FT                   KLHDTLGTDRVRVKRFIVQQSDDDPDTDDISVSFSRTSGAEFAAICAALQNLAGVRTCR
FT                   PDTSSRSFA"
FT                   /protein_id="YP_777466.1"
FT   misc_feature    12043..12396
FT                   /note="MgtC family; Region: MgtC; pfam02308"
FT                   /db_xref="CDD:111223"
FT                   /locus_tag="Bamb_5585"
FT   gene            12666..13004
FT                   /db_xref="GeneID:4314523"
FT                   /locus_tag="Bamb_5586"
FT   CDS_pept        12666..13004
FT                   /locus_tag="Bamb_5586"
FT                   /gene_family="HOG000268443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7035 hypothetical protein"
FT                   /db_xref="GI:115360330"
FT                   /db_xref="GeneID:4314523"
FT                   /translation="MTQTDLLSYLVTSQLTARMRGGAWMTASQTVGALRAWLACHHAEC
FT                   GWLDRIRIADASATIAQGIYEIACAYGDPDSGERIRLDADSPELQALRARCDVLLQRID
FT                   GDRDVDAR"
FT                   /protein_id="YP_777467.1"
FT   gene            13001..15220
FT                   /db_xref="GeneID:4314524"
FT                   /locus_tag="Bamb_5587"
FT   CDS_pept        13001..15220
FT                   /locus_tag="Bamb_5587"
FT                   /gene_family="HOG000268442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /transl_table="11"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bps:BPSS1381 transmembrane phospholipase protein"
FT                   /db_xref="GI:115360331"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:4314524"
FT                   /translation="MIVPARMTRASVATARSDGATADPSRTDEPLRHGLLERGRNCDTI
FT                   RHADRFAMLVDGDAYFATLRAALLRARHTVFIVGWDVDSRMHLPPADPGDRLPDTLAAF
FT                   LHALASSRHNLRIYVLAWDFAMIYALERDWPPVYRAAWRAHRGIRFRLDDTHPRGASHH
FT                   QKLVVIDDRLAFVGGLDLTRARWDTPAHAADDPRRRDAHGMPYGPFHDVQAMFDGDAAA
FT                   AIGKQARARWFNACGRPIAIRAQRHLDREEDVDPWPPDARVDLRDVRLGIAYTAPRHRD
FT                   REPVRQVSALVEDTIRAARRHLYIENQYFTAAVVRETLSERLADPEGPDVTVVAPRVQS
FT                   GWLQEATMGVLRARLHGTLKAADRFDRYRLLYPHVDGLGDACVNVHSKIAIADDEWIVI
FT                   GSANLNNRSMVLDTECCIALVAAGEPRIRTAIAGLRDRLLAEHLDTTPAEIAAALAHDE
FT                   RPNTVLDRLRDKPGRTLRTLEPVVTPQLDALVPVSARLDPEQPIEPDRFVREFVPREQH
FT                   RVLTARFFVLGAAVLLVAALALAWRFSPLGKELNIASLARMAAHAAQLPGAPALLLAGY
FT                   VIAATLSVPITLLITVTGLVFGAWPGFAYAALGTMAAAATTYGIGHWLGRDAVRRLAGA
FT                   RANRLSEHLGRRGVVAMAVLRLLPIAPFTIVNLVAGASHIGLRDYLVGTAIGMLPGIVL
FT                   TVTFAHQLTAAFSHPGPGAFAWLAAIGAVLVGVSVLLVRVLRRWR"
FT                   /protein_id="YP_777468.1"
FT   misc_feature    13052..14245
FT                   /note="Phosphatidylserine/phosphatidylglycerophosphate/car
FT                   diolipin synthases and related enzymes [Lipid metabolism];
FT                   Region: Cls; COG1502"
FT                   /db_xref="CDD:31691"
FT                   /locus_tag="Bamb_5587"
FT   misc_feature    13481..13555
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cl12059"
FT                   /db_xref="CDD:159719"
FT                   /locus_tag="Bamb_5587"
FT   misc_feature    13799..14257
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bamb_5587"
FT   misc_feature    order(14156..14158,14162..14164,14201..14203,14207..14209,
FT                   14240..14242)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bamb_5587"
FT   misc_feature    order(14156..14158,14162..14164,14177..14179,14198..14203,
FT                   14207..14209)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bamb_5587"
FT   misc_feature    14750..15103
FT                   /note="SNARE associated Golgi protein; Region: SNARE_assoc;
FT                   cl00429"
FT                   /db_xref="CDD:174199"
FT                   /locus_tag="Bamb_5587"
FT   gene            15211..16020
FT                   /db_xref="GeneID:4314525"
FT                   /locus_tag="Bamb_5588"
FT   CDS_pept        15211..16020
FT                   /locus_tag="Bamb_5588"
FT                   /gene_family="HOG000261041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   putative endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="GI:115360332"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="GeneID:4314525"
FT                   /translation="MALSVQPAPPPNIVTSDGPPPAAPGGRDLRIATYNIRGGYGKWHT
FT                   RAAHRIAQVIHELDADVIALQEVPLGGTHAPDVLAHLRDATGMHAVAGPTIDTPERRYG
FT                   NAVLSRCPIRAARTLDLSFHQREPRGALDADIDSSAGMIRVVATHLGLSASERSAQVQR
FT                   LLAAFDTGAMPVILMGDINEWFVRGRALRALVTRFRRAPAPRTFPTLYPVFSLDRIWIH
FT                   PGEWLVDVNVHRSMRARRASDHYPLVARMRATPGTPLARRAPHPDET"
FT                   /protein_id="YP_777469.1"
FT   misc_feature    15295..15975
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:174238"
FT                   /locus_tag="Bamb_5588"
FT   gene            16033..16521
FT                   /db_xref="GeneID:4314526"
FT                   /locus_tag="Bamb_5589"
FT   CDS_pept        16033..16521
FT                   /locus_tag="Bamb_5589"
FT                   /gene_family="HOG000268421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSS1383 hypothetical protein"
FT                   /db_xref="GI:115360333"
FT                   /db_xref="GeneID:4314526"
FT                   /translation="MRTDELAGTALDYWCARALCADDEDTLCFTAVDPKVILTGACDAL
FT                   RRLDAHFAPSASWADAGAVLERVADLRITRRGDGVECDASFIDGPSTCAARAPDVRTAV
FT                   LRAFVRARFGDEVDAPPSFAHRIENGAAVRYDPGVPIPEADDDAATGDSSDIRSIPRM"
FT                   /protein_id="YP_777470.1"
FT   gene            16822..20232
FT                   /db_xref="GeneID:4314527"
FT                   /locus_tag="Bamb_5590"
FT   CDS_pept        16822..20232
FT                   /locus_tag="Bamb_5590"
FT                   /gene_family="HOG000239230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha amylase, catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: bur:Bcep18194_C7034
FT                   alpha amylase like protein"
FT                   /db_xref="GI:115360334"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:4314527"
FT                   /translation="MNPTPPFAPHIYFCDARLVGPLDAWPDTFQHIAGMGFDHVLIGGF
FT                   WAASVAGFPRHVADFHRPAATFATRAGALETFSRLAQLAHGHGLRVLLEVVPDRIARDN
FT                   PLRTEHPDWYVERAHDDALIDPRSAAHEMDVAHAQVGEDAAHDALSAWWCTHLATFADA
FT                   GASGFLIDAPHHLPAAWWPGWRAALRRARPDVAVLAGVPGHARDALAQLEAAGFDAVFS
FT                   SVRWWDLHAPWFVDEHRLLRRIGSPIAFPDAIDGPRLADNWNTAPDETVARAYHRALWT
FT                   AAAVGTGWLVPMGFERGVTLPLMARDADAARFRAALDDARFDLSGAIADANAWRRATPL
FT                   AAERGEIAQLSAPGARATALLRGSGPSLEHDDTALLIALNPDLDAPTHVDPATILPGVP
FT                   GGFTHVSPPNGARKSAPAAPAAPVALQAFTLEPGGYALLDARRAPPALARTDAAGERTA
FT                   LSAALAADRIAIERVEPAVDGGRFAIKRVIGETLVVHASIFTDGHAHLAAALQWRADDE
FT                   DAWREVPFVAEPNDRWHACISLDRLGRHAFRVIAWRDDWASLVTDITKKRAAGQDVTLE
FT                   LREAQLLLATALKHADAVDRRARTRMEQLTAEFNDAAPDKRLELLGAPALADAYAALRY
FT                   RPFVTHDDAVYPVDVERRAARFSSWYEMFPRSASNDPHRHGTFDDVIAQLPRIRDMGFD
FT                   VLYFPPIHPIGTTARKGRNNTLTAGPDDVGSPYAIGSPEGGHTAVHPQLGTLASFRTLV
FT                   DAAHAQGLEIALDFAIQCSPDHPWLAAHPGWFAWRPDGSLRYAENPPKRYQDIVNPDFY
FT                   APDALPDLWVALRDAVLFWVDAGVRIFRVDNPHTKPLPFWAWMIADVRGKHPDVVFLSE
FT                   AFTRPGMMYRLAKVGFSQSYTYFTWRETKREFIDYLTELTAGPAREFFRPNFFVNTPDI
FT                   NPRHLQNAPRSQFVIRAALAATLAGSWGLYSGFEIGESAPLPDSEEYADAEKYELRVRD
FT                   WRKAAHIGGEIARLNRARRDHPALQTHLGLTFVDADNDQVLVFVKATPAHDSVVAVAIS
FT                   LDPWHPQAANFTLDAALWRGFGLVDGEPLDALEQDAAHAETWRGHRQYVSLDPHVRPYA
FT                   IWRLAPSPGAARAAAPDPADARGHSGAHG"
FT                   /protein_id="YP_777471.1"
FT   misc_feature    16876..>17364
FT                   /note="Glycosidases [Carbohydrate transport and
FT                   metabolism]; Region: AmyA; COG0366"
FT                   /db_xref="CDD:30715"
FT                   /locus_tag="Bamb_5590"
FT   misc_feature    18235..18780
FT                   /note="Domain of unknown function (DUF3416); Region:
FT                   DUF3416; pfam11896"
FT                   /db_xref="CDD:152332"
FT                   /locus_tag="Bamb_5590"
FT   misc_feature    18847..>19440
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5590"
FT   gene            20229..23642
FT                   /db_xref="GeneID:4314528"
FT                   /locus_tag="Bamb_5591"
FT   CDS_pept        20229..23642
FT                   /locus_tag="Bamb_5591"
FT                   /gene_family="HOG000268420" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trehalose synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7033 glycoside hydrolase,
FT                   family 16; TIGRFAM: trehalose synthase; trehalose
FT                   synthase-fused possible maltokinase; PFAM: alpha amylase,
FT                   catalytic region; SMART: alpha amylase, catalytic sub
FT                   domain"
FT                   /db_xref="GI:115360335"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="GeneID:4314528"
FT                   /translation="MMKREDPLDDVRRAQFPSLAPAGTPRRRRSRRRAPALCADDPLWY
FT                   KDAIIYQVHVKSFYDSNNDGIGDFPGLIMKLDYIAELGVDTIWLLPFYPSPRRDDGYDI
FT                   ADYRDVHPDYGTLADVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMHR
FT                   DYYVWSDTDTKYAGTRIIFLDTETSNWTHDPIAGQYYWHRFYSHQPDLNFDNPAVVREV
FT                   IQVMRFWLDLGIDGLRLDAVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLA
FT                   EANQWPEDVQEYFGEENECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQW
FT                   AVFLRNHDELTLEMVTDSERDLLWQTYASDRRARINLGIRRRLAPLMERDRRRIELINS
FT                   LLLSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVM
FT                   GALYGYDAVNVEAQTRDPHSLLNWTRRILSTRRATQSFGRGTIRFLRPDNRKVLAYLRE
FT                   LEGHETVLCVANLSRASQAVELDLSEFAGRVPIEMTSDSAFPPIGQLTYLLTFPPYGFL
FT                   WFVLSEHGREPSWRQPHAEPLPEYVTIVMRRGDARPDVGQLHTLAHDALASWLTRRRWF
FT                   ASKDRKIGDAWLNVVTPMPDEPFQYAEAWVSASDGGVERYVVPLATAWGGETSHPLFTQ
FT                   LALARVRRGHTVGYLTDAFALPAFARGMLRKLRDGATVPTSDGGRLDFLPEHALAGLDP
FT                   GDEAEVRWLAAEQSNSSLVIGDAIVLKLVRKVAHGVHPEAEMSRHLTRIGYANTATLAG
FT                   EVVHVDPDGTPHTVAILQRYVDNQGDAWTRSFDFLRRAIDELALPAAGDGDAAEVDDEP
FT                   DALLGYAAFAGIIGTRLGQLHVALAQPSDDPAFAPEAATPEHVDGWCVDAIASFERALD
FT                   VLRTQLDKLDPVNRAAADTLLASRDAAVQAIGELVPRTLDAQCTRVHGDFHLGQVLDVQ
FT                   GDALLIDFEGEPARALDRRRAKSHPLRDVAGLLRSLSYVSATAQFAIEKAPPQTAGRKR
FT                   ALFDRFGQAAADRFVECYRAAADQAPERFVDPRYADRLLALFLIDKASYELCYEAANRP
FT                   DWLGVPVGGLAALIERLLATDRAPDHGGNR"
FT                   /protein_id="YP_777472.1"
FT   misc_feature    20355..21968
FT                   /note="trehalose synthase; Region: treS_nterm; TIGR02456"
FT                   /db_xref="CDD:162863"
FT                   /locus_tag="Bamb_5591"
FT   misc_feature    20427..21482
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5591"
FT   misc_feature    22014..23591
FT                   /note="Uncharacterized protein, probably involved in
FT                   trehalose biosynthesis [Carbohydrate transport and
FT                   metabolism]; Region: Ble; cl01286"
FT                   /db_xref="CDD:163965"
FT                   /locus_tag="Bamb_5591"
FT   gene            23639..25840
FT                   /db_xref="GeneID:4314529"
FT                   /locus_tag="Bamb_5592"
FT   CDS_pept        23639..25840
FT                   /locus_tag="Bamb_5592"
FT                   /gene_family="HOG000283037" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="catalyzes the transfer of a segment of a
FT                   1,4-alpha-D-glucan chain to a primary hydroxy group in a
FT                   similar glucan chain"
FT                   /db_xref="GI:115360336"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:4314529"
FT                   /translation="MTDMLFDRTDIDALLAGRHPDPFACLGPHTDAGRVVVRALLPGAQ
FT                   RVRAVTPDGDELGALACVDDAGCFAGTLAHDGRYRLAIDWPDTRQITDDAYAFGTLLDE
FT                   AALARFAAGDPAAVLDCLGATPTRVDGVDGVRFAVWAPNAQRVSVVGDFNMWDGRRHPM
FT                   RLRRPWGVWELFVPGIGAGEHYKYELRAADGHVLPHKADPCARATEAPPRTASVVADTA
FT                   ALDAFAWHDDGWLHARPPADQRFRMPWSIYEVHAESWQRVPEDMDRSANWDELAERLIP
FT                   YVRGMGFTHVEFMPISEYPFGGSWGYQPLAQFAPSARFGPVDGFARFVDRAHAAGIGVI
FT                   VDWVPAHFPNDAHGLAQFDGSALYEHADPREGMHPDWNTCVFNLGRNEVSAFLIASALA
FT                   WARRYHVDGIRVDAVASMLYRDYSRNEGEWVPNIHGGRENLESVAFLRALNDTLHGTLA
FT                   PPGVVTFAEESTAWPGVTASTGDGGLGFDFKWNMGWMHDTLSYVREDPIHRRYHHDRMT
FT                   FGLVYAFSERFVLPLSHDEVVHGKGSLAVKMPGDAWQRLATLRAYFGFMWAHPGKKLLF
FT                   MGSEFAQWAEFAHDATPHWDLLDAPAHRGVQRLVRDLNRTYAAEPALHALDCHASGFFW
FT                   LIGDDRDNSVFAFARRDDSGRLVVAICNFTPVPRPGYRIGLPAPGHWRELMNTDAAVYG
FT                   GTNAGNDGAVWTEDVPSHGQSWSATLRLPPLATLWLSPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_777473.1"
FT   misc_feature    23639..25837
FT                   /note="glycogen branching enzyme; Provisional; Region:
FT                   PRK05402"
FT                   /db_xref="CDD:168023"
FT                   /locus_tag="Bamb_5592"
FT   misc_feature    23975..24295
FT                   /note="Glycogen branching enzyme N-terminus domain.
FT                   Glycogen branching enzyme (AKA 1,4 alpha glucan branching
FT                   enzyme) catalyzes the formation of alpha-1,6 branch points
FT                   in either glycogen or starch by cleavage of the alpha-1,4
FT                   glucosidic linkage yielding a...; Region:
FT                   Glycogen_branching_enzyme_N_term; cd02855"
FT                   /db_xref="CDD:30342"
FT                   /locus_tag="Bamb_5592"
FT   misc_feature    24449..>24679
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5592"
FT   misc_feature    25553..25834
FT                   /note="Alpha amylase, C-terminal all-beta domain; Region:
FT                   Alpha-amylase_C; cl02706"
FT                   /db_xref="CDD:155067"
FT                   /locus_tag="Bamb_5592"
FT   gene            25875..27989
FT                   /db_xref="GeneID:4314530"
FT                   /locus_tag="Bamb_5593"
FT   CDS_pept        25875..27989
FT                   /locus_tag="Bamb_5593"
FT                   /gene_family="HOG000239197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7031 glycogen debranching
FT                   enzyme GlgX; TIGRFAM: glycogen debranching enzyme GlgX;
FT                   PFAM: glycoside hydrolase, family 13 domain protein; alpha
FT                   amylase, catalytic region; SMART: alpha amylase, catalytic
FT                   sub domain"
FT                   /db_xref="GI:115360337"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="GeneID:4314530"
FT                   /translation="MPTALPSRLEPGRCYPLGATWDGLGTNFAVFSAHAHRIQLCVFDP
FT                   TGRKELARLDLPECTDEVWHGYLPNAHPGTVYGFRADGPYQPQHGHRFNPTKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSNRADLSMDRRDSAPAMPKAVVVDEAFDWRNDRRPDVPWR
FT                   STVIYETHVRGASMRRAGLRVPERGTFASLSHPAFIDHLLSIGVTTIELLPVHAFLQQR
FT                   ALVNRGLRNYWGYDTAAFFAPEPSYLTTRRLDEMRIAIRQLHAAGIEVVLDVVYNHTCE
FT                   GNELGPTLSWRGLDNASYYRLRQDDRRYHVDETGCGNTLNLSHPRVVQMVMDSLRYWAT
FT                   AFNIDGFRFDLGVTLGREDHGFEPGAGFFDALRQDPVLAQRKLITEPWDLGLGGYQLGR
FT                   HPPGFAEWNDRFRDTVRRFWRGDAGQRPELAARLAGSADLFNHQRRRTWASVNFVTAHD
FT                   GFTLADLVSYAHKHNEANGEDDRDGRDDNCSANWGVEGATDDASILDLRARVARSMLAT
FT                   LFTALGTPMIVAGDEFGRTQHGNNNAYCQDNEISWLDWDLAHSEEGVQMIRFVSRLAAL
FT                   RRMYPVMSAPRYPSGDRDGAPGMREIGWFDEHGLELSVPAWEDGEGRALTMRRVGTGRT
FT                   GRTEALLVILNASAGTIKFKPPAPVLDYRVLLDTATPDSGPRSWPEAGLEVAAHTAVIA
FT                   VAAVPPDLPS"
FT                   /protein_id="YP_777474.1"
FT   misc_feature    25905..27890
FT                   /note="glycogen debranching enzyme GlgX; Region:
FT                   glgX_debranch; TIGR02100"
FT                   /db_xref="CDD:131155"
FT                   /locus_tag="Bamb_5593"
FT   misc_feature    25920..26234
FT                   /note="Glycogen_debranching_enzyme N-terminal domain.
FT                   Glycogen debranching enzymes have both
FT                   4-alpha-glucanotransferase and amylo-1,6-glucosidase
FT                   activities. As a transferase it transfers a segment of a
FT                   1,4-alpha-D-glucan to a new 4-position in an acceptor...;
FT                   Region: Glycogen_debranching_enzyme_N_term; cd02856"
FT                   /db_xref="CDD:30343"
FT                   /locus_tag="Bamb_5593"
FT   misc_feature    26469..27248
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5593"
FT   gene            27999..29870
FT                   /db_xref="GeneID:4314531"
FT                   /locus_tag="Bamb_5594"
FT   CDS_pept        27999..29870
FT                   /locus_tag="Bamb_5594"
FT                   /gene_family="HOG000155668" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7030 glycoside hydrolase,
FT                   family 13; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase, family 13
FT                   domain protein; alpha amylase, catalytic region; SMART:
FT                   alpha amylase, catalytic sub domain"
FT                   /db_xref="GI:115360338"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="GeneID:4314531"
FT                   /translation="MSSRTAHPSGTHAFASSFGATCVDAQHTRFRLWAPASRTAAVELH
FT                   GDERIAMQAAGDGWFEVVARCGAGTLYRFLLDDGLAVPDPASRFQPSDVHGPSQVVDPA
FT                   AYRWRNDTWRGRPWHETVLYELHVGACGGYASVERRLSDIAALGVTALELMPVNAFPGA
FT                   RNWGYDGVLPFAPAASYGRPEELKALVDAAHGLGLQVFLDVVYNHFGPDGNLLPRYAPE
FT                   FFRADRQTAWGPAIDFSRAQTSAFFIDNALYWLDEFRFDGLRIDAAHAIDDDAWLRELA
FT                   RRVRTHFGDARHVHLVLENERNTASLLGPNGFDAQWNDDFHNSAHVLLTGEHEGYYRAY
FT                   ADAPLRRLARTLGEGFAYQGEPSPLHGGAPRGEPSAHLPPTAFVTFLQNHDQIGNRAFG
FT                   ERLRALANDDAVRAATALMLLAPQIPLLFMGEEDGSTQPFQFFTDYRGELADAVREGRR
FT                   REFAAFSAFADPAHRDAIPDPNDVATFVRSSPAHADDDAWPDADAWRHFYRSALTVRAA
FT                   LVTPHLPGARALGVELLAGHVSPDAEALVARWRLGDGSTLTIAFNPGSHDAVLPALPVG
FT                   KIVFETPPRARDRLADQRLPPRTCIAWRDGAVNHDALKHRANGHTRP"
FT                   /protein_id="YP_777475.1"
FT   misc_feature    28053..28307
FT                   /note="Maltooligosyl trehalose synthase (MTSase) N-terminus
FT                   domain. MTSase and maltooligosyl trehalose trehalohydrolase
FT                   (MTHase) work together to produce trehalose. MTSase is
FT                   responsible for converting the alpha-1,4-glucosidic linkage
FT                   to an alpha,alpha-1,1-...; Region: MTHase_N_term; cd02853"
FT                   /db_xref="CDD:30340"
FT                   /locus_tag="Bamb_5594"
FT   misc_feature    28080..29711
FT                   /note="malto-oligosyltrehalose trehalohydrolase; Region:
FT                   trehalose_TreZ; TIGR02402"
FT                   /db_xref="CDD:162842"
FT                   /locus_tag="Bamb_5594"
FT   misc_feature    28392..>28637
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5594"
FT   misc_feature    29511..29819
FT                   /note="Domain of unknown function (DUF3459); Region:
FT                   DUF3459; pfam11941"
FT                   /db_xref="CDD:152376"
FT                   /locus_tag="Bamb_5594"
FT   gene            29867..32098
FT                   /db_xref="GeneID:4314532"
FT                   /locus_tag="Bamb_5595"
FT   CDS_pept        29867..32098
FT                   /locus_tag="Bamb_5595"
FT                   /gene_family="HOG000245168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: bur:Bcep18194_C7029
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase,
FT                   family 77"
FT                   /db_xref="GI:115360339"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="GeneID:4314532"
FT                   /translation="MTTDVPIAELARAAGLEPDWIDAGGVARRVTDDSLVALVDALGWP
FT                   CGTPIERVDSAAALVDAHDAAPPVVTGDAGVPLTLPRSVAPRGARWRITLESGEHVDGR
FT                   VAGAGEYGRLPPLAQPGYHTLDIGEHRIGLAIAPPRARPFAAGDGLPDAQRRWGISAQL
FT                   YSLRRAGDDGAGDYTALARLAAQAARHGADAVAISPTHAGYPALPEHNSPYSPSSRRWH
FT                   NVAYLDCDAVPGADVVRRTNGAAADVASAPDTPLIDWPQVLPQKLRRLRACFDAWRANG
FT                   EPARDAFEQFRAAGGAALDAHARFDALQAFCIEHGIGADWRHWPAQWRMPATAEVDAFA
FT                   HAHADAIAFHTFLQWCASRALGDAQQAARDAGMAVGLIADLAVGSDRAGSDAWAHGTTL
FT                   LRGVSVGAPPDLFNADGQAWGVTTWTPAALRANGFTPFLDLLRAAFAHAGGIRIDHVLG
FT                   FARMWIVPEGGSARDGAYLRYPLDDLVRLVALEAARHRAVAIGEDLGTVPAGFRERLGA
FT                   QGIAGMRVLWFERDADRAFRPPSAWDRDTIAMTSTHDLPTVAGWWRGIDLEWRRVAAEA
FT                   AAAPTKPHPAGDDVGRAAAAHDTGHDARIDPVLRGDAPAADDGHDAPPPASFDLRAAQD
FT                   ERTTDRAALWRALQHAGCAPAGDPIPSADTPPVGAVLAYVARSPSPLAIVPLEDLLALD
FT                   EQPNLPGPPCGHPNWLRRLPRAVDALLDADARTRITAIEHARRAPEDDA"
FT                   /transl_table="11"
FT                   /protein_id="YP_777476.1"
FT   misc_feature    30308..31579
FT                   /note="4-alpha-glucanotransferase; Region: Glyco_hydro_77;
FT                   cl00711"
FT                   /db_xref="CDD:174357"
FT                   /locus_tag="Bamb_5595"
FT   misc_feature    <31871..31993
FT                   /note="4-alpha-glucanotransferase; Region: Glyco_hydro_77;
FT                   cl00711"
FT                   /db_xref="CDD:174357"
FT                   /locus_tag="Bamb_5595"
FT   gene            32095..34869
FT                   /db_xref="GeneID:4314533"
FT                   /locus_tag="Bamb_5596"
FT   CDS_pept        32095..34869
FT                   /locus_tag="Bamb_5596"
FT                   /gene_family="HOG000248560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7028 maltooligosyl trehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="GI:115360340"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="GeneID:4314533"
FT                   /translation="MTPRATLRLQLHAGFTFDDAAAHADYFARLGVSHLYLSPITTAEP
FT                   GSLHGYDTVDHRAISTELGGEAGFRRLVDALRARGLGVIVDIVPNHMGVGGVSNGWWND
FT                   VLEWGRASPYARYFDIDWHPPDAALDGKVLLPCLGVPYGDALASGDITLGADPSAGRFF
FT                   IACPGRRLPVAIATYAEILRIANRADLNALAERFATASARGGPRVAAAHAALRDYAAAQ
FT                   GPHAFDAILRGADPRRARSRACLHRLLERQHYRLAWWRTAADELNWRRFFDIATLAAVR
FT                   VEDDAVFDAVHALPLGLHAAGYIDGLRVDHVDGLADPRAYCRRLHARLAAQRDERPYVV
FT                   VEKILAPGETLRDDWRVDGTTGYDFMNDVAALLHDPAGAAPLAAHWAAVSGSARSFAQE
FT                   AVAGKRRVLKRQLAGEHARVARALHRIARAAPATRDVSQIAIHRVLGELAVHLPVYRMY
FT                   PTPGDEPTGADGRVLALAYDAACAAVDPSDRYALDRVAGWLGLPGMRVPRADAALLHAA
FT                   RVAFAQLTAPLAAKGVEDTANYRYGRLLSRNEVGADAGDFSLSRGAFHARNRRRARTVP
FT                   HTLVATATHDHKRGEDARMRLAVLSEMPDAWRAVSLDWSALNQPHRGGAHRDLAWAPGP
FT                   AAEAMLYQTLVGCWPPGLAPDDATALAALAERVVRWQTKALREGKQQTDWLAPDADYER
FT                   ACEQFVRAILTPRGAGDFVHRLHAFVARIAPAGVVNSLAQAALRMASPGVPDLYQGTES
FT                   WDHSLVDPDNRRDVPFAALAAERVDEPVAAYLRHWPDARVKRALVERMLALRARWPATF
FT                   ADGAYVPLRVRGRLGRHAVAFARRDESATIVVIVTRLACGWLGEAPELPRVEPREWGDT
FT                   VVVLPRGAGERWIDWLNDGSEVETPDGTMRLARCLAALPVAVLVAVDSKRREL"
FT                   /protein_id="YP_777477.1"
FT   misc_feature    32095..34776
FT                   /note="maltooligosyl trehalose synthase; Provisional;
FT                   Region: PRK14511"
FT                   /db_xref="CDD:172981"
FT                   /locus_tag="Bamb_5596"
FT   misc_feature    32182..>32382
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bamb_5596"
FT   gene            complement(34938..35366)
FT                   /db_xref="GeneID:4314592"
FT                   /locus_tag="Bamb_5597"
FT   CDS_pept        complement(34938..35366)
FT                   /locus_tag="Bamb_5597"
FT                   /gene_family="HOG000236614" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C6566 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:115360341"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4314592"
FT                   /translation="MQFRSAALSDLASIEALLRASNLPTAGVAEHLGNFIVLADLLDVI
FT                   GCGGIEYHEDFALIRSVAVVSHAHGKGFGSAIVERLIATCRARSVRSIGLLTTTAEDYF
FT                   TGFGFVPVARGDVPGPLLASSQFRGVCPQTATAMLLAC"
FT                   /protein_id="YP_777478.1"
FT   misc_feature    complement(34980..35366)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bamb_5597"
FT   gene            complement(35405..36127)
FT                   /db_xref="GeneID:4314593"
FT                   /locus_tag="Bamb_5598"
FT   CDS_pept        complement(35405..36127)
FT                   /locus_tag="Bamb_5598"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bur:Bcep18194_C6565 NADPH-dependent FMN reductase"
FT                   /db_xref="GI:115360342"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:4314593"
FT                   /translation="MTDRLTDLPQLDPALFQVPDASRLRPASPSTHPPRFLLLYGSLRE
FT                   RSFSRLLVEEAERLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELRELVMWSEGMVWC
FT                   SPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAFMEFDEAGRMKPSAYYDRVVDVLEELVKFTLLTRDIGPYLVDRYS
FT                   ERKESAEELSKRVNQRGI"
FT                   /protein_id="YP_777479.1"
FT   misc_feature    complement(35450..36106)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Bamb_5598"
FT   gene            complement(36148..37254)
FT                   /db_xref="GeneID:4314594"
FT                   /locus_tag="Bamb_5599"
FT   CDS_pept        complement(36148..37254)
FT                   /locus_tag="Bamb_5599"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bile acid:sodium symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: arsB; sodium
FT                   bile acid symporter family   protein"
FT                   /db_xref="GI:115360343"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="GeneID:4314594"
FT                   /translation="MPRAFLHPEPRPMNTSNVVPPRNAAVKPAINFFERYLTLWVALCI
FT                   VAGIALGQLLPGLFQRIGRIEYAQVNLPVGLLIWVMIVPMLVKVDFGALHEVRRHVKGI
FT                   GVTLAVNWLVKPFSMAFLGWLFIRQLFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWS
FT                   RLTGGDPLFTLSQVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVIL
FT                   AQLWRKRLLRNGQAAFDAAMARIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVP
FT                   ILIQVFFNAALAYWLNRAVGEKHNVACPSALIGASNFFELAVAAAISLFGFHSGAALAT
FT                   VVGVLIEVPVMLLVVRIVNRSKGWYERV"
FT                   /protein_id="YP_777480.1"
FT   misc_feature    complement(36181..37167)
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Bamb_5599"
FT   gene            complement(37285..37779)
FT                   /db_xref="GeneID:4314595"
FT                   /locus_tag="Bamb_5600"
FT   CDS_pept        complement(37285..37779)
FT                   /locus_tag="Bamb_5600"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bur:Bcep18194_C6562 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="GI:115360344"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:4314595"
FT                   /translation="MTTNVLILCTHNSARSVLAEGMLNHWAAKLGRDVRAYSAGSAPSG
FT                   RLNPFALDALTRAGVDVSGYRSKSWDEFVGDGAPEMRIVITVCDSAAAEACPYWPGSPV
FT                   KVHWGYADPSNATGGDAGKQLAFELTREALGYRMLQLLALPLERMSNAELQAALTAIAQ
FT                   N"
FT                   /protein_id="YP_777481.1"
FT   misc_feature    complement(37351..37773)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bamb_5600"
FT   misc_feature    complement(37351..37773)
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bamb_5600"
FT   misc_feature    complement(order(37732..37740,37744..37749,37753..37755))
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bamb_5600"
FT   gene            complement(37802..38137)
FT                   /db_xref="GeneID:4314596"
FT                   /locus_tag="Bamb_5601"
FT   CDS_pept        complement(37802..38137)
FT                   /locus_tag="Bamb_5601"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   bur:Bcep18194_C6561 transcriptional regulator, ArsR family"
FT                   /db_xref="GI:115360345"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:4314596"
FT                   /translation="METNQTIAALSALAHESRLAVFRALVQAGPSGLAAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLVGYLTENCCGGNPCSPVSACS
FT                   AACPDPT"
FT                   /protein_id="YP_777482.1"
FT   misc_feature    complement(37910..38110)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bamb_5601"
FT   misc_feature    complement(order(37958..37960,38057..38059,38066..38071,
FT                   38078..38083,38090..38092,38099..38101,38105..38110))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bamb_5601"
FT   misc_feature    complement(order(37919..37927,37940..37948,37964..37969,
FT                   37973..37978,37985..37990,37994..38005,38030..38038,
FT                   38084..38092,38102..38107))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bamb_5601"
FT   misc_feature    complement(order(38027..38029,38036..38038))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bamb_5601"
FT   gene            38631..39878
FT                   /db_xref="GeneID:4314597"
FT                   /locus_tag="Bamb_5602"
FT   CDS_pept        38631..39878
FT                   /locus_tag="Bamb_5602"
FT                   /gene_family="HOG000268409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylserine decarboxylase-related"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: bma:BMAA1997 putative phosphatidylserine
FT                   decarboxylase"
FT                   /db_xref="GI:115360346"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="GeneID:4314597"
FT                   /translation="MPTDRSTPATRHRLGGWMASEEAHMAAYREKIAGEARAHAGERLR
FT                   TPAVQELARLFDDNAVLRMSLTRAIDEALESGRKLGYASIGELMTVIDHLMTYTPPFSE
FT                   SSLIVCPLNAFLDWPMCMPSGHAVFRDAAVNAHLKQVLNVWCDFLGGPHSCTHLDTSAP
FT                   DGWFCDEARERLGLSQFQYQEDQPHWGFASWNDFFTRRFRADARPVTAPGDPHVIVSAC
FT                   EAQPYHAESNLKIRDKFWIKGQPYSLRDIFTPARLPLAERFVGGDLYQAYLSAYNYHRW
FT                   HAPVRGTVTHAYRVDGTYYSVAEAEGPDPAGLNDSQGYMTAVAARAVIAIDCDDPGIGT
FT                   VVGVFVGMGDVSSCVIEVMPGQRIDKGEEIGYFQYGGSTYCLLFEPGVIDHFVHAPPFD
FT                   DDTPVVQVNAPVAIAR"
FT                   /protein_id="YP_777483.1"
FT   misc_feature    38769..39155
FT                   /note="Phophatidylserine decarboxylase; Region: PSDC;
FT                   pfam12588"
FT                   /db_xref="CDD:153022"
FT                   /locus_tag="Bamb_5602"
FT   misc_feature    39264..39806
FT                   /note="Phosphatidylserine decarboxylase; Region:
FT                   PS_Dcarbxylase; cl03656"
FT                   /db_xref="CDD:174796"
FT                   /locus_tag="Bamb_5602"
FT   gene            complement(39940..40149)
FT                   /db_xref="GeneID:4314598"
FT                   /locus_tag="Bamb_5603"
FT   CDS_pept        complement(39940..40149)
FT                   /locus_tag="Bamb_5603"
FT                   /gene_family="HOG000264187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7026 hypothetical protein"
FT                   /db_xref="GI:115360347"
FT                   /db_xref="GeneID:4314598"
FT                   /translation="MLTAHEFAALFLVHRAPEQIQSDRDDVVALVEQQLIEIRRDASGA
FT                   SRPALTADGLSIVQCMQRHGGTDA"
FT                   /protein_id="YP_777484.1"
FT   gene            complement(40420..40761)
FT                   /db_xref="GeneID:4314599"
FT                   /locus_tag="Bamb_5604"
FT   CDS_pept        complement(40420..40761)
FT                   /locus_tag="Bamb_5604"
FT                   /gene_family="HOG000186128" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7025 hypothetical protein"
FT                   /db_xref="GI:115360348"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="GeneID:4314599"
FT                   /translation="MPTESVHRARLTDAPPEFDGAVMQMRFVVEFDGKPQICAITVEAL
FT                   EDHFGARSALEADLREAFERGRARIEAACAEVLADGKGGTELHSGYFRVQDKAAGNTAR
FT                   AGMARSRKS"
FT                   /protein_id="YP_777485.1"
FT   misc_feature    complement(40507..40719)
FT                   /note="Protein of unknown function (DUF1488); Region:
FT                   DUF1488; pfam07369"
FT                   /db_xref="CDD:148784"
FT                   /locus_tag="Bamb_5604"
FT   gene            complement(40765..41313)
FT                   /db_xref="GeneID:4314600"
FT                   /locus_tag="Bamb_5605"
FT   CDS_pept        complement(40765..41313)
FT                   /locus_tag="Bamb_5605"
FT                   /gene_family="HOG000063195" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PfpI family intracellular peptidase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: ppu:PP2725 protease PfpI"
FT                   /db_xref="GI:115360349"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="GeneID:4314600"
FT                   /translation="MTGKLDHCKVAILAVDGFEEAELVEPQRALKAEGAQVDVISQKPG
FT                   EIQGFRHVDKGDRVKVDHTFDDARIGDYDAVVLPGGVVNGDAIRMLPAAREFVTAAVGA
FT                   GKPIAAICHGGWLLVSSGLVEGRTMTSWPSLQDDIRNAGGKWVDEEVVRDGNLITSRKP
FT                   DDLPAFNGALVQSLASRGA"
FT                   /protein_id="YP_777486.1"
FT   misc_feature    complement(40789..41289)
FT                   /note="A type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in PfpI from Pyrococcus furiosus; Region:
FT                   GATase1_PfpI_like; cd03134"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bamb_5605"
FT   misc_feature    complement(40975..40980)
FT                   /note="proposed catalytic triad; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bamb_5605"
FT   misc_feature    complement(40978..40980)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bamb_5605"
FT   gene            complement(41555..41920)
FT                   /db_xref="GeneID:4314601"
FT                   /locus_tag="Bamb_5606"
FT   CDS_pept        complement(41555..41920)
FT                   /locus_tag="Bamb_5606"
FT                   /gene_family="HOG000268388" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7024 hypothetical protein"
FT                   /db_xref="GI:115360350"
FT                   /db_xref="GeneID:4314601"
FT                   /translation="MQSNYRTTFDASDLDTDDVDSDELDTAVNLDVETGRITFHAAWAL
FT                   APHAPQGIARHAVVLALDCDTMARYADLDDGARMRVHAMLHDSVQATLESLSDATEDLT
FT                   VTVELTDAMLDAARHLQ"
FT                   /protein_id="YP_777487.1"
FT   misc_feature    complement(41570..41836)
FT                   /note="Protein of unknown function (DUF3022); Region:
FT                   DUF3022; pfam11226"
FT                   /db_xref="CDD:151668"
FT                   /locus_tag="Bamb_5606"
FT   gene            complement(42012..42551)
FT                   /db_xref="GeneID:4314602"
FT                   /locus_tag="Bamb_5607"
FT   CDS_pept        complement(42012..42551)
FT                   /locus_tag="Bamb_5607"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ath:At5g59630 glycine-rich protein"
FT                   /db_xref="GI:115360351"
FT                   /db_xref="GeneID:4314602"
FT                   /translation="MTGDGAASRVPRPLTGTGLAESQGQDRHSTTSDSIDGERSMKPAS
FT                   ESNAAARRIAACAAVALIAAAPAAWAQNSQRPGEGTGAPILSPPDDTSAQGTGSMTNGN
FT                   TAAPPPATRMQEPRGTRSHVRPQVRPKPGGPSGAGTGGSGSTGGGGAAGGSAGGGGAGA
FT                   GGGGAGGTGGAGSSGY"
FT                   /protein_id="YP_777488.1"
FT   gene            42576..42932
FT                   /db_xref="GeneID:4314603"
FT                   /locus_tag="Bamb_5608"
FT   CDS_pept        42576..42932
FT                   /locus_tag="Bamb_5608"
FT                   /gene_family="HOG000268377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:115360352"
FT                   /db_xref="GeneID:4314603"
FT                   /translation="MPSASASHPHGKRATRRPGRTRGHASHPRKRWSADVMQKSDALDI
FT                   EPDIFKSDDPGEIAASLKRSAEHSRRRKATPFQSAMSMLNFYVNRAGRTLPKTRRTTLE
FT                   RAKRKLREAFGRKP"
FT                   /protein_id="YP_777489.1"
FT   misc_feature    42666..42923
FT                   /note="Protein of unknown function (DUF3175); Region:
FT                   DUF3175; pfam11373"
FT                   /db_xref="CDD:151813"
FT                   /locus_tag="Bamb_5608"
FT   gene            42975..44300
FT                   /db_xref="GeneID:4314604"
FT                   /locus_tag="Bamb_5609"
FT   CDS_pept        42975..44300
FT                   /locus_tag="Bamb_5609"
FT                   /gene_family="HOG000220350" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: Na+/H+
FT                   antiporter-like protein"
FT                   /db_xref="GI:115360353"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="GeneID:4314604"
FT                   /translation="MHETLWYLIIGAVLMGMGVATSALRRLPCSTAMIYLVLGVALGPS
FT                   GVGLLHLDIERDARLLREIVEVALLVSLFAIGLRLRVPLSDKLWLVPCRLGLLAMIVTV
FT                   PLLAGCAVLTLGLGWGPALLLAAILAPTDPVLAHDVQVHDPGDRDLVRFALSGEGGMND
FT                   GIALPFALAGLALCGVPDTPHGPPPLSGTFALAVLWGIGGAAAIGGLLGAATTKAIGRL
FT                   RTRYAQALGFEGFFALALIVLSFGAAQFAHTFGFIATFAAGVAMRRVEHRASGDRPPRE
FT                   VIGQVDSEDVSATEKHPEKVHAFMAESVLDFTIELERIAEALVMTMIGSVLGTLSAPLV
FT                   TWGAVALALVLFVAVRPFAVLLTLTGSHATLAQRRLMAWFGIRGIGSFYYLLFALEHGP
FT                   SSTVRPLAAPVLAVVVASVIAHGISATPLMDWYYRLQHRRGP"
FT                   /protein_id="YP_777490.1"
FT   misc_feature    42975..44270
FT                   /note="NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic
FT                   ion transport and metabolism]; Region: NhaP; COG0025"
FT                   /db_xref="CDD:30375"
FT                   /locus_tag="Bamb_5609"
FT   misc_feature    43047..>43298
FT                   /note="Kef-type K+ transport systems, membrane components
FT                   [Inorganic ion transport and metabolism]; Region: KefB;
FT                   cl10482"
FT                   /db_xref="CDD:164194"
FT                   /locus_tag="Bamb_5609"
FT   gene            complement(44306..47104)
FT                   /db_xref="GeneID:4314605"
FT                   /locus_tag="Bamb_5610"
FT   CDS_pept        complement(44306..47104)
FT                   /locus_tag="Bamb_5610"
FT                   /gene_family="HOG000222509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP dependent DNA ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: bps:BPSS2211 ATP-dependent DNA
FT                   ligase"
FT                   /db_xref="GI:115360354"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="GeneID:4314605"
FT                   /translation="MAGKLDPYRRKRHFGATPEPEGAHGHHAKAGAKPAARASARGTHP
FT                   LRFVIQEHHARRLHYDFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEG
FT                   QIPEGHYGAGSVVVWDEGTWTPDGGVAQAREGYRAGKLTFRLDGEKLHGGWALVRSGRQ
FT                   EGRQEQWLLIKERDDDARSMDEFDVVGERPGSVHDGAASARADAKNGSARGSRSGQREK
FT                   SGTSAARHDDHRHDGHAGTPIDPSRIEGAVRAPLPEHVAPQLATLVDGPPTQGDWCYEL
FT                   KFDGYRILARISGKGARRHVKLMTREGRDWTAKLRAQRDALAALDVDAAWLDGEAVVLG
FT                   KNGLPDFQALQNAFGGGHSDEITLFVFDLPYLDGYDLRDAPLTARRALLEPLFADSDPT
FT                   RLRFSPDLGNDVASLIASACDTGLEGLIGKRAESRYRAGRSPAWIKLKCRRRQEFVIGG
FT                   YTEPSGSRHGFGALLLGVHEPAADGKRRRGPGPLRYVGRVGTGFDTRMLDRLTPILRKH
FT                   ERDTMPFDPPPRERSRTPVHWIEPVLVAECEFAEWTGDGIVRQAAFIALREDKPAARIV
FT                   REVPKHTETEVQMEQRQTTRHERHKPKGAARAERDTSDASDGKHPARSRGSRRAEADDT
FT                   GPDQLGRVRISHPERVIDSHSGTRKIDLARYWQWVAPWLLRDLKGRPVSLVRAPGDISG
FT                   ELFFQKHAERREIPFVTQHEGLDPGHGPLLSLDSVDALLGAAQMGTIELHTWNAHASNI
FT                   ERPDRIVFDLDPDPALPWSAMIDAAQLVRGLLDELGLISFCKTSGGKGLHVVVPITRHM
FT                   GWDEVKDFSRAVAQHVAGALPDRFTATMGPKHRRGKIFIDYLRNGRGASTIAAYSVRAR
FT                   PGLGVSVPLRWDEVPDTTGGAQWTIDTLHERLDRLKRDPWDGYDDTRQRITAQMRARLG
FT                   TS"
FT                   /protein_id="YP_777491.1"
FT   misc_feature    complement(44315..47104)
FT                   /note="ATP-dependent DNA ligase; Reviewed; Region: ligD;
FT                   PRK05972"
FT                   /db_xref="CDD:168321"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(46571..47092)
FT                   /note="DNA ligase D, 3'-phosphoesterase domain; Region:
FT                   LigD_PE_dom; TIGR02777"
FT                   /db_xref="CDD:131824"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(45758..46327)
FT                   /note="The Adenylation domain of Mycobacterium tuberculosis
FT                   LigD-like ATP-dependent DNA ligases is a component of the
FT                   catalytic core unit; Region: Adenylation_DNA_ligase_LigD;
FT                   cd07906"
FT                   /db_xref="CDD:153267"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(order(45764..45766,45770..45772,45776..45778,
FT                   45818..45820,45824..45826,45833..45835,46004..46006,
FT                   46046..46054,46061..46066,46100..46102,46172..46174,
FT                   46178..46180,46184..46192,46244..46252,46256..46267))
FT                   /note="active site"
FT                   /db_xref="CDD:153267"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(order(45764..45766,45770..45772,45833..45835,
FT                   46046..46054,46061..46066,46172..46174,46178..46180,
FT                   46184..46192,46244..46252,46259..46261))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153267"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(45380..45757)
FT                   /note="The Oligonucleotide/oligosaccharide binding
FT                   (OB)-fold domain of ATP-dependent DNA ligase LigD is a
FT                   DNA-binding module that is part of the catalytic core unit;
FT                   Region: OBF_DNA_ligase_LigD; cd07971"
FT                   /db_xref="CDD:153440"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(order(45419..45421,45425..45430,45434..45436,
FT                   45593..45610,45614..45619,45695..45697))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153440"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(44450..45127)
FT                   /note="PaeLigD_Pol_like: Polymerase (Pol) domain of
FT                   bacterial LigD proteins similar to Pseudomonas aeruginosa
FT                   (Pae) LigD. The LigD Pol domain belongs to the
FT                   archaeal/eukaryal primase (AEP) superfamily. In
FT                   prokaryotes, LigD along with Ku is required for non-...;
FT                   Region: PaeLigD_Pol_like; cd04862"
FT                   /db_xref="CDD:80312"
FT                   /locus_tag="Bamb_5610"
FT   misc_feature    complement(order(44492..44500,44522..44524,44540..44542,
FT                   44549..44551,44696..44698,44702..44707,44714..44716,
FT                   44813..44815,44819..44821,44873..44875,45011..45013))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:80312"
FT                   /locus_tag="Bamb_5610"
FT   gene            complement(47129..48136)
FT                   /db_xref="GeneID:4314606"
FT                   /locus_tag="Bamb_5611"
FT   CDS_pept        complement(47129..48136)
FT                   /locus_tag="Bamb_5611"
FT                   /gene_family="HOG000237248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ku domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Ku domain protein; KEGG: bps:BPSS2212
FT                   hypothetical protein"
FT                   /db_xref="GI:115360355"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="GeneID:4314606"
FT                   /translation="MAPRMIWKGAISFGLVHVPVQLFPATRTVKPSFRLLDKRSMDPVG
FT                   YRQINKRTGKEVTREDIVRGYEYEKERYVVLTDEEIRAANPESTQTVDILTFVDADAVS
FT                   FLYLDTPYYLVPDRKGEKVYALLREALKDSGKIGIALVVMRDRQHLGALIPVGPLLALD
FT                   TLRWQEELRPLDELSVPTDDAKHAGVTARELTMAKKLIDDMAGKWTPDEYHDTFRDDIL
FT                   ELVERKVRSGKIEEIEDRPAQTGRAATNVVDLTELLKRSLKGGGGARASDLRDERAEEE
FT                   AETSSPAGARRKAAAKSASKGAAVKSPAKRPAAKRAATGAHAAKKTAVRGKHAA"
FT                   /protein_id="YP_777492.1"
FT   misc_feature    complement(47342..48130)
FT                   /note="Ku protein, prokaryotic; Region: Ku_bact; TIGR02772"
FT                   /db_xref="CDD:163009"
FT                   /locus_tag="Bamb_5611"
FT   misc_feature    complement(47339..48127)
FT                   /note="Ku-core domain, Ku-like subfamily; composed of
FT                   prokaryotic homologs of the eukaryotic DNA binding protein
FT                   Ku. The alignment includes the core domain shared by the
FT                   prokaryotic YkoV-like proteins and the eukaryotic Ku70 and
FT                   Ku80. The prokaryotic Ku...; Region: KU_like; cd00789"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bamb_5611"
FT   misc_feature    complement(order(47702..47704,47993..47995,48038..48040,
FT                   48065..48067,48122..48124))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bamb_5611"
FT   misc_feature    complement(order(47351..47353,47360..47362,47453..47455,
FT                   47492..47500,47513..47515,47525..47527,47621..47623,
FT                   47627..47635,47714..47716,47771..47773,47813..47815,
FT                   47843..47848,47852..47854,47909..47911,47918..47923,
FT                   47933..47938,47942..47944,47948..47956,47966..47968,
FT                   47984..47992,47996..48007,48014..48016,48029..48040,
FT                   48053..48067,48086..48088))
FT                   /note="putative homodimer interface; other site"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bamb_5611"
FT   gene            complement(48194..50302)
FT                   /db_xref="GeneID:4314607"
FT                   /locus_tag="Bamb_5612"