(data stored in ACNUC7421 zone)

HOGENOMDNA: BURM1_3

ID   BURM1_3; SV 1; empty ; DNA; empty ; PRO; 2472928 BP.
XX
AC   NC_010086;
XX
PR   Project: 58697;
XX
DE   Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence.
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2472928
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Tiedje,J.
RA   and Richardson,P.;
RT   "Complete sequence of chromosome2 of Burkholderia multivorans ATCC 17616";
RL   Unpublished
XX
RN   [2]
RP   1-2472928
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-DEC-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2472928
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Tiedje,J.
RA   and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (26-OCT-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000869.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002733
CC   Source DNA available from James Tiedje (tiedjej@msu.edu)
CC   Bacteria available from ATCC: ATCC 17616
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2472928
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="2"
FT                   /db_xref="taxon:395019"
FT   gene            40..1053
FT                   /db_xref="GeneID:5770180"
FT                   /locus_tag="Bmul_3158"
FT   CDS_pept        40..1053
FT                   /locus_tag="Bmul_3158"
FT                   /gene_family="HOG000220979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: bam:Bamb_4969
FT                   phage integrase family protein"
FT                   /db_xref="GI:161519707"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:5770180"
FT                   /translation="MSLPTPAAPPARAEEKDLFDRGASDWIVSPEAAFDAWLAMQDYRR
FT                   SSADVYRAQWGAFLTWLRARQKNLATVDTASIAEFVGELPIRKTQRLRYLRLIERVLDH
FT                   IRRTEFASTNPARFIAQDGEADWRKARDNEPTSFLTPAERAKLLAYLFSPIGVSGAAYW
FT                   KERRDRALVAAFLGAGIKTGEARVLTISCVNTSGTSLRIPSTHPDFARDAHLASFAIAL
FT                   FDAWLAERSRQQIPGDLVFPASHTGRPMHKATMLRAIDAIVESAGLTSSRTARTSPQTL
FT                   RNTYAAELFEHDVPPERVGKWLGFVQPISANRLHRAWKTWRAELVEGDAAGSGETH"
FT                   /protein_id="YP_001583134.1"
FT   misc_feature    508..978
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_3158"
FT   misc_feature    order(580..582,655..657,874..876,883..885,952..954)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_3158"
FT   misc_feature    order(580..582,874..876,883..885,952..954)
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_3158"
FT   misc_feature    order(580..582,883..885)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_3158"
FT   misc_feature    order(580..585,655..657,871..876)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_3158"
FT   gene            complement(1194..2375)
FT                   /db_xref="GeneID:5769674"
FT                   /locus_tag="Bmul_3159"
FT   CDS_pept        complement(1194..2375)
FT                   /locus_tag="Bmul_3159"
FT                   /gene_family="HOG000220968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5697 hypothetical protein"
FT                   /db_xref="GI:161519708"
FT                   /db_xref="GeneID:5769674"
FT                   /translation="MTVDEMRQSIREELESMRAAGARRQELSLHACKRLFFDLGIRPSA
FT                   ANVRDLTQTGSASDIPKDIDHFWERIRSASKVRLEGAAIPKSVEEKAGALIGALYEEAL
FT                   KAARDGLDVDRQQVRAEMAAAEQRLRDATVRQETLEAALARSEARNEQLQARVTELEVQ
FT                   LASQTTHGSANEVTLRATVARLETELAAAHGRVNTEQTLNATLRDRIDELQAELQHRTE
FT                   HYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSAAKARA
FT                   DRLEEQLRTQSDELERATRDVNALRANRTMSPEIATLIRRLADAGHLDADAFAAIGTAL
FT                   DHDVPVPSQCPHCDGEPELSHTDDGFEVSCPECEHASGSWPSRLEAVTRFARR"
FT                   /protein_id="YP_001583135.1"
FT   misc_feature    complement(1941..2303)
FT                   /note="Plasmid replication region DNA-binding N-term;
FT                   Region: KfrA_N; pfam11740"
FT                   /db_xref="CDD:152176"
FT                   /locus_tag="Bmul_3159"
FT   misc_feature    complement(<1446..>2075)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bmul_3159"
FT   gene            4198..5562
FT                   /db_xref="GeneID:5768903"
FT                   /locus_tag="Bmul_3160"
FT   CDS_pept        4198..5562
FT                   /locus_tag="Bmul_3160"
FT                   /gene_family="HOG000220945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5695 hypothetical protein"
FT                   /db_xref="GI:161519709"
FT                   /db_xref="GeneID:5768903"
FT                   /translation="MATKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLF
FT                   NVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQ
FT                   KPGRKWGISTLIADAEILEDPATRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRS
FT                   SAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRP
FT                   AIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKL
FT                   GIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAAALFKDALKKGYAPPVDA
FT                   VDALPAAAPSAKGTAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGELEREVARESFEAE
FT                   ALPTLGTHLRDDWRKRGLESKLAETAFFDWLAQKTWGEPTDGDLLAFTLNQSRAA"
FT                   /protein_id="YP_001583136.1"
FT   misc_feature    4297..4950
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:186548"
FT                   /locus_tag="Bmul_3160"
FT   gene            complement(5641..6702)
FT                   /db_xref="GeneID:5768904"
FT                   /locus_tag="Bmul_3161"
FT   CDS_pept        complement(5641..6702)
FT                   /locus_tag="Bmul_3161"
FT                   /gene_family="HOG000220933" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="parB-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bch:Bcen2424_5694 ParB-like
FT                   partition proteins"
FT                   /db_xref="GI:161519710"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:5768904"
FT                   /translation="MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSDAPAPTTA
FT                   KSAKKDSAAPHVPDLAIDLSTDESPQYRAWRLENRYAPGQVIELPLKAIKHSPFNPRHF
FT                   YLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIVI
FT                   DVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELAEHLGLDESTVAV
FT                   ALSIGKLPEAVMQEMVARPDRFGSNMAYQVGRYHAARGTEATLRLINKIVSDDLSTRQV
FT                   SDIVKGRVAAQDAPKPASRQRYAQRLEIKLGGKSVGDLKSYGDDRIELRLRGLPKDKRD
FT                   AILEQLERMLLAD"
FT                   /protein_id="YP_001583137.1"
FT   misc_feature    complement(5755..6453)
FT                   /note="Stage 0 sporulation protein J (antagonist of Soj)
FT                   containing ParB-like nuclease domain [Transcription];
FT                   Region: Spo0J; COG1475"
FT                   /db_xref="CDD:31664"
FT                   /locus_tag="Bmul_3161"
FT   misc_feature    complement(6202..6444)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bmul_3161"
FT   gene            complement(6726..7388)
FT                   /db_xref="GeneID:5768802"
FT                   /locus_tag="Bmul_3162"
FT   CDS_pept        complement(6726..7388)
FT                   /locus_tag="Bmul_3162"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bam:Bamb_4965 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="GI:161519711"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:5768802"
FT                   /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADGQNT
FT                   LVHWSSASGDGDNGIPFPVVNLAEAGGQIHREIKKFINDYDIIVVDCPPSITEKVSGVV
FT                   LLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKR
FT                   ALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGAKLAAAEIRACADEIVAMLP"
FT                   /protein_id="YP_001583138.1"
FT   misc_feature    complement(6741..7376)
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="Bmul_3162"
FT   misc_feature    complement(6945..7376)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bmul_3162"
FT   misc_feature    complement(7335..7355)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bmul_3162"
FT   misc_feature    complement(order(7116..7118,7335..7337))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bmul_3162"
FT   gene            8535..8894
FT                   /db_xref="GeneID:5769127"
FT                   /locus_tag="Bmul_3163"
FT   CDS_pept        8535..8894
FT                   /locus_tag="Bmul_3163"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenate reductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: bur:Bcep18194_B0006 arsenate
FT                   reductase"
FT                   /db_xref="GI:161519712"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:5769127"
FT                   /translation="MMITIYHNPRCSKSRETLALIETLNTTGAPVNVVEYLKTPPTVEE
FT                   LETLHHQLGRPMRDMLRDGEEPYKTLDLGRAELTDAEAYAAIAAHPILLQRPIVVYRGK
FT                   AAIGRPPEAVRALFE"
FT                   /protein_id="YP_001583139.1"
FT   misc_feature    8541..8885
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_3163"
FT   misc_feature    order(8565..8567,8718..8720,8820..8822,8859..8861)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_3163"
FT   gene            8968..9135
FT                   /db_xref="GeneID:5769128"
FT                   /locus_tag="Bmul_3164"
FT   CDS_pept        8968..9135
FT                   /locus_tag="Bmul_3164"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_2001 protein of unknown function
FT                   DUF107"
FT                   /db_xref="GI:161519713"
FT                   /db_xref="GeneID:5769128"
FT                   /translation="MRHARRQWRSGSVGFVAGGLLQLAGFVRYVQFGAVAAIALVTITA
FT                   LRCSGLERKR"
FT                   /protein_id="YP_001583140.1"
FT   gene            complement(9304..9771)
FT                   /db_xref="GeneID:5769090"
FT                   /locus_tag="Bmul_3165"
FT   CDS_pept        complement(9304..9771)
FT                   /locus_tag="Bmul_3165"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_5405 hypothetical protein"
FT                   /db_xref="GI:161519714"
FT                   /db_xref="GeneID:5769090"
FT                   /translation="MSEESNRLIPGRRQRSVYRQASPRAARPGHPADFPQGFPQKLWIT
FT                   LGGASGEWGSVRRGKLCATQGLGKHSAARRFGAGKRDGRGWVGGVGGVGGVGGVGGVGG
FT                   VGGVGGVGGVGGVGGVGGWRRCRCSRSDATGRRAKKHAEVAVPRKSSGGAR"
FT                   /protein_id="YP_001583141.1"
FT   gene            9787..10338
FT                   /db_xref="GeneID:5769091"
FT                   /locus_tag="Bmul_3166"
FT   CDS_pept        9787..10338
FT                   /locus_tag="Bmul_3166"
FT                   /gene_family="HOG000263119" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bur:Bcep18194_B0009 NADPH-dependent FMN reductase"
FT                   /db_xref="GI:161519715"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:5769091"
FT                   /translation="MAYRVAVVVGSLRRGSWNRALAHAVISLAPSDLSFEFVEIGELPL
FT                   YSQDYDADFPEVAKRFKQSIEAADALLFVTPEYNRSIPGVLKNALDWGSRPWGSNSWAG
FT                   KPGAVLGTSPGATGTALAQQHLRNVLSYLDVKLLGQPEMFIKHDPTRIDDEGKIVNEDT
FT                   RKFLQGFVDRYADWVRLLKK"
FT                   /protein_id="YP_001583142.1"
FT   misc_feature    9796..10236
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="Bmul_3166"
FT   gene            complement(10396..12672)
FT                   /db_xref="GeneID:5769080"
FT                   /locus_tag="Bmul_3167"
FT   CDS_pept        complement(10396..12672)
FT                   /locus_tag="Bmul_3167"
FT                   /gene_family="HOG000220897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bur:Bcep18194_B0010 periplasmic sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="GI:161519716"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:5769080"
FT                   /translation="MMAGTSATPSYRMTSDRPAESRTPVTAPADDWQDDGNYASGAPEH
FT                   DFAVRRITLIVLLVAAIVLPCIYVVVMAYNDLKAREAAASDVTMRTVRVAEEHALKVFD
FT                   LTETLDARIVDLVQDMKDATVRNQEADIHDALNTIGGGYPQVAAVSIFGASGMLLANSL
FT                   YYPAPYASIENREDFIGIRDGRVIEHISKLMMGPLKLENIPVFNTGIARRNSDGSFAGM
FT                   VSIALKSSYFNAFYRDLLGGAKTPMTMALARSDGAVLASYPQLPSAVHTDREATFGNAH
FT                   NNPRAGVVRVHHGGSDSEIVAYRQVGSYPVYVVCTYRASAIWREWYEHLSVLFLSMFAP
FT                   SVALWCVIWLSLKRLKAEERAWERWQAEASMRRSIESAYRQSRKMQALGNLVGSVAHDF
FT                   NNLLMIISSNVQIMRRRNAEHLDKELGAIERALKNGQSLTRQLLGVARKQPLHSETIDV
FT                   GQWLGSCRELLKTSLGSKSSLVVAIDPGVWPIRVDVAELELAVINLAVNARDAMPTGGR
FT                   FTVGARNVTLRREDGFPLTGDFAQLSFDDTGSGMAPDVLSRAFEPLFTTKAHGMGTGLG
FT                   LPQVFAFCERSGGLATIDSAVGAGTSVRLYLPRARAEDITTRPPAAAHVAPHTGLHVLL
FT                   VEDNSEVAAGTEALLSLLGHRVTYAATGDDALRLIESATDDNAFDLVISDIHMPGRLNG
FT                   IDLAEAIDKRPEKLPVILVTGYAEELDRTRSVNVRVLSKPFDIALLDAILLEIRDGRDE
FT                   QHPRP"
FT                   /protein_id="YP_001583143.1"
FT   misc_feature    complement(11332..11520)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(order(11347..11349,11359..11361,11368..11370,
FT                   11380..11382,11389..11391,11401..11403,11446..11448,
FT                   11455..11457,11467..11469,11476..11478,11488..11490,
FT                   11500..11502))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(11482..11484)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(10852..11184)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(order(10864..10866,10870..10875,10888..10890,
FT                   10894..10896,10942..10953,11020..11025,11029..11031,
FT                   11035..11037,11041..11043,11143..11145,11152..11154,
FT                   11164..11166))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(11152..11154)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(order(10945..10947,10951..10953,11023..11025,
FT                   11029..11031))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(10468..10773)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(order(10471..10476,10531..10533,10591..10593,
FT                   10618..10620,10759..10764))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(10618..10620)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(order(10591..10599,10606..10611))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3167"
FT   misc_feature    complement(10468..10476)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3167"
FT   gene            13104..13472
FT                   /db_xref="GeneID:5769484"
FT                   /locus_tag="Bmul_3168"
FT   CDS_pept        13104..13472
FT                   /locus_tag="Bmul_3168"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bam:Bamb_4958 response regulator receiver protein"
FT                   /db_xref="GI:161519717"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:5769484"
FT                   /translation="MSLPIVIADDSLLARKLLAKALPGDWDVDVAYAANGREALALYRD
FT                   GKASVMFLDLTMPDMNGYQVLETLRHEDMNTFVIVVSADIQPQAQARVRELGAIAFVAK
FT                   PVTSEALLPILKEYGLYA"
FT                   /protein_id="YP_001583144.1"
FT   misc_feature    13173..13457
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3168"
FT   misc_feature    order(13263..13265,13287..13289,13347..13349,13404..13406,
FT                   13413..13418)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3168"
FT   misc_feature    13263..13265
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3168"
FT   misc_feature    order(13272..13277,13281..13289)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3168"
FT   misc_feature    13413..13421
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3168"
FT   gene            13477..14091
FT                   /db_xref="GeneID:5769485"
FT                   /locus_tag="Bmul_3169"
FT   CDS_pept        13477..14091
FT                   /locus_tag="Bmul_3169"
FT                   /gene_family="HOG000220874" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /transl_table="11"
FT                   /note="PFAM: CheC domain protein; KEGG: bam:Bamb_4957 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="GI:161519718"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="GeneID:5769485"
FT                   /translation="MFTAEQRDALQEIANLAMGRAAARLAVLLGRFIELSVPRVRVVRA
FT                   AEAGRALREMTGIDDNVTAVRQGFRSDIKGEAIVLCRSAGVGRLMSLVERTFGGGAHGG
FT                   MATQDELVFDVANVLMGACVASILDELGRKPVFFPPGLLGTNVSFEDVFQPTVLAWSVA
FT                   LLLEVNFGLEDHAFRAHFVMLMAEDSIRLMGDALDALLSAL"
FT                   /protein_id="YP_001583145.1"
FT   gene            14088..15026
FT                   /db_xref="GeneID:5769497"
FT                   /locus_tag="Bmul_3170"
FT   CDS_pept        14088..15026
FT                   /locus_tag="Bmul_3170"
FT                   /gene_family="HOG000220872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0014 diguanylate cyclase (GGDEF
FT                   domain); TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: PAS domain containing protein"
FT                   /db_xref="GI:161519719"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="GeneID:5769497"
FT                   /translation="MTAERASLSDLVIERVGFGLFVLDRRMTVLMWNRFMQDHSGVPAA
FT                   DVIGRNLFDCFPDLPRAWLTRKLESVFQLGSFAFSSWEQRPYLFRFEHDRPITGGVDYM
FT                   QQDCTFMPLTRGRDVEAVCVTISDVTHVSVMQREREEAVAKLREHANRDGLTGIANRRY
FT                   FETRLGEEFARWQRYGGDLSMLLFDLDHFKAINDRFGHAVGDAVLRETARRVAAIVRAQ
FT                   DTFGRFGGEEFALLLPCTNLEEALQVADKVRDAIGRTPVDAEGVSVAVTASVGAACAKL
FT                   GQPACDALVNDADAALYRAKRLGRDRSVGYA"
FT                   /protein_id="YP_001583146.1"
FT   misc_feature    14115..14474
FT                   /note="PAS fold; Region: PAS; pfam00989"
FT                   /db_xref="CDD:144544"
FT                   /locus_tag="Bmul_3170"
FT   misc_feature    14142..14306
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Bmul_3170"
FT   misc_feature    14538..15014
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3170"
FT   misc_feature    order(14649..14651,14778..14780)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3170"
FT   misc_feature    order(14664..14666,14673..14678,14688..14690,14700..14702,
FT                   14766..14768,14772..14783)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3170"
FT   misc_feature    order(14754..14756,14838..14840)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3170"
FT   gene            complement(15060..15944)
FT                   /db_xref="GeneID:5769467"
FT                   /locus_tag="Bmul_3171"
FT   CDS_pept        complement(15060..15944)
FT                   /locus_tag="Bmul_3171"
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5683 alpha/beta hydrolase fold"
FT                   /db_xref="GI:161519720"
FT                   /db_xref="InterPro:IPR008262"
FT                   /db_xref="GeneID:5769467"
FT                   /translation="METNVTAPSQSDHPVFVLVHGAWHGAWCFAHVAAALAARGHLSIA
FT                   RDLPAHGLHARFPVSYHVRPLDKDAFGAEPSPVANTTLDDYATQVMQAVDDAYALGRGK
FT                   VILVGHSMGGLAITAAAERAPDKIAKLVYLAAFMPAAGVPGLDYVRAPENRGELLGPLM
FT                   LASPRVAGALRIDPRSGDADYRAATRRALCDDVPQADFDAVANLMSCDVPAAPFATAIP
FT                   TTAARWGAIDRHYIKCLQDRVLLPALQQRFIDEADAFAPGNPTHVHQLDSSHSPFMSQP
FT                   AVLAGVLADIAKH"
FT                   /protein_id="YP_001583147.1"
FT   misc_feature    complement(15069..15944)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="Bmul_3171"
FT   gene            16157..16489
FT                   /db_xref="GeneID:5769468"
FT                   /locus_tag="Bmul_3172"
FT   CDS_pept        16157..16489
FT                   /locus_tag="Bmul_3172"
FT                   /gene_family="HOG000220851" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5682 hypothetical protein"
FT                   /db_xref="GI:161519721"
FT                   /db_xref="GeneID:5769468"
FT                   /translation="MNVDYLFYRKPDKPGPYSLDDLGDVAPPIGASDAVRAGIARVFEE
FT                   IDWAESPDVPGAWFGTGGAVFQFTAEPDGRVTSFMGSRLERRAMLQLTREMGLIALDLQ
FT                   RDIVYG"
FT                   /protein_id="YP_001583148.1"
FT   gene            16779..17627
FT                   /db_xref="GeneID:5769437"
FT                   /locus_tag="Bmul_3173"
FT   CDS_pept        16779..17627
FT                   /locus_tag="Bmul_3173"
FT                   /gene_family="HOG000220850" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="squalene synthase HpnD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: squalene synthase HpnD; PFAM:
FT                   Squalene/phytoene synthase; KEGG: bam:Bamb_4953
FT                   squalene/phytoene synthase"
FT                   /db_xref="GI:161519722"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="GeneID:5769437"
FT                   /translation="MAVSNLVVDEQETDAAAVTSGSSFYLAMRILPAVQRDAMFQVYAF
FT                   CRAVDDIADSDLPRAERAAGLERWRADIDACFAGHPPRHLVALEREIRAFDLQRDDFHA
FT                   MIDGMAMDAAEDICAPDEPTLDLYCDRVASAAGRLSVRIFGMPEAEGIKLSHHLGRALQ
FT                   LTNILRDIDDDAAINRCYLPRELLQREGIAISDPATIARDPALPRVCATLVERALEHFR
FT                   QADAVMDTCARAQVKAPRIMSGAYRCILEAAVARGFAAPRAPLRKPKARMLMIAARYAL
FT                   F"
FT                   /protein_id="YP_001583149.1"
FT   misc_feature    16836..17531
FT                   /note="Trans-Isoprenyl Diphosphate Synthases, head-to-head;
FT                   Region: Trans_IPPS_HH; cd00683"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    16836..16850
FT                   /note="active site lid residues"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    order(16842..16844,16848..16850,16905..16907,16917..16919,
FT                   16926..16928,16938..16940,17160..17162,17175..17177,
FT                   17187..17189,17253..17255,17262..17264,17283..17288,
FT                   17295..17300,17313..17315,17487..17492)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    order(16848..16850,16905..16907,16926..16928,16938..16940,
FT                   17160..17162,17184..17186,17196..17198,17262..17264,
FT                   17283..17288,17298..17300,17313..17315,17487..17492,
FT                   17502..17504)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    order(16926..16940,17286..17300)
FT                   /note="substrate-Mg2+ binding site; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    16926..16940
FT                   /note="aspartate-rich region 1; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   misc_feature    17286..17300
FT                   /note="aspartate-rich region 2; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="Bmul_3173"
FT   gene            17632..18885
FT                   /db_xref="GeneID:5769438"
FT                   /locus_tag="Bmul_3174"
FT   CDS_pept        17632..18885
FT                   /locus_tag="Bmul_3174"
FT                   /gene_family="HOG000220835" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="squalene-associated FAD-dependent desaturase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: squalene-associated FAD-dependent
FT                   desaturase; PFAM: amine oxidase; FAD dependent
FT                   oxidoreductase; KEGG: bur:Bcep18194_B0018 amine oxidase"
FT                   /db_xref="GI:161519723"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:5769438"
FT                   /translation="MPRTVHVIGAGLAGLSAAVELQRRGRRIVLHDAHAHAGGRCRSWF
FT                   DSTLGTTVDSGLHRVFAGQAATQRYLRTIGAADQLTGPPSSEFPVVDLASQQRWTLRFG
FT                   NRRWPSWLFDATARAPGTTPLDYASLASLAFARTGRSLAQTMRCDGVLWERWLRPHFLR
FT                   VLNVEPRHATAELARAALCGTLAAGGPGCRPLVARHGLGSAFVEPALRMLQHGGAQIRL
FT                   RSRLDALEFGARGNAVDALAAGGQRIDLAPGDAVVLAVPPDVAQPLVPDLAAPDAFGAV
FT                   ATAYFAAEPPPGAPLDTTVINGVADAVRTGEGQLAATVHDAGRWLDLPREALARRLWED
FT                   VARVTGANAAVVPPWQLVVEPRAGFAAVPSQEMKRPAVRTRWTNLVLAGDWIATGLPAT
FT                   IEGAIRSGQQAADALQTQ"
FT                   /protein_id="YP_001583150.1"
FT   misc_feature    17632..>17721
FT                   /note="anaerobic glycerol-3-phosphate dehydrogenase subunit
FT                   B; Validated; Region: PRK05329"
FT                   /db_xref="CDD:180019"
FT                   /locus_tag="Bmul_3174"
FT   misc_feature    17677..18873
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bmul_3174"
FT   gene            18897..20870
FT                   /db_xref="GeneID:5769427"
FT                   /locus_tag="Bmul_3175"
FT   CDS_pept        18897..20870
FT                   /locus_tag="Bmul_3175"
FT                   /gene_family="HOG000220823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="squalene-hopene cyclase"
FT                   /EC_number="5.4.99.17"
FT                   /note="KEGG: bur:Bcep18194_B0019 terpene synthase/squalene
FT                   cyclase; TIGRFAM: squalene/oxidosqualene cyclase;
FT                   squalene-hopene cyclase; PFAM: Prenyltransferase/squalene
FT                   oxidase"
FT                   /db_xref="GI:161519724"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR002365"
FT                   /db_xref="InterPro:IPR006400"
FT                   /db_xref="GeneID:5769427"
FT                   /translation="MNDLTDMATLSAGTVPAELDAAVARATDALLAAQNADGHWVYELE
FT                   ADSTIPAEYVLLVHYLGETPNLELEQKIGRYLRRIQQADGGWPLFTDGAPNISASVKAY
FT                   FALKVIGDDENAEHMQRARRAIHAMGGAEMSNVFTRIQLALYGAIPWRAVPMMPVEIML
FT                   LPQWFPFHLSKVSYWARTVIVPLLVLNAKRPLAKNPRGVRIDELFIDPPVNAGLLPRQG
FT                   HQSAGWFAFFRAVDHVLRAVDGLFPAYTRERAIRQAVAFVDERLNGEDGLGAIYPAMAN
FT                   AVMMYDVLGYAEDHPNRAIARKSIEKLLVVHEDEAYCQPCLSPVWDTSLAAHALLETRD
FT                   PRAEQAAVRGLDWLRPLQILDVRGDWISRRPHVRPGGWAFQYANPHYPDVDDTAVVAMA
FT                   MDRAQKLNQSDTYRESIARAREWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLD
FT                   PPTADVSGRCLSMLSQLGETALNSDAARRALDYMLKEQEPDGSWYGRWGMNYVYGTWTA
FT                   LCALNAAGLGPDDARVKRAAQWLLSIQNKDGGWGEDGDSYKLNYRGYEPAPSTASQTAW
FT                   ALLGLMAAGEVNNPAVKRGIDYLIAEQKEHGLWDEARFTATGFPRVFYLRYHGYRKFFP
FT                   LWALARYRNLKRDNTTRVTVGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583151.1"
FT   misc_feature    19008..20834
FT                   /note="squalene-hopene cyclase; Region: hopene_cyclase;
FT                   TIGR01507"
FT                   /db_xref="CDD:162394"
FT                   /locus_tag="Bmul_3175"
FT   misc_feature    19008..20822
FT                   /note="Squalene cyclase (SQCY) domain subgroup 1; found in
FT                   class II terpene cyclases that have an alpha 6 - alpha 6
FT                   barrel fold. Squalene cyclase (SQCY)  and 2,3-oxidosqualene
FT                   cyclase (OSQCY) are integral membrane proteins that
FT                   catalyze a cationic cyclization...; Region: SQCY_1;
FT                   cd02892"
FT                   /db_xref="CDD:29791"
FT                   /locus_tag="Bmul_3175"
FT   misc_feature    order(19026..19028,19041..19046,19053..19055,19200..19202,
FT                   19302..19304,19308..19310,19320..19322,19428..19433,
FT                   19440..19442,19722..19727,19737..19739,19854..19859,
FT                   19872..19874,20034..20036,20061..20063,20067..20072,
FT                   20202..20204,20244..20249,20253..20255,20262..20264,
FT                   20295..20297,20412..20414,20430..20432,20751..20753,
FT                   20763..20765,20769..20771,20775..20777,20784..20786)
FT                   /note="Active site cavity; active site"
FT                   /db_xref="CDD:29791"
FT                   /locus_tag="Bmul_3175"
FT   misc_feature    20067..20069
FT                   /note="catalytic acid; other site"
FT                   /db_xref="CDD:29791"
FT                   /locus_tag="Bmul_3175"
FT   gene            20876..21580
FT                   /db_xref="GeneID:5769444"
FT                   /locus_tag="Bmul_3176"
FT   CDS_pept        20876..21580
FT                   /locus_tag="Bmul_3176"
FT                   /gene_family="HOG000220812" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0020 hypothetical protein"
FT                   /db_xref="GI:161519725"
FT                   /db_xref="GeneID:5769444"
FT                   /translation="MASQQSGGLPVIAVTGMAFEARIARGDGVEAVFAARADRLERALT
FT                   EATARGCAGIVSFGTAGGLAPDLKPGALVVADAVDGPFGRVQTDADWSARLVVALHDTP
FT                   VWTRVSRGAIAAVTAPVVTEQEKASLHRAKGALAVDMESHIAAAFAAARGVPFAVCRAI
FT                   VDPAWRTLPRAATAGLRDDGSTAILPILRELLKQPSQLGPLLQVASDARAARTTLIQAR
FT                   HAFGREGALRIV"
FT                   /protein_id="YP_001583152.1"
FT   misc_feature    20876..21577
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:185889"
FT                   /locus_tag="Bmul_3176"
FT   gene            21845..23809
FT                   /db_xref="GeneID:5769445"
FT                   /locus_tag="Bmul_3177"
FT   CDS_pept        21845..23809
FT                   /locus_tag="Bmul_3177"
FT                   /gene_family="HOG000255467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type VI secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   bur:Bcep18194_B1828 protein of unknown function DUF879"
FT                   /db_xref="GI:161519726"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="GeneID:5769445"
FT                   /translation="MRWSLRLAFDTLPTAMPSNAWRGTRIARAMNPHLLDAYNRELLYF
FT                   KELVEEFAQAHPKIARRLGLHAGEIADPFVERLVQAASFTTARLQLKLDAAFPLLSSRL
FT                   LETVYPNYVAPTPSIAVARLYPDEQEGNLLEGFRVPRGTTFTSRVPDGERTPCTFRSGL
FT                   DVTLYPLEIVSARLTGVPPDIPSVERYGAADRPIRGALRLRLRTTGEARFDELRGLDRL
FT                   PVYLAGDERVASRLFELIHAGAVASVIGMPNRFADSNRSFGVVRDRAVEHTGLAADEGL
FT                   LPLVGTKFHGQNLLHEYATCPARFWFFTLTGLNAGLRYVTDREAEIVVLLDRFDGSLVE
FT                   HVDASRFALFCTPVINLFRRTSDPAEMPGTGAEVLVQPDRQNGSDYEVFAVEALHGFVS
FT                   KGAASLEFRPLYRPLLNNEADHGRYFTIRREHGTAKTSYRRYGARTPYVSTDVFVSLVD
FT                   ENERSYPQAMKYLSVDAWLTNGDLPSLLEPEGATDLTVEISAPVRRTELVRAPSAARAP
FT                   LAQGDAAWRLIGQLNLDYGRLETQDGSALRDILILFAAADDVRLRRQIDSLIRVETRPV
FT                   TKKLPGQGPLRFGRGIECVLTVDEAGFDGASPFLFGVILEHYVARHVSTHSFTQSVLRS
FT                   PQRGELMRWPVRMGTRSAA"
FT                   /protein_id="YP_001583153.1"
FT   misc_feature    21944..23797
FT                   /note="Bacterial protein of unknown function (DUF879);
FT                   Region: DUF879; cl09183"
FT                   /db_xref="CDD:164134"
FT                   /locus_tag="Bmul_3177"
FT   gene            23880..29825
FT                   /db_xref="GeneID:5768748"
FT                   /locus_tag="Bmul_3178"
FT   CDS_pept        23880..29825
FT                   /locus_tag="Bmul_3178"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: YD repeat protein; type VI secretion system
FT                   Vgr family protein; PFAM: RHS protein; YD repeat-containing
FT                   protein; Rhs element Vgr protein; KEGG: bur:Bcep18194_B1826
FT                   rhs family protein"
FT                   /db_xref="GI:161519727"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="GeneID:5768748"
FT                   /translation="MVNFKTNRTFSVSGPALPDLEGIGAMLHLSAMRGTEQLSTPYTYE
FT                   LWLTTPADPRLPAEMLANLDLKAMLGKELTVTIQLDGMGSFVAGMAGQAGAGNLGAGTR
FT                   EISGIVTAASYVDQLNRQCRYRVVLEPWLALARERTDYRIFQRKSVLDILREVFGSYWY
FT                   SFEMRVGRTYRTLRYQVQYGESDFAFAQRLMEEHGIAWFFEHSQGVHRLVLVDGPGAYR
FT                   SVESVAYQTLEYYPPGRKIDREHVDRFEATERLQSGVWTTDDFDFEKPGATLTAQNSLP
FT                   RETAHNQLERYEWPGDYTETEDGHAFAQVRMEEIHAQGARAQGEGNLRNVVCGTTFVLA
FT                   GHPMASANREYLVIASELDVKETGETTGFSAYAIRSRFTVQPSDVVFRPPRTIRKPRTR
FT                   GPQTAIVTGPPDAEIWTNKNGEVTLKFHWDRSDVKDQNSSCWVRVSYPWAGSNFGGIHV
FT                   PRVGTEVIVDFENGDPDRPIVTGRVYNAMTMPPWRLPAHATQSGILTRSTKGGGYGNAN
FT                   AIRFEDKKGAEQVWIQAERNLDAVIEADETHTVGHDRTKRIGHDETDQIGRHWTLSTGG
FT                   YKFETVTLASVKSVGMGAMFNVGMAYNVNVGGLYLRNVGLQMASTVGRSRTDRVVQDWT
FT                   ADVGHTYTLTVRGKAVGDAVAADRANPIEPSPDFAPQLPAPVSSSNANQLRIADTGESS
FT                   LSGAKQTQLIGPGGTVTIDESGIHLKGTAIYLQAPTISMTNGNAGGLAPVTEADCAECA
FT                   KKSVSANPVDLATGQKVLSHTDFTLPGRVSIDWSRSYRSADQRRGSLGVAWKLPYATEV
FT                   RTSATGLIYFDADGRQLQFPALNPGEAHFHPIEKFTLMRGDDNASGATYALRFGNGVEE
FT                   HYGRHPVDETRWQLQRIATRDGQCLTLGYTAQGWLETVRNNVHTVRCALDDAGRITSVL
FT                   LDQGVGNQPLHLTSYVYDEHGDLVEATDRENLTWRYGYDNHLLTTYRTPAGATHVSEWS
FT                   DDTPNAYCLRTYAYTEGADGQRVVTREMRFDYLPSLRATRVTDGLGHTTEYHYNGLWAV
FT                   EKIVHPDGSVEQTHFDETGSVAGYTDALGRTTRIVNDARGNPTSIIDPAGNVTRISYGE
FT                   HNLPEQITDPAGQIWQRGYDAHGHLTSETDPLGNVTRYAYENGLPVARTDALGNVTKMQ
FT                   WDDAGQLVARTDCSGHTTTYDYDPFGQLTETTDALGQVSHHSGSVSARVTAVQPAGMGW
FT                   WKVEYDEAGRAIAHTDPLERVTRVDWDGYGQRTQIVDPAGGTQQFRYDAIGRLTKLTNA
FT                   NQETTTFRYDSRNRLIEQTGFDGRRQSYRYNAAGELVERIDHGQDGQIATHVTYDVLGR
FT                   PVERRSSDGSQASYRYDERGLLTQAQAIVPGRAPVHVTYEYDAAGRRTAEVQAHHGRVW
FT                   RLTHGVDAIGNRDWTHVPDIGSLVWQRYGSGHVHGILLDEHPLASFERDALHREIRRTQ
FT                   GPASHHFGYGANGLLAVHRWQNLDERGRSLEHPRPWRAWAYDDAGQLTTLDDAWRDQKA
FT                   YRYDALSRLTQVMAASGPEAFHYDPAGNLLAAAPSRDNMQAWKASGDRLLRFAPQTRPD
FT                   RPVDFTYDGHGNRIARTVPLPPKPALTEAEKRSQRGTDNLLRVMEVLTGTPKYEEPSEV
FT                   PEVTRYRYDGSHQLIAIEHADGARSEYEYDALGRRVAKHHTPAGGAQQTTLFMWDGDWM
FT                   MQEVRTGRTSHEDRAVTYVPHPDHEGPLTRLADGQAWHYVTDHLGTPQELYDEQREVLW
FT                   AADLSAYGRTARWLTRVVDNPIRFPGQYRDEESGLHYNRFRYYDPMVGRYINQDPIAFD
FT                   GGINFYSYADSAPNIAYDPKGLFVPLIAVASFLGRGALGGAVEIAMQGAKQVFRQAKNN
FT                   WVDGRPLTDIDWDCVKIDWTDVGVSVAVGGVAPSLGATRKSVTRSIKAIRNLSNQSANT
FT                   ANRAAKLKVRVDIKKDSIKRDLIVQGAWQGIKQGAKCAFGEEKKCEEE"
FT                   /protein_id="YP_001583154.1"
FT   misc_feature    23907..25544
FT                   /note="type VI secretion system Vgr family protein; Region:
FT                   VI_Rhs_Vgr; TIGR03361"
FT                   /db_xref="CDD:163233"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    <25182..25355
FT                   /note="Phage-related baseplate assembly protein; Region:
FT                   Phage_base_V; cl11432"
FT                   /db_xref="CDD:164221"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    26094..>27869
FT                   /note="Rhs family protein [Cell envelope biogenesis, outer
FT                   membrane]; Region: RhsA; COG3209"
FT                   /db_xref="CDD:33022"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27162..27317
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27255..27365
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27378..27491
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27387..29552
FT                   /note="Rhs family protein [Cell envelope biogenesis, outer
FT                   membrane]; Region: RhsA; COG3209"
FT                   /db_xref="CDD:33022"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27567..27680
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27630..27743
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    27693..27806
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    28815..28943
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    29082..29183
FT                   /note="RHS protein; Region: RHS; pfam03527"
FT                   /db_xref="CDD:112350"
FT                   /locus_tag="Bmul_3178"
FT   misc_feature    29160..29390
FT                   /note="RHS repeat-associated core domain; Region:
FT                   Rhs_assc_core; TIGR03696"
FT                   /db_xref="CDD:163408"
FT                   /locus_tag="Bmul_3178"
FT   gene            32441..32737
FT                   /db_xref="GeneID:5768477"
FT                   /locus_tag="Bmul_3179"
FT   CDS_pept        32441..32737
FT                   /locus_tag="Bmul_3179"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161519728"
FT                   /db_xref="GeneID:5768477"
FT                   /translation="MGFMLPRAFAFFLPVFMKISIIDYERADVIPDAVVYRLCDMAKDR
FT                   ADDNLSAVLSSYTHEQLEMVLNFLLEMSRTEWRHHNPDLAFEAATLLREKFLI"
FT                   /protein_id="YP_001583155.1"
FT   gene            34280..34534
FT                   /db_xref="GeneID:5768478"
FT                   /locus_tag="Bmul_3180"
FT   CDS_pept        34280..34534
FT                   /locus_tag="Bmul_3180"
FT                   /gene_family="HOG000149303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: csa:Csal_2255 hypothetical protein"
FT                   /db_xref="GI:161519729"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="GeneID:5768478"
FT                   /translation="MPARVATLGTLTTHGGAVTSASAGVAINGRPAACVGDAVSCPLHG
FT                   AGVITNGGVGTINGRQIAHHGSGTSCGATLVVSDDGPTV"
FT                   /protein_id="YP_001583156.1"
FT   sig_peptide     34280..34351
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.779 at
FT                   residue 24"
FT                   /locus_tag="Bmul_3180"
FT                   /product="hypothetical protein"
FT   gene            34545..35486
FT                   /db_xref="GeneID:5769642"
FT                   /locus_tag="Bmul_3181"
FT   CDS_pept        34545..35486
FT                   /locus_tag="Bmul_3181"
FT                   /gene_family="HOG000023943" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1824 hypothetical protein"
FT                   /db_xref="GI:161519730"
FT                   /db_xref="GeneID:5769642"
FT                   /translation="MKGISSATQSDSAPKIVSAKRTSAPPRQPNGTFLSNRDPRQQPGP
FT                   RRNRPFGPLAPPEDEPTRLAAVLGHRNALLEAGRVLLRALVDMSALIDTGHDARLRDLL
FT                   LEEVRVFERLCVRANIRVDHRIGARYCLCTALDEAAMRELAARGDASGSAAWASDALTQ
FT                   RIGEDNQGGSKVYALTLRLLDDAADHWPLLELIYRIFSLGFEGRYPHGRTFSAHDRVRE
FT                   RIYNAIAAHLPTVPNALSPHAATIESARPRACFEMPVWLSAAVLSAALCALYVYCRIES
FT                   GAQADDVQRQLSNIARTAPYSAIDPPQGDPAR"
FT                   /protein_id="YP_001583157.1"
FT   misc_feature    34758..35324
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2077); Region: DUF2077; cl01370"
FT                   /db_xref="CDD:154358"
FT                   /locus_tag="Bmul_3181"
FT   gene            35515..39468
FT                   /db_xref="GeneID:5769643"
FT                   /locus_tag="Bmul_3182"
FT   CDS_pept        35515..39468
FT                   /locus_tag="Bmul_3182"
FT                   /gene_family="HOG000143195" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type VI secretion protein IcmF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   bur:Bcep18194_B1823 hypothetical protein"
FT                   /db_xref="GI:161519731"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="GeneID:5769643"
FT                   /translation="MKKILSFPSWRHLWAVVMVIAAVVVIWFAGPLLTFGGLSPLASIG
FT                   IRLTLIALVLAAWALWLIDWTMSIVIVVLLCLAIWHAFPLVTLSGKPLFASVTARILAM
FT                   IGVVFVYAGVMSVRWWRQMRRHPGRLRRWLRLGKRGPRPLAASRLAEIEDMARATIAQL
FT                   KAGRAVHGRLARLFRGAAHLYDVPWYVVLGPKGSGKTSMLLNSGLAFPLDARLQHSLAP
FT                   DDARALPGWRLTNEAVLIDTAGHYVQHGTSRYSLPVASSDGPNGGKRKKQPPDMAAVRR
FT                   QSDSAEWHGFLRLLRRIRPRLPLNGVLLTIDVAALAHADPAAHTTESRALRARLEEMQA
FT                   EFGTGFPVWLVVTKMDRLPGFTDYFAALGQAERAQILGVTLGSGQQARMNDAIRTELNL
FT                   LATRLADGVTSLLRNEADMDRRRRLAVLPESVAALVNPLADLIEHVFARDDNGGPTQPR
FT                   AMFRGVYLTSAIQGDHAIAAERRTLLRRMIDASGTTRRAPRPARGETGYFLRDLWLAVV
FT                   FREGHLASPNWNREHRVRLQRWLGHSLVWLIAAAMCVNLWNGFVTERTSLATLGQNARS
FT                   LAALLARNDLSADPERVPMVLNRAKELLHDATRLATDADGTFRFATARLETIASDSRHA
FT                   YEALSDQAVLPHIVRRMEGAISSAVAIGDAQAAYDALRVYLMLHDRERFNANDVRMWVL
FT                   DDWWRHDSAATFGGRAAMMGHVERLFSEGHVVRSPLSRNDALIRQARVFLDGSDLIERL
FT                   YRRAKATMWKDAPDDFSLLRMVGTQAGMVFTCVSGAPLSGGVPGIFTREGYQAVFSKRL
FT                   PEFLRAASDDDAWVMGRRASGDPRRHSAGTLNAPNQDDDALLAAITRRYLLEYAQQWDA
FT                   FLGDIRIVSGTSLAFNLKILRTLAAPDSPLTRLARAAVIETTLTQPMAKSDGALLAKAT
FT                   DAIHQKAETVLGPRASEQLEREWVDRHFAALREVVTGHADTRSDTQPVETSAGRTGLDG
FT                   IADLLNDYYAALAIADNALLNNSMPPASEHAAKLKMMADTMPAPLRAVLHQLAVEGSRG
FT                   VNQGIGRLLSRQVQAAIGDVCRTTIEGNYPFSPDSSRDVGIDDFTRMFAHGGVIDDFFT
FT                   RTLAPFVDTAAKPWRYRTLPGATEAVQGPDLAPFEHAKAIRDIFFNEVDRTRPSWKVDI
FT                   RIPELDPTIMSLSLDIDGQTTRYRHGPVEPFTVTWPGPRGGAHAWLVASPSIGPNTWTI
FT                   AADGPWALMRLLRKGHVIETATLGRTRVVFSFDGREAALDIASAGSAGNPLTSDVLATF
FT                   RCPGTMAMFNLPDSGPPPGLPHGRLPAMPDSGL"
FT                   /protein_id="YP_001583158.1"
FT   sig_peptide     35515..35619
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.446 at
FT                   residue 35"
FT                   /locus_tag="Bmul_3182"
FT                   /product="hypothetical protein"
FT   misc_feature    35716..39378
FT                   /note="type VI secretion protein IcmF; Region: VI_IcmF;
FT                   TIGR03348"
FT                   /db_xref="CDD:163225"
FT                   /locus_tag="Bmul_3182"
FT   misc_feature    37291..38256
FT                   /note="Intracellular multiplication and human
FT                   macrophage-killing; Region: IcmF-related; pfam06761"
FT                   /db_xref="CDD:148393"
FT                   /locus_tag="Bmul_3182"
FT   misc_feature    38581..38955
FT                   /note="Protein of unknown function (DUF1215); Region:
FT                   DUF1215; pfam06744"
FT                   /db_xref="CDD:148380"
FT                   /locus_tag="Bmul_3182"
FT   gene            complement(39498..40511)
FT                   /db_xref="GeneID:5769693"
FT                   /locus_tag="Bmul_3183"
FT   CDS_pept        complement(39498..40511)
FT                   /locus_tag="Bmul_3183"
FT                   /gene_family="HOG000220800" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="VacJ family lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: bam:Bamb_4949
FT                   VacJ family lipoprotein"
FT                   /db_xref="GI:161519732"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="GeneID:5769693"
FT                   /translation="MNNMRIIAVTVAASAMLSGCATGPNRNPNDPLEPMNRAMYKFNDT
FT                   VDEHIAVPIAKGYQKITPTPLRTAISNFFSNLGDLGNMANNLLQLRITDATQDLMRVAM
FT                   NSVFGMAGLIDIATPAGLPKHHQDFGLTLARWGVPSGPYLVLPVFGPSTFRDGVGRAVD
FT                   VRFNLLNYIEPAARNPMYVMQFISARSDLLGATDLLKQAALDPYSFVRDAYLQQRKSLT
FT                   YRGQSSAGVPSYNEPGEAGAVPGAVPAATPAAPGLPNYEDPGESGGTGGGAPNNAPAAP
FT                   GLPQYDDPGSDTATPASAPAAASATAPAGSTTAPAASGAPIAPAMPTVPASSPAAQ"
FT                   /protein_id="YP_001583159.1"
FT   misc_feature    complement(39828..40511)
FT                   /note="VacJ like lipoprotein; Region: VacJ; cl01073"
FT                   /db_xref="CDD:186319"
FT                   /locus_tag="Bmul_3183"
FT   sig_peptide     complement(40446..40511)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.906 at
FT                   residue 22"
FT                   /locus_tag="Bmul_3183"
FT                   /product="hypothetical protein"
FT   gene            complement(40504..43137)
FT                   /db_xref="GeneID:5768687"
FT                   /locus_tag="Bmul_3184"
FT   CDS_pept        complement(40504..43137)
FT                   /locus_tag="Bmul_3184"
FT                   /gene_family="HOG000220788" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hopanoid biosynthesis associated RND transporter
FT                   like protein HpnN"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: hopanoid biosynthesis associated RND
FT                   transporter like protein HpnN; KEGG: bch:Bcen2424_5676
FT                   efflux pump, RND superfamily"
FT                   /db_xref="GI:161519733"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="GeneID:5768687"
FT                   /translation="MVTSLIVRLVAWSVRRPVWVVVLSLLIAAFSGVYVARHFKINTDI
FT                   SKLVDAEPQWAALSQAVDRAFPQRNGTILAVVEAPAPEFATAAAHALTESLQKQAAAGR
FT                   IGPVAEPGGGPFFEHNGLLFLSPQQVADTTSQLASARPLVNELAKNPSLTGLATTLSTT
FT                   LGQPLLTGQVKLPSMAKLLSRSAATVDDVLAGKPAAFSWRALVDNDAARQPARAFVTVQ
FT                   PVVNYGALKAGAQTSDVIRETARALDLEKRYGAVVRLTGEQPLADDEFSSVEDGAALNG
FT                   VVTLLVVFVILWLALRSKRMIASVLVTLFVGLVVTAALGLAMVGSLNMISVAFMVLFVG
FT                   LGVDFSIQYGVKYREERFRDERIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRG
FT                   VSELGLIAGVGMFVALLTTLTLLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPIL
FT                   IGTLAVVIGALPLLAFLHFDFNPLHLKDPHSESMSTLLALKDSPEAAVNDVTLLAPSLA
FT                   DADAAAKRLDALPEVGRTTTLSTFIPADQPEKRAAIATAASTLLPALTQPPAPPATDAQ
FT                   RVAALKRASDLLGYAAEDHPGPGAAAAQHLSQSLAKLAAADSATRDRAERAFADTLRIA
FT                   LNQLAALLQPQEITRDTLPPPLVRDWVAPDGKALVQISPKVPKGVDPNDDTMLRHFATA
FT                   VKAAEPGAIGGPISILHSANTIISAFLHAALWSIISITILLWITLRRFGDVLRTLVPLL
FT                   VSGIVTLEMCVVLGMSLNFANIIALPLMLGVGVAFKVYFVMAWRAGQTGLLHSSLTHAV
FT                   LFSAATTATAFGSLWLSHHPGTSSMGKLLALALTCTLIGAVVFQPVLMGKPRVKRAKNQ
FT                   SQGINE"
FT                   /protein_id="YP_001583160.1"
FT   misc_feature    complement(40540..43125)
FT                   /note="hopanoid biosynthesis associated RND transporter
FT                   like protein HpnN; Region: HpnN; TIGR03480"
FT                   /db_xref="CDD:163284"
FT                   /locus_tag="Bmul_3184"
FT   gene            43456..44052
FT                   /db_xref="GeneID:5768688"
FT                   /locus_tag="Bmul_3185"
FT   CDS_pept        43456..44052
FT                   /locus_tag="Bmul_3185"
FT                   /gene_family="HOG000220777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="toluene tolerance family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   bur:Bcep18194_B0023 toluene tolerance protein"
FT                   /db_xref="GI:161519734"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="GeneID:5768688"
FT                   /translation="MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAA
FT                   RGGDMAKITQVVEQRFLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAA
FT                   SLAQLGNQDAKFSFKAGGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSG
FT                   AWLIQVYQGQFKSQLASGGIDGLIAYLQKHNSRTN"
FT                   /protein_id="YP_001583161.1"
FT   sig_peptide     43456..43518
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 21"
FT                   /locus_tag="Bmul_3185"
FT                   /product="hypothetical protein"
FT   misc_feature    43525..44037
FT                   /note="ABC-type transport system involved in resistance to
FT                   organic solvents, auxiliary component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: Ttg2D; cl01074"
FT                   /db_xref="CDD:186320"
FT                   /locus_tag="Bmul_3185"
FT   misc_feature    43537..44037
FT                   /note="Toluene tolerance, Ttg2; Region: Tol_Tol_Ttg2;
FT                   pfam05494"
FT                   /db_xref="CDD:147591"
FT                   /locus_tag="Bmul_3185"
FT   gene            complement(44225..44869)
FT                   /db_xref="GeneID:5769974"
FT                   /locus_tag="Bmul_3186"
FT   CDS_pept        complement(44225..44869)
FT                   /locus_tag="Bmul_3186"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component LuxR family transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bvi:Bcep1808_3814
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="GI:161519735"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="GeneID:5769974"
FT                   /translation="MSAPDTARPAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNAD
FT                   EALALAAELEPDLALMDVGMNGMNGIALAGVFHERFPAIRVLMLSMHDNVEYVTQAVRA
FT                   GASGYLLKDSPASEIVRAIGAVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILD
FT                   ALAEGLSSKQIAQQTGLSVRTVETHRLNLKRKLDIEGQAELIKFAVEHRRR"
FT                   /protein_id="YP_001583162.1"
FT   misc_feature    complement(44234..44836)
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(44489..44830)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(order(44531..44536,44543..44545,44600..44602,
FT                   44660..44662,44684..44686,44816..44821))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(44684..44686)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(order(44660..44668,44672..44677))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(44528..44536)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(44240..44410)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(order(44267..44269,44300..44314,44318..44323,
FT                   44327..44332,44354..44362,44399..44407))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bmul_3186"
FT   misc_feature    complement(order(44240..44245,44252..44254,44261..44269,
FT                   44360..44362,44366..44368,44372..44374))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bmul_3186"
FT   gene            complement(44897..46276)
FT                   /db_xref="GeneID:5769354"
FT                   /locus_tag="Bmul_3187"
FT   CDS_pept        complement(44897..46276)
FT                   /locus_tag="Bmul_3187"
FT                   /gene_family="HOG000220751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   Cache type 2 domain protein; KEGG: bam:Bamb_4945
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="GI:161519736"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013163"
FT                   /db_xref="GeneID:5769354"
FT                   /translation="MKLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAY
FT                   LSSKEVELKHYVELATSAIMPLYDAAGRNGRDDAMLRTQALAMLQKMDFGPDGYFFVYD
FT                   LHGNALMHPREPERVGHNFWTMRDPQGALTIQQLIGAASRGGGFVRYVWQRPSTGKPAP
FT                   KLGYVVALERWGWMVGTGIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAAIAV
FT                   CALVLNVSESRSADAKLKQLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALA
FT                   RFERGTVRVPEAERALASGVVRLGDTLREVRRISHALRPAMLDDLGLAAALDQLIREFG
FT                   AQSGIDIGYTQVAHSGARPLPAAVNTALFRIAQEALSNIVHHAHASRAAVTLDVGAQSV
FT                   TLTIADNGCGFDAVRSQADERRGIGLRNMRERLDALGGTLTITSQVGHTVVAARVPLRD
FT                   A"
FT                   /protein_id="YP_001583163.1"
FT   misc_feature    complement(44909..46276)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: COG4564"
FT                   /db_xref="CDD:34202"
FT                   /locus_tag="Bmul_3187"
FT   sig_peptide     complement(46184..46276)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.319 at
FT                   residue 31"
FT                   /locus_tag="Bmul_3187"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(45884..46153)
FT                   /note="Cache domain; Region: Cache_2; pfam08269"
FT                   /db_xref="CDD:149365"
FT                   /locus_tag="Bmul_3187"
FT   misc_feature    complement(45320..45520)
FT                   /note="Histidine kinase; Region: HisKA_3; pfam07730"
FT                   /db_xref="CDD:149021"
FT                   /locus_tag="Bmul_3187"
FT   misc_feature    complement(44936..45175)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3187"
FT   misc_feature    complement(order(44948..44950,44954..44956,45002..45013,
FT                   45047..45052,45056..45058,45062..45064,45068..45070,
FT                   45134..45136,45143..45145,45155..45157))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3187"
FT   misc_feature    complement(45143..45145)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3187"
FT   misc_feature    complement(order(45005..45007,45011..45013,45050..45052,
FT                   45056..45058))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3187"
FT   gene            complement(46394..47983)
FT                   /db_xref="GeneID:5769355"
FT                   /locus_tag="Bmul_3188"
FT   CDS_pept        complement(46394..47983)
FT                   /locus_tag="Bmul_3188"
FT                   /gene_family="HOG000146508" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bur:Bcep18194_B0028 diguanylate
FT                   cyclase (GGDEF domain)"
FT                   /db_xref="GI:161519737"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="GeneID:5769355"
FT                   /translation="MPDDPRIMAETDYAMPRESGLTSRVATHLRRLLLPHLIFYSGLLI
FT                   ALLLMLLCAIVLYEGRIDARERARTTLQNLVLMASWDIERNIEIYSLSLQAVVEGENDP
FT                   AIVALPMPLRRQVLFDRATTARYLGGIYVLDSRGNIAVDGKSDVPRNANFADAPYFSVH
FT                   RDRPDVGLYVSDPYRSRLRGGSPSIALSRRITRADGSFGGIAVMSIRLEYFRDLFSRLA
FT                   LGDRGAMSLIGTNGVMVMREPYDPKIVGRNISQASTFRQFMRAREGSFFDRASIDGVRR
FT                   LYAFRHLDNLPLIMMVAESESEIYAAWYDRAIPIGSAMALLALGFVGLSLLLDVQLRKR
FT                   HRAETELQALARTDGLTGLDNRRMLDVTLAREWRRAARSQHALSLLFVDVDHFKRYNDS
FT                   QGHQAGDDALAAVGRCIAGCLRRPADYAARYGGEEFVVILPDIGSDGAVAIAETIRTSI
FT                   LELGIRHDGSAFGCLTASIGVATCRPDRDDDMHAALKLADDALYRAKETGRNRVVVLTA
FT                   AHAGRHYAPRTA"
FT                   /protein_id="YP_001583164.1"
FT   misc_feature    complement(46424..>47563)
FT                   /note="putative diguanylate cyclase YedQ; Provisional;
FT                   Region: PRK15426"
FT                   /db_xref="CDD:185324"
FT                   /locus_tag="Bmul_3188"
FT   misc_feature    complement(46445..46930)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3188"
FT   misc_feature    complement(order(46685..46687,46817..46819))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3188"
FT   misc_feature    complement(order(46682..46693,46697..46699,46766..46768,
FT                   46778..46780,46790..46795,46802..46804))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3188"
FT   misc_feature    complement(order(46625..46627,46709..46711))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bmul_3188"
FT   gene            complement(48445..50619)
FT                   /db_xref="GeneID:5768804"
FT                   /locus_tag="Bmul_3189"
FT   CDS_pept        complement(48445..50619)
FT                   /locus_tag="Bmul_3189"
FT                   /gene_family="HOG000220740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="catalyzes the formation of malate from glyoxylate
FT                   and acetyl-CoA"
FT                   /db_xref="GI:161519738"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="GeneID:5768804"
FT                   /translation="MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAP
FT                   RNRELLAERDRLQSELDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDS
FT                   EIATQAGPQLVVPLSNARYALNAANARWGSLYDALYGTDALPEDNGAERTATYNPTRGQ
FT                   RVIDYARNVLDNAAPLAGASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAAD
FT                   APSAILLKHNGLHLEIQIDGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDK
FT                   VQLYRNWLGLMQGTLVEEVSKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGH
FT                   LMTIGAVLDRDGNEIPEGILDGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAF
FT                   ADTLFARIEDLYGLPRNTLKMGIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDE
FT                   MHSAMEAGPMIRKGDMKSSAWIAAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAML
FT                   EQKIAHPRAGANTAWVPSPTAATLHALHYHLVDVQAVQQELERTPYASERDALLDGLLT
FT                   VPVVERAAWSDEEILREVENNAQGILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRI
FT                   SSQHIANWLRHGVITEAFVLDVFKRMARVVDQQNAGDPNYRPMAPDYDRSVAFQAACAL
FT                   ALHGTSQPSGYTEPLLHRFRLAFKAQQAQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583165.1"
FT   misc_feature    complement(48466..50604)
FT                   /note="Malate synthase G (MSG), monomeric enzyme present in
FT                   some bacteria. In general, malate synthase catalyzes the
FT                   Claisen condensation of glyoxylate and acetyl-CoA to
FT                   malyl-CoA , which hydrolyzes to malate and CoA. This
FT                   reaction is part of the glyoxylate...; Region:
FT                   malate_synt_G; cd00728"
FT                   /db_xref="CDD:48434"
FT                   /locus_tag="Bmul_3189"
FT   misc_feature    complement(order(48733..48735,49261..49263,49267..49269,
FT                   49345..49347,49612..49614))
FT                   /note="active site"
FT                   /db_xref="CDD:48434"
FT                   /locus_tag="Bmul_3189"
FT   gene            complement(50654..51058)
FT                   /db_xref="GeneID:5768805"
FT                   /locus_tag="Bmul_3190"
FT   CDS_pept        complement(50654..51058)
FT                   /locus_tag="Bmul_3190"
FT                   /gene_family="HOG000195937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   bch:Bcen2424_5668 protein of unknown function DUF336"
FT                   /db_xref="GI:161519739"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="GeneID:5768805"
FT                   /translation="MQMKPELELADADRILAAARAEAERNGWAVSIAVVDDGGHLLAFA
FT                   RLDGASPASAAIAQDKARAAALGRRDTKAYEDMINGGRTAFLSAPLSGLLEGGVPVTAG
FT                   GRVAGAIGVSGVKSVQDAQIARAGAQSVAD"
FT                   /protein_id="YP_001583166.1"
FT   misc_feature    complement(50660..50983)
FT                   /note="Domain of unknown function (DUF336); Region: DUF336;
FT                   cl01249"
FT                   /db_xref="CDD:186401"
FT                   /locus_tag="Bmul_3190"
FT   gene            51641..53119
FT                   /db_xref="GeneID:5768542"
FT                   /locus_tag="Bmul_3191"
FT   CDS_pept        51641..53119
FT                   /locus_tag="Bmul_3191"
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /transl_table="11"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bam:Bamb_4936 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="GI:161519740"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="GeneID:5768542"
FT                   /translation="MSNPVRGDGPDARAVPILHRPVCDLLGCTWPIVLAGMGGVARSAL
FT                   ASAVSAAGGFGFLGMVREPVELIRREVQQVRAATDRPFGINLIPAATPPELLDAQLDAC
FT                   IELRVPVVALFWDVMPAIVRRLRDAGIRVVHQVGSVDDAQAAEAAGADALIVQGHEAGG
FT                   HVRGDRPLLALLPDVIGAVQVPVLAAGGIVDGAGVAAAMALGAQGAAIGTAFLATHESF
FT                   AHAYHKQRIVDAHDGDTLLTDIFHINWPRGAKVRVLPSSVTRGERGDPFGDARVVIGDE
FT                   EGRPIYLFSTDSPLRTMTGDFEAMALYAGTGAGRIRAVEPAADVLRRIVREAAAILESR
FT                   AAAPSGHDADAQRTALLAALDELLEAERAGARVASETAAELTDDDALHRLIAHIRQDEA
FT                   HWCSVLVDAIRTLGATPTRATGAFYEKAMAIDDLAERMAFLNRGQRWVVRKLQALLPTL
FT                   ADRDLHEALTQMLVAHEKNIGAVDVRLRDGGVHG"
FT                   /protein_id="YP_001583167.1"
FT   misc_feature    51701..52627
FT                   /note="putative enoyl-(acyl-carrier-protein) reductase II;
FT                   Region: enACPred_II; TIGR03151"
FT                   /db_xref="CDD:132195"
FT                   /locus_tag="Bmul_3191"
FT   misc_feature    51722..52396
FT                   /note="2-Nitropropane dioxygenase (NPD), one of the
FT                   nitroalkane oxidizing enzyme families, catalyzes oxidative
FT                   denitrification of nitroalkanes to their corresponding
FT                   carbonyl compounds and nitrites. NDP is a member of the
FT                   NAD(P)H-dependent flavin...; Region: NPD_like; cd04730"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Bmul_3191"
FT   misc_feature    order(51746..51751,51902..51904,51983..51985,52046..52048,
FT                   52109..52111,52121..52126,52205..52213,52268..52279)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Bmul_3191"
FT   misc_feature    52127..52132
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Bmul_3191"
FT   misc_feature    52130..52132
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Bmul_3191"
FT   gene            complement(53135..54139)
FT                   /db_xref="GeneID:5768749"
FT                   /locus_tag="Bmul_3192"
FT   CDS_pept        complement(53135..54139)
FT                   /locus_tag="Bmul_3192"
FT                   /gene_family="HOG000224650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; KEGG: reu:Reut_A0607 CheB
FT                   methylesterase"
FT                   /db_xref="GI:161519741"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="GeneID:5768749"
FT                   /translation="MDHRDVVVVASSRGGLPVLRTLVTNLPEGFPVPICIVQHIGRNRS
FT                   ILPELLTRWGRLDATHALHGERPHPGRIYVAPPDRHLVLRGGRLHLLDTAAENYARPAA
FT                   DPLFRSAAREYGPGAIGVVLSGDLDDGSAGLAAIRAHGGYGIVQRPDECEAPSMPRAAL
FT                   AAAGADAVATADELARTIHAAVYGARGEEGRTMTDLRTLDDESRIAEGRFVTPQLLDAI
FT                   GERSALTCPSCNGALWRMRDDRPLRYRCHTGHAFSALSLDDAEAQKAEDAIWVAIRAVN
FT                   ERMIFARERQEWARRTGNAEDEAIEQARIDENRQLAEVLRHALHVATHGRETG"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583168.1"
FT   misc_feature    complement(53660..54124)
FT                   /note="CheB methylesterase; Region: CheB_methylest;
FT                   pfam01339"
FT                   /db_xref="CDD:144802"
FT                   /locus_tag="Bmul_3192"
FT   gene            complement(54294..58436)
FT                   /db_xref="GeneID:5768750"
FT                   /locus_tag="Bmul_3193"
FT   CDS_pept        complement(54294..58436)
FT                   /locus_tag="Bmul_3193"
FT                   /gene_family="HOG000062543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase with CheB
FT                   and CheR activity"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4915 protein-glutamate
FT                   methylesterase, two-component system, chemotaxis family,
FT                   response regulator CheB / chemotaxis protein
FT                   methyltransferase CheR; TIGRFAM: PAS sensor protein; PFAM:
FT                   CheB methylesterase; MCP methyltransferase CheR-type;
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="GI:161519742"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:5768750"
FT                   /translation="MARQEPTDRERLPASATLRSDLTFPIVGIGASAGGTTALQTFFEN
FT                   APTGMEMAFVVIVHLAPEQISHMDSVLQHTTGMPVRQVTSTVPIEKNHIYVIAPGMQLE
FT                   MADGCLRCSPREMSGGVALTIDHFFRTLADAHDSRAIGIVMSGTGSDGAAGLRRIKEVG
FT                   GITLAQTPDDAEHAEMPKQAIAVGGADIVLPAAEMPQRLLDLWANARRIEQQGLELAHA
FT                   HQNLDRPGANDPERALSDILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLLAYR
FT                   DFLRATPDEANALLADMLIGVTQFFRDRDAFDFLEREVIASMFSPDAGEEQVRVWVAGC
FT                   ATGEEAYSISLLLARARETAVSSQAIQVFATDIDEAAIVRARTGSYPLSIAADVPEPLL
FT                   QRYFTRDGAHFVIAKSVRERILFAAHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILE
FT                   LFHFALRPNGYLFLGTAESADAADDLFTVVDKKRRIYQARVVTHRAKTPTGCPPLLHVE
FT                   SGSADERPVPTPALRAPASPVQRNFSYAELHQRALEMYSPPSVIIDKESNVVHLSDNAG
FT                   RFLRHVGGELSSNIMTLVLPDLRLDLRTAIFRALQTGTSVEARRVKWTHDTQVSWINMT
FT                   VRPFHDKVANADFLLVVFDEVAGRMTDEDQAEATGQDPVLAQLEHELQHSREQLATIIE
FT                   QYETSVEELKASNEELQAINEELRSTSEELESSKEELQSVNEELTTANAEMQARIEDTA
FT                   KANDDLHNIIASSEIATVFVDKEIRIKRFTPNATAIFNLIDSDLGRSLFHITHSLRYPT
FT                   LADDVRQSFQSLRLIEREIESEAGRWYLIRLLPYRTADDHIDGAVITLIDVTDRHHAEE
FT                   AARAGEQRLRLVAQSTKDYAIIIQDGNGIIASWNAGAERIFGYTEDEMIGQDVELIYEP
FT                   NDRHARVPAHEREVAAREGRADDERWHRTKDGRRIFCSGVVTPIADTSFNGFAKIVRDL
FT                   TQRKLSEDANREALAREQAAREQALSSNQLKDEFIAVLSHELRHPLNLIGVRAEMLPRL
FT                   PETRDIPAVREAAELIRQAVRAQAQIIDDLLDLSRIRTGKLALELSRVDLTAVLRTIVD
FT                   TCEADAHARGLVLTAELPDEPAIALADPIRCEQIFWNLMSNALKFTHAGGRIVVRLTHE
FT                   ARMLRVDVIDDGQGIDRDTLPHVFDMFRQAPRDRTRGGLGIGLALVRQLVEMHDGRISA
FT                   ASEGPGRGTTMTVWLPAAADTRVAAADRRASEGRIAGLHVLLVEDDAETALSLTTLLKL
FT                   AGAEVRTAASGAAALEMLAQGPVDAIVSDIGLPDMDGYALLRRIKADPQWAQVKAIALT
FT                   GRNRQTDVGAATQAGFDTHLPKPLDFGLLLAALAEPR"
FT                   /protein_id="YP_001583169.1"
FT   misc_feature    complement(57822..58361)
FT                   /note="CheB methylesterase; Region: CheB_methylest;
FT                   pfam01339"
FT                   /db_xref="CDD:144802"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(56949..57734)
FT                   /note="Methylase of chemotaxis methyl-accepting proteins
FT                   [Cell motility and secretion / Signal transduction
FT                   mechanisms]; Region: CheR; COG1352"
FT                   /db_xref="CDD:31543"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(57567..57734)
FT                   /note="CheR methyltransferase, all-alpha domain; Region:
FT                   CheR_N; pfam03705"
FT                   /db_xref="CDD:112515"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(56952..57536)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54723..55802)
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(55470..55772)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(55551..55553,55566..55568,55647..55658,
FT                   55695..55697,55713..55715,55725..55727))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(55524..55526,55530..55532,55617..55622,
FT                   55629..55631,55653..55655,55665..55667))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(55188..55388)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(55203..55205,55215..55217,55224..55226,
FT                   55236..55238,55245..55247,55257..55259,55314..55316,
FT                   55323..55325,55335..55337,55344..55346,55356..55358,
FT                   55368..55370))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(55350..55352)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54717..55022)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(54729..54731,54735..54740,54756..54758,
FT                   54762..54764,54810..54821,54894..54899,54903..54905,
FT                   54909..54911,54915..54917,54984..54986,54993..54995,
FT                   55005..55007))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54993..54995)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(54813..54815,54819..54821,54897..54899,
FT                   54903..54905))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54303..54641)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(54339..54344,54351..54353,54408..54410,
FT                   54474..54476,54498..54500,54627..54632))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54498..54500)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(order(54474..54482,54486..54491))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3193"
FT   misc_feature    complement(54336..54344)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_3193"
FT   gene            complement(58763..59614)
FT                   /db_xref="GeneID:5768692"
FT                   /locus_tag="Bmul_3194"
FT   CDS_pept        complement(58763..59614)
FT                   /locus_tag="Bmul_3194"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3824
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:161519743"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:5768692"
FT                   /translation="MFPTPVAQWKPVTRRLYKLSLPVALAIWLLPLIAVFVTSVRSTEE
FT                   LVEGHYWGWPRHFSMIENYRDALTTSPMLHYFWNSVQITVPSVLGSIALAAMAGFALAT
FT                   YRFRGNTALFGTFVAGNFVPVRVLMIPVRDLSLRLGVFNTVEALILFHVAFQTGFCTLF
FT                   LRNFIKQLPFELIEAARIEGAGEWTVFWRIVLPLIRPALAALAILVFTFVWNDYFWALC
FT                   LTQGDEAAPITAGVAALKGQWTTSWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGAT
FT                   KG"
FT                   /protein_id="YP_001583170.1"
FT   sig_peptide     complement(59486..59614)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.460 at
FT                   residue 43"
FT                   /locus_tag="Bmul_3194"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(58829..59386)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3194"
FT   misc_feature    complement(order(58829..58834,58841..58846,58853..58858,
FT                   58862..58867,58874..58879,58907..58912,58949..58954,
FT                   58961..58972,58991..58993,59000..59005,59045..59047,
FT                   59096..59098,59105..59110,59120..59122,59126..59131,
FT                   59138..59140,59144..59146,59150..59155,59222..59227,
FT                   59234..59263,59267..59278,59306..59308,59321..59326,
FT                   59333..59338))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3194"
FT   misc_feature    complement(order(58955..58972,59219..59260))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3194"
FT   misc_feature    complement(order(58877..58879,58907..58909,58916..58918,
FT                   58952..58954,59168..59170))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3194"
FT   misc_feature    complement(order(59024..59026,59036..59041,59057..59095))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3194"
FT   gene            complement(59631..60569)
FT                   /db_xref="GeneID:5768302"
FT                   /locus_tag="Bmul_3195"
FT   CDS_pept        complement(59631..60569)
FT                   /locus_tag="Bmul_3195"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3825
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:161519744"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:5768302"
FT                   /translation="MSSPLTSHSPAGAAASRDAAHALPARRPSPAARRQRRAAWLFLAP
FT                   ACAMVAVYVIWPILSTLWLSLCNWDGMTERTFVGLANYVELLHAPTFYTALRNNVIWLV
FT                   LFMLAPPLGLALALYLNQAVGGIRLVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLALI
FT                   AGHGIPVLGDARYATLGVVFAALWPQTAYCMILYLTGLTSLNPEQIEAARMEGARGFAL
FT                   LWHVVLPQLRPTTFMAIVVTVIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYR
FT                   LGYSASIAVVLFAIMLVYIAFQLRRMLRNEQ"
FT                   /protein_id="YP_001583171.1"
FT   misc_feature    complement(59679..60188)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3195"
FT   misc_feature    complement(order(59679..59684,59691..59696,59703..59708,
FT                   59712..59717,59724..59729,59757..59762,59805..59810,
FT                   59817..59828,59847..59849,59856..59861,59901..59903,
FT                   59952..59954,59961..59966,59976..59978,59982..59987,
FT                   59994..59996,60000..60002,60009..60014,60120..60122,
FT                   60126..60131,60138..60167,60171..60182))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3195"
FT   misc_feature    complement(order(59811..59828,60120..60164))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3195"
FT   misc_feature    complement(order(59727..59729,59757..59759,59766..59768,
FT                   59808..59810,60027..60029,60120..60122))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3195"
FT   misc_feature    complement(order(59880..59882,59892..59897,59913..59951))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_3195"
FT   gene            complement(60623..61882)
FT                   /db_xref="GeneID:5768303"
FT                   /locus_tag="Bmul_3196"
FT   CDS_pept        complement(60623..61882)
FT                   /locus_tag="Bmul_3196"
FT                   /gene_family="HOG000117699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bam:Bamb_4932 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="GI:161519745"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:5768303"
FT                   /translation="MTHRPVRAAARFATAAAVALASLAATAPADAGTLSINIAFKGASQ
FT                   RAVWQSTLDAFHRAHPDIDVKATFVDEEAYKVQLPAWLTTVAPDVVNWHAGERMAYYAK
FT                   RGLFEDLSGDWAKNGWDAMYASTRSASSYNGKQYAAPTVYYSWGLFYRKDLFRKVGIAN
FT                   EPKTWDQFLDACRKLKAAGITPIAVGGRDAWTLAGWFDYLDLRLNGNAFHQQLMAGDVP
FT                   YTDARVKKVYTTWKSLIDAGYFIDNALSYDLDGAQPFLFQGKAAMMLMGTFIAAGFPAN
FT                   VKPEMGYYRFPIIDANVPTAEDGPVESLHIPTKAKNKADAHTFLAFVETPEIGAKLAEG
FT                   LGSLSANSKSPEPAEPISRIGFRILADTKGGVAQFYDRDMTKEMADEGMKGMQQFVANP
FT                   AQLDAVLAQLEQTRKRIYKK"
FT                   /protein_id="YP_001583172.1"
FT   sig_peptide     complement(61787..61882)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.732 at
FT                   residue 32"
FT                   /locus_tag="Bmul_3196"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(60626..61777)
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="Bmul_3196"
FT   misc_feature    complement(60845..61717)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bmul_3196"
FT   gene            complement(61956..63941)
FT                   /db_xref="GeneID:5768083"
FT                   /locus_tag="Bmul_3197"
FT   CDS_pept        complement(61956..63941)
FT                   /locus_tag="Bmul_3197"
FT                   /gene_family="HOG000117811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: bam:Bamb_4931
FT                   beta-galactosidase"
FT                   /db_xref="GI:161519746"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="GeneID:5768083"
FT                   /translation="MRVGVCYYPEHWPESMWADDARRMKALGIAQVRIAEFAWSRIEPS
FT                   PGEYDWGWLDRAVDVLAAAGLDIVMCTPTATPPKWLIDRHPEILAIGADGRPRTFGSRR
FT                   HYDFSSPVYYDASRQICTAVAERYGRHPAVRFWQTDNEMGCHQTVVSYSPAALARFREW
FT                   LKARYGTIDALNRAWGTVFWSMEYRDFDEIDAPVGTVTEAHPTHRLDYRRFASDEVVRY
FT                   HRMQVDVIRAHSPGRPVAHNFMQLFTDFDHYAVARDLDVATWDSYPLGALEEHWFAPDV
FT                   KARWLRTGHPDFASFNHDLYRGMSKLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEA
FT                   FAHGAGCVSYFRWRQAPFAQEQMHAGLHTPDDRLDEGGREAERVAHEIAVVHGADAHAD
FT                   AAVHARVALVFDYEAKWLLDVQPQGADFQYARIAFEYYSALRALGLDVDVISAQAPLDG
FT                   YRLVVVPPLPIVPDDFAARLAASGAHAVFGPRTGSKTVDLQIPPTLPPGALASILPLRV
FT                   WRVESLRPNVTERVDGALVDGTPFAGHARHWRDLVELRDAQRTVVRARFADDHPAWLSH
FT                   GTLHYWAALFDDATTAQLFASVAAEAGLAPTPLADGVRISRRGGLTYVFNYGDTVHTID
FT                   AVPPAAFVVGSADVEPRGVAVYRSPV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583173.1"
FT   misc_feature    complement(61968..63932)
FT                   /note="Beta-galactosidase [Carbohydrate transport and
FT                   metabolism]; Region: LacA; COG1874"
FT                   /db_xref="CDD:32058"
FT                   /locus_tag="Bmul_3197"
FT   misc_feature    complement(62778..63926)
FT                   /note="Beta-galactosidase; Region: Glyco_hydro_42; cl03154"
FT                   /db_xref="CDD:155315"
FT                   /locus_tag="Bmul_3197"
FT   misc_feature    complement(<62370..62714)
FT                   /note="A4 beta-galactosidase middle domain: a type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   A4_beta-galactosidase_middle_domain; cd03143"
FT                   /db_xref="CDD:153237"
FT                   /locus_tag="Bmul_3197"
FT   gene            complement(63951..65099)
FT                   /db_xref="GeneID:5768084"
FT                   /locus_tag="Bmul_3198"
FT   CDS_pept        complement(63951..65099)
FT                   /locus_tag="Bmul_3198"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5656 ABC transporter related"
FT                   /db_xref="GI:161519747"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="GeneID:5768084"
FT                   /translation="MASISMRRVQKAYGDHAPVIRDVDLEIGEHEFCVFLGPSGCGKST
FT                   LLRMIAGLEDLSAGELSIGGRRVDDVPAAERGVAMVFQSYALFPHMTVYENMAFGLKLA
FT                   RTPKAEIDRKVRDAARILQLDALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLS
FT                   NLDAALRGQTRIEIARLHRQFERASVVYVTHDQTEAMTLADKIVLLHAGADTAQHGSIA
FT                   QVGAPLELYHRPASRFVAGFIGSPRMNFLPAVVAAADAQRTTVTLVPSGETFTLARDGA
FT                   ALRAGDAVTLGIRPEHLTLGAAHDSTMLVRDVALVERLGEQTCVHLEQPGGTPLIAKVP
FT                   GDASVRPGERLPVHAPAAACHLFTEDGRALPASATLSVHHYA"
FT                   /protein_id="YP_001583174.1"
FT   misc_feature    complement(63993..65099)
FT                   /note="maltose/maltodextrin transporter ATP-binding
FT                   protein; Provisional; Region: PRK11000"
FT                   /db_xref="CDD:182893"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64425..65090)
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64968..64991)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(order(64518..64520,64620..64625,64851..64853,
FT                   64965..64973,64977..64982))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64851..64862)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64668..64697)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64620..64637)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64602..64613)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64512..64532)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Bmul_3198"
FT   misc_feature    complement(64011..64229)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Bmul_3198"
FT   gene            65287..66303
FT                   /db_xref="GeneID:5769118"
FT                   /locus_tag="Bmul_3199"
FT   CDS_pept        65287..66303
FT                   /locus_tag="Bmul_3199"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LacI family transcription regulator"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bvi:Bcep1808_3829 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="GI:161519748"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:5769118"
FT                   /translation="MATLDEVARRAGVTAATVSNVLRGRGRVGDATRARVLEAVQTLGY
FT                   RPHLAARALAEGRAPTVALMVSSIANPFYPEFALAVERAVRRNGQFLIVCNTNDDPAQG
FT                   RAYLDQIAGTVSEGILVTNASHLPDLLEVTRRGVPVVLCMWERPDAPPDGLPCVAVDFR
FT                   EAGRIATRHLLELGHERIGAIVGGCAGGVQAARYDGFADVMREAGLDASIVEAEPDSIE
FT                   GGLRAAARLLDAHPELTALLATNDLPAIGALHAAADRGLRVPDDLSIVGITDIQLARDT
FT                   RPTLTTVAIPTAEAAALAVDLLNALREAGGRVDDAARVRTASAPRLVVRGTTGVARR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583175.1"
FT   misc_feature    65290..66297
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    <65341..65451
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    order(65341..65346,65353..65355,65368..65373,65380..65382,
FT                   65419..65421,65428..65430,65437..65442,65446..65451)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    65419..65448
FT                   /note="domain linker motif; other site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    65467..66159
FT                   /note="Ligand binding domain of the LacI tanscriptional
FT                   regulator family belonging to the type I
FT                   periplasmic-binding fold protein superfamily; Region:
FT                   PBP1_LacI_sugar_binding_like; cd06267"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    order(65467..65469,65506..65514,65521..65526,65530..65535,
FT                   65554..65568,65572..65574,65605..65607,65614..65616,
FT                   65623..65631,65950..65952,66034..66036,66046..66048,
FT                   66055..66060)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Bmul_3199"
FT   misc_feature    order(65503..65508,65515..65517,65650..65652,65722..65724,
FT                   65764..65766,65872..65874,65941..65943,66103..66105,
FT                   66154..66156)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Bmul_3199"
FT   gene            complement(66364..68469)
FT                   /db_xref="GeneID:5769358"
FT                   /locus_tag="Bmul_3200"
FT   CDS_pept        complement(66364..68469)
FT                   /locus_tag="Bmul_3200"
FT                   /gene_family="HOG000218738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bam:Bamb_4928 TonB-dependent siderophore receptor"
FT                   /db_xref="GI:161519749"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:5769358"
FT                   /translation="MSRKNWAAAPMAIVVGTAGLSSAEAQELSLPAIEVSGQRTTAPFR
FT                   APESTSATRTETDVMEIPFAVSSVDTKLIRTVAATRGDDLYDWVAGVARQNNFGGLWDN
FT                   YAVRGFAGDGGTSGTDYLVNGFSWNRGMSVPRDTATLERMEVLKGPASALYGRGDPGGL
FT                   ISYTTKQPQFAPSNTIGVSAGSYGALRQTLDSTGPVTKSLAYRFIAMNEDNGSFRDTVS
FT                   SKRYLFAPSFTWDIGDDTTLHYEFETARQRAPLDRGVVAVNGQLGAVPASRFMGEPRDG
FT                   DYDVRNSGHQLTLEHRFNADWSINAGFAQRDTDLSGRSSEAFALQPDGRTLWRRYRQVA
FT                   FHSNDLQGRVEVAGKARTGAIGHMFVMGVDAYRFNYDQFVARSTPTAAAPYAIDIFNPV
FT                   YGQPAPVPRTATNLLERDDGQGLYAQDTLAFGPHWKVLAGLRWDRFHQSVENRLKGVTT
FT                   SQLQTAVSPRLGIVYEASPSLSLYANTAYSFRPNNGADVNGRAFDPEKGHGYEAGVKWA
FT                   GTRWLATVAAFYVNKRNVLTADPANAGFSRAAGEVRSRGVEFEWNGELGHGLRGIVNLA
FT                   YVDAQVTRDSVLTPGARLVDIPRLSGSALLMYETALPLVDKAGAGAGVIYVGRRAGNTA
FT                   NTQDGFDLPAYATVQLNGYVQVNKHLRASVVLNNLFNRTYYVSSYNSLWVTPGAPRSLF
FT                   ASLSYTF"
FT                   /protein_id="YP_001583176.1"
FT   sig_peptide     complement(68392..68469)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 26"
FT                   /locus_tag="Bmul_3200"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(66367..68289)
FT                   /note="TonB-dependent siderophore receptor; Region:
FT                   TonB-siderophor; TIGR01783"
FT                   /db_xref="CDD:162535"
FT                   /locus_tag="Bmul_3200"
FT   misc_feature    complement(66367..68274)
FT                   /note="TonB dependent/Ligand-Gated channels are created by
FT                   a monomeric 22 strand (22,24) anti-parallel beta-barrel.
FT                   Ligands apparently bind to the large extracellular loops.
FT                   The N-terminal 150-200 residues form a plug from the
FT                   periplasmic end of barrel; Region: ligand_gated_channel;
FT                   cd01347"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Bmul_3200"
FT   misc_feature    complement(order(67966..67992,68026..68058,68086..68109,
FT                   68140..68157,68191..68220,68248..68274))
FT                   /note="N-terminal plug; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Bmul_3200"
FT   misc_feature    complement(order(67447..67449,67525..67527))
FT                   /note="ligand-binding site; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="Bmul_3200"
FT   gene            complement(68941..69891)
FT                   /db_xref="GeneID:5769359"
FT                   /locus_tag="Bmul_3201"
FT   CDS_pept        complement(68941..69891)
FT                   /locus_tag="Bmul_3201"
FT                   /gene_family="HOG000233516" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4926 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:161519750"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5769359"
FT                   /translation="MPDASPWGNRSRLKTRQLLLVVALADEGSIHRAAAALNMTQPAAS
FT                   KLLRELEESIGAVLFERLPRGMRPTLYGDALIRHARAALGSLDQAREELAALKSGHLGH
FT                   VAVGAITSPGLRIVPAAVADVKASHANIRISVEIDTSLALLEHLAQEKLDIVLGRLSAE
FT                   HDKLHLRYEPLTGEPVAAVVRTGHPLLADAPLALADVQRAAWIVPPAGSVLRHRFELVF
FT                   QRASLAPPANVVETAALLFITQLLEQSDMIAVVAEDVAHYYARHGIVSVLPLEMDCRMD
FT                   DFGIITRTDRLPSPAVEVMTDAIRAAARQVYGVGV"
FT                   /protein_id="YP_001583177.1"
FT   misc_feature    complement(68962..69861)
FT                   /note="pca operon transcription factor PcaQ; Region:
FT                   TF_pcaQ; TIGR02424"
FT                   /db_xref="CDD:162852"
FT                   /locus_tag="Bmul_3201"
FT   misc_feature    complement(69673..69846)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_3201"
FT   misc_feature    complement(68980..69582)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bmul_3201"
FT   misc_feature    complement(order(69148..69153,69157..69162,69178..69195,
FT                   69478..69498,69502..69504,69514..69516,69523..69528,
FT                   69532..69537))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bmul_3201"
FT   gene            70006..71757
FT                   /db_xref="GeneID:5769086"
FT                   /locus_tag="Bmul_3202"
FT   CDS_pept        70006..71757
FT                   /locus_tag="Bmul_3202"
FT                   /gene_family="HOG000173156" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="catalyzes the formation of 3-methyl-2-oxobutanoate
FT                   from 2,3,-dihydroxy-3-methylbutanoate"
FT                   /db_xref="GI:161519751"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="GeneID:5769086"
FT                   /translation="MSATKPRLRSAQWFGTNDKNGFMYRSWMKNQGIPDHEFDGRPIIG
FT                   ICNTWSELTPCNAHFRKLAEHVKRGIFEAGGFPVEFPVFSNGESNLRPSAMLTRNLASM
FT                   DVEEAIRGNPIDAVVLLAGCDKTTPALLMGAASCDVPAIVVSGGPMLNGKLEGKNIGSG
FT                   TAVWQLHEALKAGEIDLHHFLSAEAGMSRSAGTCNTMGTASTMACMAEALGVALPHNAA
FT                   IPAVDSRRYVLAHMSGIRIVEMALEGLVLSKVLTRAAFENAIRVNAAIGGSTNAVIHLK
FT                   AIAGRIGVPLELEDWMRIGRDTPTIVDLMPSGRFLMEEFYYAGGLPAVLRRLGEGGLLP
FT                   HPDALTVNGKTLWDNVREAPNYDDEVIRPLDRPLIADGGIRILRGNLAPRGAVLKPSAA
FT                   SPELLKHRGRAVVFENFDHYKATINDESLDVDANSVLVLKNCGPRGYPGMAEVGNMGLP
FT                   PKLLRQGVKDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAAVRNGDWIELDCEAGTL
FT                   HLDIPDDELQRRLSDVDPAAAPGVAGQAGKGGYARLYLDHVLQADEGCDLDFLVGTRGA
FT                   EVPSHSH"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583178.1"
FT   misc_feature    70015..71754
FT                   /note="Dehydratase family; Region: ILVD_EDD; cl00340"
FT                   /db_xref="CDD:185921"
FT                   /locus_tag="Bmul_3202"
FT   misc_feature    70099..71709
FT                   /note="dihydroxy-acid dehydratase; Region: ilvD; TIGR00110"
FT                   /db_xref="CDD:161713"
FT                   /locus_tag="Bmul_3202"
FT   gene            71872..73248
FT                   /db_xref="GeneID:5768856"
FT                   /locus_tag="Bmul_3203"
FT   CDS_pept        71872..73248
FT                   /locus_tag="Bmul_3203"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_3833 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:161519752"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:5768856"
FT                   /translation="MTTTQHTSAASAAAPSGPAAAVDERQLMGLLTRRLVPFLALIYVV
FT                   AYVDRTVVGFAKLHMNAAVGLSDAAYGLGAGLFFIGYFLCEVPSNLALGRFGARVWFAR
FT                   ILATWGVITMAMALVRGPTSFYVLRFLLGAAEAGLYPGILYFLTQWFPMRDRARVIGLL
FT                   VLAQPVAGIVTGPLAGWLLSTHGLFGLSNWQTLFVASGLPAVLLVWPTLRVLPESPERA
FT                   RWLDDAQRRWIARELAADRDTYRPDAHRNPLAALRDRRVLLLAALFLPFPLCIYGLSLW
FT                   LPTIIKAFGTGDAATGLLSAVPYLFAVVGLLVVPRHSDRTRERYAHIVVVSAAAALTMA
FT                   ASASVRQPALQFLFICLTAFSLYSIQAVVWALPGEFLTGTSAAVGIAAINSLANLGGYV
FT                   GPYGIGLIKQATGSLAAGLYFLAATLLFAVLITFAVRAALRAPQRAGDALARESRPLSG
FT                   "
FT                   /protein_id="YP_001583179.1"
FT   sig_peptide     71872..71937
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT                   /locus_tag="Bmul_3203"
FT                   /product="hypothetical protein"
FT   misc_feature    71962..73149
FT                   /note="4-hydroxyphenylacetate permease; Region: HpaX;
FT                   TIGR02332"
FT                   /db_xref="CDD:131385"
FT                   /locus_tag="Bmul_3203"
FT   misc_feature    71977..>72519
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_3203"
FT   misc_feature    order(72019..72021,72028..72036,72040..72045,72094..72096,
FT                   72103..72108,72115..72117,72127..72132,72136..72141,
FT                   72277..72282,72289..72294,72301..72306,72313..72315,
FT                   72349..72354,72361..72366,72382..72384)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_3203"
FT   misc_feature    <72691..73179
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_3203"
FT   gene            73279..74208
FT                   /db_xref="GeneID:5768857"
FT                   /locus_tag="Bmul_3204"
FT   CDS_pept        73279..74208
FT                   /locus_tag="Bmul_3204"
FT                   /gene_family="HOG000220663" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bur:Bcep18194_B0042 dihydrodipicolinate synthetase"
FT                   /db_xref="GI:161519753"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="GeneID:5768857"
FT                   /translation="MTSSRTPRYRGIFPVVPTTFTETGELDLASQKRAVDFMIDAGSDG
FT                   LCILANFSEQFALADDERDVLTRTILEHVAGRVPVIVTTSHYSTQTCIARSVRAQQLGA
FT                   AMVMVMPPYHGATFRVPEAQIHAFYARLSDALSIPIMIQDAPASGTVLSAPFLAQLARE
FT                   IEHVAYFKIETPGAATKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGAYP
FT                   DGIRPILEAHREGRHDDAFARYQTWLPLINHENRQSGILTAKALMREGGVIACEAPRHP
FT                   MPTLHPDTRAELIAIARRLDPLVLRWAR"
FT                   /protein_id="YP_001583180.1"
FT   misc_feature    73294..74175
FT                   /note="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase [Amino acid transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane]; Region: DapA; COG0329"
FT                   /db_xref="CDD:30677"
FT                   /locus_tag="Bmul_3204"
FT   misc_feature    73312..74166
FT                   /note="Dihydrodipicolinate synthase family. A member of the
FT                   class I aldolases, which use an active-site lysine which
FT                   stablilzes a reaction intermediate via Schiff base
FT                   formation, and have TIM beta/alpha barrel fold. The
FT                   dihydrodipicolinate synthase family...; Region: DHDPS-like;
FT                   cd00408"
FT                   /db_xref="CDD:29936"
FT                   /locus_tag="Bmul_3204"
FT   misc_feature    order(73321..73323,73417..73419,73426..73434,73705..73707,
FT                   73789..73791)
FT                   /note="inhibitor site; inhibition site"
FT                   /db_xref="CDD:29936"
FT                   /locus_tag="Bmul_3204"
FT   misc_feature    order(73417..73419,73426..73434,73705..73707,73789..73791,
FT                   73918..73920)
FT                   /note="active site"
FT                   /db_xref="CDD:29936"
FT                   /locus_tag="Bmul_3204"
FT   misc_feature    order(73429..73431,73444..73449,73540..73545,73615..73620,
FT                   73648..73650,73660..73662,74116..74121)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29936"
FT                   /locus_tag="Bmul_3204"
FT   misc_feature    73789..73791
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29936"
FT                   /locus_tag="Bmul_3204"
FT   gene            74231..75160
FT                   /db_xref="GeneID:5769210"
FT                   /locus_tag="Bmul_3205"
FT   CDS_pept        74231..75160
FT                   /locus_tag="Bmul_3205"
FT                   /gene_family="HOG000220652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="galactose 1-dehydrogenase"
FT                   /EC_number="1.1.1.48"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bch:Bcen2424_5642 galactose 1-dehydrogenase"
FT                   /db_xref="GI:161519754"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="GeneID:5769210"
FT                   /translation="MSQVVSLGVVGIGKIARDQHLPAIAAEPGFALTACASRHAEVTGV
FT                   RNYPDLGALLAGEPELAAVSLCAPPQVRYAQARAALNAGKHVMLEKPPGATLGEVAALE
FT                   ALAQSRGLTLFATWHSRCASAVEPARAWLATREIRAVQVRWKEDVRRWHPGQQWIWEPG
FT                   GLGVFDPGINALSIVTRILPRELVLREATLVVPSDTQTPIAAELECADTDGVPVHAEFD
FT                   WRHGPVEQWEIAVDTADGVLAISAGGAKLSIAGEPVEVGPAREYPALYAQFHALIARRE
FT                   SDVDVRPLRLVADAFLFGRRVDTEAFGR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583181.1"
FT   misc_feature    74249..74575
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_3205"
FT   gene            75229..76233
FT                   /db_xref="GeneID:5769211"
FT                   /locus_tag="Bmul_3206"
FT   CDS_pept        75229..76233
FT                   /locus_tag="Bmul_3206"
FT                   /gene_family="HOG000220638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bvi:Bcep1808_3836
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="GI:161519755"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:5769211"
FT                   /translation="MFRTNRRTLLRALLAALCIAPLGMQGTARADAPLKIGFLVKMPEQ
FT                   AWFINEQNAAAALGQKENFSVVKIGTPDGEKVLAAIDNLGSQGAQGFVICAPDVRLGPA
FT                   IAARAKRYNMKFVTVDDQLVDSTGKPLANVPHLGMSATKIGNQVGQAIADEMKRRGWKP
FT                   EEVGALRITNYELPTAKLRTDGATQALLANGFRKENIFDAPQKTTDDEGGFSAAAPVLA
FT                   RHPNVKKWVIYALNEETVLGAVRATEQLHIPAADVIGVGINGAGEAFAEFQKKEPTGFF
FT                   GTIAVSSTNHGKESTQNLVDWIRNGKMPPADTQTSGKLMTRSNWQAVRAELGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001583182.1"
FT   sig_peptide     75229..75321
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT                   /locus_tag="Bmul_3206"
FT                   /product="hypothetical protein"
FT   misc_feature    75328..76170
FT                   /note="family; Region: Peripla_BP_1; pfam00532"
FT                   /db_xref="CDD:144207"
FT                   /locus_tag="Bmul_3206"
FT   misc_feature    75331..76200
FT                   /note="Periplasmic L-arabinose-binding protein (ABP), a
FT                   member of a family of pentose/hexose sugar-binding proteins
FT                   of the type I periplasmic binding protein superfamily;
FT                   Region: PBP1_arabinose_binding; cd01540"
FT                   /db_xref="CDD:107253"
FT                   /locus_tag="Bmul_3206"
FT   misc_feature    order(75586..75588,75772..75774,75931..75936,76015..76017)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107253"
FT                   /locus_tag="Bmul_3206"
FT   gene            76254..77801
FT                   /db_xref="GeneID:5768828"
FT                   /locus_tag="Bmul_3207"