(data stored in ACNUC8465 zone)

HOGENOMDNA: BURM1_4

ID   BURM1_4; SV 1; empty ; DNA; empty ; PRO; 919806 BP.
XX
AC   NC_010087;
XX
PR   Project: 58697;
XX
DE   Burkholderia multivorans ATCC 17616 chromosome 3, complete sequence.
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-919806
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Tiedje,J.
RA   and Richardson,P.;
RT   "Complete sequence of chromosome3 of Burkholderia multivorans ATCC 17616";
RL   Unpublished
XX
RN   [2]
RP   1-919806
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-DEC-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-919806
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Tiedje,J.
RA   and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (26-OCT-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000870.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002733
CC   Source DNA available from James Tiedje (tiedjej@msu.edu)
CC   Bacteria available from ATCC: ATCC 17616
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..919806
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="3"
FT                   /db_xref="taxon:395019"
FT   gene            15..323
FT                   /db_xref="GeneID:5770871"
FT                   /locus_tag="Bmul_5324"
FT   CDS_pept        15..323
FT                   /locus_tag="Bmul_5324"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6524 hypothetical protein"
FT                   /db_xref="GI:161522357"
FT                   /db_xref="GeneID:5770871"
FT                   /translation="MRIQTKKLMLAATAAAFLLGSTAPVFAQTDASAPAAQDAKAAKQE
FT                   ARKAARAKRKAERKAARTKNTAELKKLEDAGYKPAANDPNYPQNLQNAEKKAAGSGQ"
FT                   /protein_id="YP_001585286.1"
FT   sig_peptide     15..98
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT                   /locus_tag="Bmul_5324"
FT                   /product="hypothetical protein"
FT   gene            complement(492..1397)
FT                   /db_xref="GeneID:5770553"
FT                   /locus_tag="Bmul_5325"
FT   CDS_pept        complement(492..1397)
FT                   /locus_tag="Bmul_5325"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5998 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:161522358"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5770553"
FT                   /translation="MARRLPPLNSLCAFEAAARLGSFTLAADERCVTHGAISRHVQQLE
FT                   TWLGKPLFERLNLRVVLTDAGRAYLAEVGASFDRIALATAQQFGQAQQRVLRVNAPATF
FT                   SLRWLVPKLSSFQVAHPTIEVRLSTSNEPIDKLRDSADLIIRGGPQTIDGYVADEFLSE
FT                   VRLPVCAPKLLERTPLRTPADLANFTLLHAATYPGMWPEWLAAAGCPNLVPRHALTLEH
FT                   FYLTLQGALDGLGVAMGPIALVADDIAEGRLVQPFSGPALPAWRYFIYVPATRIDDEAV
FT                   RAFRDWLKLAGCAENSNGLR"
FT                   /protein_id="YP_001585287.1"
FT   misc_feature    complement(534..1397)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:182990"
FT                   /locus_tag="Bmul_5325"
FT   misc_feature    complement(1197..1376)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5325"
FT   misc_feature    complement(534..1115)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5325"
FT   misc_feature    complement(order(1011..1031,1035..1088,1092..1115))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5325"
FT   misc_feature    complement(order(669..671,729..737,1086..1088,1092..1097))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5325"
FT   gene            1541..2839
FT                   /db_xref="GeneID:5770554"
FT                   /locus_tag="Bmul_5326"
FT   CDS_pept        1541..2839
FT                   /locus_tag="Bmul_5326"
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   bur:Bcep18194_C6526 adenylosuccinate synthase"
FT                   /db_xref="GI:161522359"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="GeneID:5770554"
FT                   /translation="MANVVVVGAQWGDEGKGRIVDWLAARADVVARYNGGHNAGHTLVV
FT                   GGKTYKLALLPSGIVRGKRGVIGNGVVLDPEALLAEIGRMAELGLQVTPDNLSIAENAT
FT                   LVLPIHRALDEAQERLRREPIGTTLRGIGPAYEDKVGRRGLRVGDLAEPGRLADKLEAL
FT                   VDYHNAWFRGLGLEVCSRDAMFDRLMDIAPKILPFVRPVWADLNDATDRGEHILFEGSQ
FT                   AVMLDIDWGTYPFVTSSATVASAAAAGTGLGASKLGHVLGVTKAYATRVGGGPFLTELT
FT                   DATGEALRTRGQEFGVNTGRPRRCGWLDAAQLRQPVRVSGIDSLALTKLDVLDGFDSIE
FT                   LCVGYELDGARVEHLPASLEAQARARPVYERFDGWQRSVKGVRERAALPHAAQAFIARV
FT                   EAVAGVPVSMITTGAERDDTIVLRDPFDPAPRV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585288.1"
FT   misc_feature    1541..2821
FT                   /note="adenylosuccinate synthetase; Provisional; Region:
FT                   PRK01117"
FT                   /db_xref="CDD:179227"
FT                   /locus_tag="Bmul_5326"
FT   misc_feature    1547..2782
FT                   /note="Adenylosuccinate synthetase (AdSS) catalyzes the
FT                   first step in the de novo biosynthesis of AMP. IMP and
FT                   L-aspartate are conjugated in a two-step reaction
FT                   accompanied by the hydrolysis of GTP to GDP in the presence
FT                   of Mg2+. In the first step, the r-...; Region: AdSS;
FT                   cd03108"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bmul_5326"
FT   misc_feature    order(1577..1579,1583..1591,1658..1666,1670..1672,
FT                   2525..2527,2531..2533,2777..2782)
FT                   /note="GDP-binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bmul_5326"
FT   misc_feature    order(1583..1585,1592..1594,1661..1663)
FT                   /note="ACT binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bmul_5326"
FT   misc_feature    order(1652..1654,1913..1915,1922..1924,2204..2206,
FT                   2249..2251)
FT                   /note="IMP binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bmul_5326"
FT   gene            3098..4051
FT                   /db_xref="GeneID:5770555"
FT                   /locus_tag="Bmul_5327"
FT   CDS_pept        3098..4051
FT                   /locus_tag="Bmul_5327"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5996 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:161522360"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5770555"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILAYIDEAEAEAADAQAKPSGRLHVHATTSFGQ
FT                   AYVVPAVVRYRQRYPSVAVELTLSQHVPDIIDEGYDVSLQLSTAELPDSGLVSQRLGEM
FT                   HSVLCASPAYLKERGTPRTVSDLEGHACLQIVTPIFPRDRWHLDGPNGRETFELPLPDF
FT                   QVNIADALGAGLRAGLGIGALPMSTALPAFASGALVRVLPEYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLAADEAALCAAQDARANA"
FT                   /protein_id="YP_001585289.1"
FT   misc_feature    3098..3979
FT                   /note="transcriptional regulator; Provisional; Region:
FT                   PRK10632"
FT                   /db_xref="CDD:182601"
FT                   /locus_tag="Bmul_5327"
FT   misc_feature    3107..3286
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5327"
FT   misc_feature    3371..3973
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5327"
FT   misc_feature    order(3401..3403,3413..3415,3530..3532,3578..3580,
FT                   3584..3586,3776..3778,3827..3829,3908..3910)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5327"
FT   misc_feature    order(3404..3409,3419..3424,3428..3433,3440..3442,
FT                   3452..3454,3458..3478,3665..3667,3758..3772,3791..3796,
FT                   3803..3805)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5327"
FT   gene            complement(4288..5001)
FT                   /db_xref="GeneID:5770655"
FT                   /locus_tag="Bmul_5328"
FT   CDS_pept        complement(4288..5001)
FT                   /locus_tag="Bmul_5328"
FT                   /gene_family="HOG000157121" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bam:Bamb_5994
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="GI:161522361"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="GeneID:5770655"
FT                   /translation="MSQTSGSMITFRRPDGQELQGYLATPEKTDGAPAVVVIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVQYLK
FT                   TRAERVAVTGFCMGGALTLLSLQFADADAGVTWYGFPPLDYLDPSKIKVPVMGHWGTQD
FT                   AFFTIDQVDALEKKLTDAKVDIEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSQFAWD
FT                   RTLTFFGRTLWQKAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585290.1"
FT   misc_feature    complement(4312..4941)
FT                   /note="Dienelactone hydrolase family; Region: DLH;
FT                   pfam01738"
FT                   /db_xref="CDD:145081"
FT                   /locus_tag="Bmul_5328"
FT   gene            complement(5345..5656)
FT                   /db_xref="GeneID:5770656"
FT                   /locus_tag="Bmul_5329"
FT   CDS_pept        complement(5345..5656)
FT                   /locus_tag="Bmul_5329"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6611 hypothetical protein"
FT                   /db_xref="GI:161522362"
FT                   /db_xref="GeneID:5770656"
FT                   /translation="MKSFIYAAVAAAALSASYGAFAQSNPSGQLTREQVRAELVQLEQA
FT                   GYKPEVSDTQYPRALQTAQERVTNADATGYGAQAAPRIHAGRVAAARQDGRDSIYFGQ"
FT                   /protein_id="YP_001585291.1"
FT   sig_peptide     complement(5588..5656)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 23"
FT                   /locus_tag="Bmul_5329"
FT                   /product="hypothetical protein"
FT   gene            complement(6096..7073)
FT                   /db_xref="GeneID:5770657"
FT                   /locus_tag="Bmul_5330"
FT   CDS_pept        complement(6096..7073)
FT                   /locus_tag="Bmul_5330"
FT                   /gene_family="HOG000063189" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_C6612 transcriptional regulator, AraC family"
FT                   /db_xref="GI:161522363"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:5770657"
FT                   /translation="MPSFMPKVVGVFAVPGVQLLDVSAPLDVFAQANVECGKAFYTLRV
FT                   IACESGPIRSSSGAQLLADWVAPNVPERIDTLLVAGAPGAGRIALRTDVLAWLRSAAVQ
FT                   SRRYGSICTGAFVLAETGLLKGRYLTTHWAAAEALAEAHPTITVDADALYVRDGKLRTG
FT                   AGVTAGLDLALALVEEDLGRDIARRVASQLVMFFKRPGGQLQFSRKGEARPAGRSVLQE
FT                   VQRWIAAHPELTHSVADLAKHAGMSPRHFARLFRAEVGMTPAAWVEATRIAAARQLLEN
FT                   GRDTPKQVAAKCGFANVDTLRRSFAKHVGITPAEYRKRQAIVTE"
FT                   /protein_id="YP_001585292.1"
FT   misc_feature    complement(6111..7073)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="Bmul_5330"
FT   misc_feature    complement(6486..7049)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_1; cd03137"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="Bmul_5330"
FT   misc_feature    complement(6738..6740)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="Bmul_5330"
FT   misc_feature    complement(6276..>6368)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bmul_5330"
FT   misc_feature    complement(6120..>6215)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bmul_5330"
FT   gene            7274..7843
FT                   /db_xref="GeneID:5770658"
FT                   /locus_tag="Bmul_5331"
FT   CDS_pept        7274..7843
FT                   /locus_tag="Bmul_5331"
FT                   /gene_family="HOG000267517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: bam:Bamb_5991 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="GI:161522364"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:5770658"
FT                   /translation="MTVNVAGITIPDSQLAREITELVRDTESPLLFHHSSRVYYFAALA
FT                   GRRQALKYDPELLYCACMFHDMGLTHRHSSACERFEVDGANAARDFLKSKGIAQQDIDL
FT                   VWTSIALHTTPGIPQHMHPVIALVTAGVEMDVLGLAYSEFTDIEREAVVHAHPRTPHFK
FT                   EDIIQAFYDGIKHKPHTTFGNVKADV"
FT                   /protein_id="YP_001585293.1"
FT   misc_feature    7277..7747
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:185790"
FT                   /locus_tag="Bmul_5331"
FT   gene            8367..8822
FT                   /db_xref="GeneID:5770896"
FT                   /locus_tag="Bmul_5332"
FT   CDS_pept        8367..8822
FT                   /locus_tag="Bmul_5332"
FT                   /gene_family="HOG000267528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bch:Bcen2424_6212 hypothetical protein"
FT                   /db_xref="GI:161522365"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="GeneID:5770896"
FT                   /translation="MSTIAFHPSGVAHPRQAEFTILEQLLAIPVRSGADLAELASARVD
FT                   VSVIDRLSERGLKSDELAFIIPRRTLSHRRQAHERLSPEESDKAIRLARIVAQATATFG
FT                   DQDKAMAWLRRGLQRFGGRTSLDMASTEHGARLVEEALTQIDEGYFA"
FT                   /protein_id="YP_001585294.1"
FT   misc_feature    8436..8819
FT                   /note="putative toxin-antitoxin system antitoxin component,
FT                   TIGR02293 family; Region: TAS_TIGR02293"
FT                   /db_xref="CDD:131346"
FT                   /locus_tag="Bmul_5332"
FT   misc_feature    8652..8810
FT                   /note="Protein of unknown function (DUF2384); Region:
FT                   DUF2384; pfam09722"
FT                   /db_xref="CDD:150402"
FT                   /locus_tag="Bmul_5332"
FT   gene            8819..9295
FT                   /db_xref="GeneID:5770897"
FT                   /locus_tag="Bmul_5333"
FT   CDS_pept        8819..9295
FT                   /locus_tag="Bmul_5333"
FT                   /gene_family="HOG000267539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RES domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RES domain protein; KEGG: bch:Bcen2424_6213
FT                   hypothetical protein"
FT                   /db_xref="GI:161522366"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="GeneID:5770897"
FT                   /translation="MTTLWRISNYADLRGIGGLRAGGRWHFAGQPVVYLAEHPALALLE
FT                   TLVHFEIATVAQLPSGYQLLRVEAAESVDIAEIVEADAPADWQTNVDWTRSAGTEWLHT
FT                   RPTALLRVPSVVVPHAHNFLLNPLHPAAADVRIVEIMQSPYDSRILRLIQSKPE"
FT                   /protein_id="YP_001585295.1"
FT   misc_feature    8825..9256
FT                   /note="RES domain; Region: RES; cl02411"
FT                   /db_xref="CDD:154895"
FT                   /locus_tag="Bmul_5333"
FT   gene            complement(9329..10270)
FT                   /db_xref="GeneID:5770898"
FT                   /locus_tag="Bmul_5334"
FT   CDS_pept        complement(9329..10270)
FT                   /locus_tag="Bmul_5334"
FT                   /gene_family="HOG000267540" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bur:Bcep18194_C6618 phage integrase"
FT                   /db_xref="GI:161522367"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="GeneID:5770898"
FT                   /translation="MDTSRWIDDPVGAFRAWQQTSATGARRQPFAPRSIVQHVAMFERF
FT                   LRHLHAQRASLATFGPDHVATFLTELERSCAPGTSTRVRYAKLIDRLSRHLVEAGVRRV
FT                   HPAARAAHALAWPDTEPEPCYLPPDADAALQRHVQPRADDTPAACRNRAIVALLLATGI
FT                   TSAEIRATTRDALTLDERRPMLTVPRERARPARRIELAAFAVAPLAAWLAACASDSDAL
FT                   ARLFPAPRDGGPMNDMFLLLVVRDALAAIGFEASDMSPRVLRNTFARRQLLAGHTHADV
FT                   SAMLGLVSTRTVTRIRQTLPPNAAADRAAHER"
FT                   /protein_id="YP_001585296.1"
FT   misc_feature    complement(9386..9850)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5334"
FT   misc_feature    complement(order(9410..9412,9479..9481,9488..9490,
FT                   9698..9700,9779..9781))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5334"
FT   misc_feature    complement(order(9410..9412,9479..9481,9488..9490,
FT                   9779..9781))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5334"
FT   misc_feature    complement(order(9488..9496,9698..9700,9776..9781))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5334"
FT   gene            10475..12457
FT                   /db_xref="GeneID:5770899"
FT                   /locus_tag="Bmul_5335"
FT   CDS_pept        10475..12457
FT                   /locus_tag="Bmul_5335"
FT                   /gene_family="HOG000175619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bur:Bcep18194_C6623 gamma-glutamyltransferase"
FT                   /db_xref="GI:161522368"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:5770899"
FT                   /translation="MNRTAIFPYASALLAAVLMTACGGDVENEAARSSTTADTSCLALD
FT                   NSGATVVVGSNQPGDPSLPEASSGYRTGMKPVYAKRYLVATSNAYASAAGCAVLKKGGT
FT                   AADAAVAVQAVLGLTVPEATGLGSGGVLLYYDARNKTLQAYDGRETAPAAATENYLRYV
FT                   DDQSDRSPPQPNARASGRSIGTIGVPRLIEALQQDHGRLAWKDLFGDAIALATNGFPVG
FT                   GRLADAIAANAANLKRDPDAAAYFLNADGSPKTLGTVLKNPAYADTLTALAQSGAKALY
FT                   TGPIAQDIVAKIATAKGADGSTITPGKTTLADLAAYEAKRREPVCTTYRSYWVCGMPPP
FT                   SSGGIAVASALGILENFDLKSLKPTAIDLEGGKPTVAGVHLVSEAERLAYADRDKYVAD
FT                   TDFVPLPGGTWDTLLNKPYLKSRAALIDPGKSMGTAQPGDLGAVPLGVDTTLVEHGTNQ
FT                   FTIVDGDGNVLSATTTVESSMGSFHMTHGFLLNNQLTDFSANPLDSAGNPVANRLQPGK
FT                   RPRSSMAPAIVFAKAADGSRGDFVMATGSPGGGTIPQYVVKTLVGALDWGLDAQQSAGL
FT                   VDFGASNSPTTTIGGEHPNVNTSNSGANDPLIAGLLALGHKVSTSAQASGVNTVMRVTL
FT                   GQTPALQGGTDPRREGVVLGDTIRP"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585297.1"
FT   sig_peptide     10475..10546
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.498 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5335"
FT                   /product="hypothetical protein"
FT   misc_feature    10700..12442
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:186741"
FT                   /locus_tag="Bmul_5335"
FT   misc_feature    10766..12427
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="Bmul_5335"
FT   gene            12825..13355
FT                   /db_xref="GeneID:5770999"
FT                   /locus_tag="Bmul_5336"
FT   CDS_pept        12825..13355
FT                   /locus_tag="Bmul_5336"
FT                   /gene_family="HOG000257935" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6625 hypothetical protein"
FT                   /db_xref="GI:161522369"
FT                   /db_xref="GeneID:5770999"
FT                   /translation="MNKIRTILLGAALSAVATSAAFAQTAQTGADGSVGVGAQVQTPLL
FT                   SGGVGAQGGAGANAAGSGNVIGGALSGVGKTVDGVGSAAGNAVGGATHAVGTAAGSAKD
FT                   AAASAVHSTKGHVKHAAASAKTHAQGAMTTAGDVAGGVKAKAGEALAGTTNAAQGGASV
FT                   GLKGSVSAQGAAQ"
FT                   /protein_id="YP_001585298.1"
FT   sig_peptide     12825..12896
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5336"
FT                   /product="hypothetical protein"
FT   gene            13650..14900
FT                   /db_xref="GeneID:5771000"
FT                   /locus_tag="Bmul_5337"
FT   CDS_pept        13650..14900
FT                   /locus_tag="Bmul_5337"
FT                   /gene_family="HOG000061512" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bam:Bamb_5979
FT                   metallophosphoesterase"
FT                   /db_xref="GI:161522370"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:5771000"
FT                   /translation="MKFIHAADIHLDSPLHGLSAYPDAPAAQLRSASRDALRQLVDRAI
FT                   DEEVAFLVIAGDLYDGDWKDHNTGIFFGQQMGRLRKAGIRAFVLWGNHDAESEMTKKLT
FT                   LPDNVTVFHHRKPETHRLPEFEVALHGQSFKDKAVVDNLATGYPDPVPGYYNIGVLHTA
FT                   LEGYAAHANYAPCTLAELHAKGYDYWALGHVHEFQQWTGPSTIVFPGNLQGRHIRETGR
FT                   RGAVLVTVEQGRTQVERLYLDVLRWESLAVDASDCVSVADLSRKIGQSLETLLSVDAHV
FT                   PRAVRVTVTGRTPAHGLFFGRATQLRAEVLNQIGIIGNERLWLEKVRLATSAPEHPYGA
FT                   GEPLEALDDLKQILADAAHDPDFLALLERDLKPFLGKVRSDVKEDVPLLALAREGDLTA
FT                   LVRQVGPALLARLARGE"
FT                   /protein_id="YP_001585299.1"
FT   misc_feature    13650..14240
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="Bmul_5337"
FT   misc_feature    13653..14303
FT                   /note="Mre11 nuclease, N-terminal metallophosphatase
FT                   domain; Region: MPP_Mre11_N; cd00840"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bmul_5337"
FT   misc_feature    order(13671..13673,13677..13679,13818..13820,13923..13928,
FT                   14130..14132,14226..14234)
FT                   /note="active site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bmul_5337"
FT   misc_feature    order(13671..13673,13677..13679,13818..13820,13923..13925,
FT                   14130..14132,14226..14228,14232..14234)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bmul_5337"
FT   misc_feature    order(13683..13703,13827..13829,13932..13934,13938..13943,
FT                   14052..14057)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bmul_5337"
FT   gene            14904..18374
FT                   /db_xref="GeneID:5771001"
FT                   /locus_tag="Bmul_5338"
FT   CDS_pept        14904..18374
FT                   /locus_tag="Bmul_5338"
FT                   /gene_family="HOG000267580" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6222 hypothetical protein"
FT                   /db_xref="GI:161522371"
FT                   /db_xref="GeneID:5771001"
FT                   /translation="MRIGQLDLIRYGKFTDETLRFPAATQDFHVIVGPNEAGKSTIRTA
FT                   VTELLFGMKLQTPLDFLHGTPDLRIGGVLESGGATLAFHRARGRSSLRTPDDDKLPDDY
FT                   LAAVLDGATREFFEQMFGLDHGRLLDGGRSILDASDKLGQVLFESAAGVGRLGSVRDEL
FT                   DARAADLWAPRRSGSAFAVAETAFNEAVAELKAVQVRTRDWVDRKEAREAVEHEIALAR
FT                   TELRRLESLRSKYERVRRLAPYLKELALNEAALAELGDVVDLPPSAGAELLKAQGDLAA
FT                   EQKVLEARRADLLAKRQARDAIDGDTDALARAADIETLERLRATCAHHAQDLLLLGAEV
FT                   ERHLSAAFDAAAQLGWPSDESALRAALPSALALKTVESLLREHGALHQALVGARDSLDE
FT                   RMREADQVREQLASVSTVDVPEALRAALVDARGLRNIGQREHALEGEIASAERVLAGAL
FT                   DALGPWRQPVDALRALDVPSAARVGALLKAESERMSAVAAARDARDAAQEELERLALQE
FT                   RHFAENHPVVTTAEVLAARARRDRAWSDVRSGAVDLAAGAPAVDNAIRVADQLVDAQLG
FT                   ATQAAATLQSLRQQVETARAGVARRQAVLDDRERDLAAHRDAWAACAAAAGVPGMPLDA
FT                   MTDWLARRDAVFAAQSDVERLRNERDTLRDTRTRAESALRAALRVVSRGDDAQGLDTLV
FT                   ATAETFVQSAEKASARKESLDERAREAERGCATARSRVDQAQSAYDAWQQQWRDALADA
FT                   RLAASATSLAAAEGALALANTVTAELAAADAPRNRIATIRAELAALEAGARRLAEALAP
FT                   EWLTIGDWLEVARRLSARLSAAMETARAIERADEAIRQADDKVADAAAAVAGAEARVYP
FT                   LLQLAGVATIDEALRLAERSDRRRALRQAVDAAQQQLTRDGDGLSRAALEAEVAEYDIA
FT                   DVPAHLEAVKQSIEDVGKRLNALAQQQVVAEQAFGAIDGQANAALAEAKRQEALAAMGD
FT                   AAEQYLEAATASRLLKWATDRYRDQKQGPMLRRAGEIFAGLTLGEFARLTVDTERTPPA
FT                   LYARRTSGTSVEVAGLSEGTRDQLFLALRIAALELQLGSRTALPFVADDLFINFDDTRA
FT                   KAGFEALRDLSTRTQVLFLTHHDHLLPLIADVFGAQVNVIELQRQSAAA"
FT                   /protein_id="YP_001585300.1"
FT   misc_feature    14904..>15509
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4717"
FT                   /db_xref="CDD:34333"
FT                   /locus_tag="Bmul_5338"
FT   misc_feature    <17517..18299
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4717"
FT                   /db_xref="CDD:34333"
FT                   /locus_tag="Bmul_5338"
FT   gene            18491..19015
FT                   /db_xref="GeneID:5771002"
FT                   /locus_tag="Bmul_5339"
FT   CDS_pept        18491..19015
FT                   /locus_tag="Bmul_5339"
FT                   /gene_family="HOG000265510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: bam:Bamb_5977 metal dependent phosphohydrolase"
FT                   /db_xref="GI:161522372"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:5771002"
FT                   /translation="MNKLIAAIAFAADRHRNQRRKDEEASPYINHPIALADVLANEVGI
FT                   EDERVIAAAVLHDTIEDTETTEQELLRLFGKDVADIVVEVTDDKSLPKETRKRLQVEHA
FT                   AHISRRAKLVKLADKICNLRDLARHPPADWPLERKQAYFDWAKSVVDRMRGVHPGLEAI
FT                   FDAAYAARPSE"
FT                   /protein_id="YP_001585301.1"
FT   misc_feature    18497..>18916
FT                   /note="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases [Signal transduction
FT                   mechanisms / Transcription]; Region: SpoT; COG0317"
FT                   /db_xref="CDD:30665"
FT                   /locus_tag="Bmul_5339"
FT   gene            19025..19729
FT                   /db_xref="GeneID:5770264"
FT                   /locus_tag="Bmul_5340"
FT   CDS_pept        19025..19729
FT                   /locus_tag="Bmul_5340"
FT                   /gene_family="HOG000267591" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5976 hypothetical protein"
FT                   /db_xref="GI:161522373"
FT                   /db_xref="GeneID:5770264"
FT                   /translation="MRDDRSTGRARGGRDEASSTRAVAGVDVGGDKKQCDLVILRGSTV
FT                   VCHEARISPEALLPLCLEHDVVAVGVDAPSQWWAGNGRRPVEQALARERISCFPTPTRE
FT                   QAISSASGFFDWMFVGERVYRALASAYPLLVDAHYGGGRVSFETYPYAITCALLGKATA
FT                   SAKQKRIQRRQLLERLGIDVATLRTVDARDAALCAVTARFVIEGSAHAYGDAQGGHIRV
FT                   PLVAGPIVLDPS"
FT                   /protein_id="YP_001585302.1"
FT   misc_feature    19097..19678
FT                   /note="Protein of unknown function (DUF429); Region:
FT                   DUF429; cl12046"
FT                   /db_xref="CDD:159706"
FT                   /locus_tag="Bmul_5340"
FT   gene            complement(19901..20404)
FT                   /db_xref="GeneID:5770265"
FT                   /locus_tag="Bmul_5341"
FT   CDS_pept        complement(19901..20404)
FT                   /locus_tag="Bmul_5341"
FT                   /gene_family="HOG000267602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6225 hypothetical protein"
FT                   /db_xref="GI:161522374"
FT                   /db_xref="GeneID:5770265"
FT                   /translation="MSNRLPRAVEYHAAIAYLLTMMMDSFTQSGEADLRAEFAALRERA
FT                   ATLEEQVPPLLQRISDVLPRISGETELADEHRERLVGARNAAMVSIENYQQAIPFVQTA
FT                   DSIIEQLDKTPERDEDAEWREALLQRLDELIDVAIVMIDDADNYFEQARACDLASVPSS
FT                   ILED"
FT                   /protein_id="YP_001585303.1"
FT   gene            20986..22511
FT                   /db_xref="GeneID:5770266"
FT                   /locus_tag="Bmul_R0079"
FT   rRNA            20986..22511
FT                   /db_xref="GeneID:5770266"
FT                   /locus_tag="Bmul_R0079"
FT                   /product="16S ribosomal RNA"
FT   gene            22573..22649
FT                   /note="tRNA-Ile5"
FT                   /db_xref="GeneID:5770267"
FT                   /locus_tag="Bmul_R0080"
FT   tRNA            22573..22649
FT                   /db_xref="GeneID:5770267"
FT                   /locus_tag="Bmul_R0080"
FT                   /product="tRNA-Ile"
FT   gene            22741..22816
FT                   /note="tRNA-Ala7"
FT                   /db_xref="GeneID:5770839"
FT                   /locus_tag="Bmul_R0081"
FT   tRNA            22741..22816
FT                   /db_xref="GeneID:5770839"
FT                   /locus_tag="Bmul_R0081"
FT                   /product="tRNA-Ala"
FT   gene            23167..26047
FT                   /db_xref="GeneID:5770840"
FT                   /locus_tag="Bmul_R0082"
FT   rRNA            23167..26047
FT                   /db_xref="GeneID:5770840"
FT                   /locus_tag="Bmul_R0082"
FT                   /product="23S ribosomal RNA"
FT   gene            26185..26273
FT                   /db_xref="GeneID:5771042"
FT                   /locus_tag="Bmul_R0083"
FT   rRNA            26185..26273
FT                   /db_xref="GeneID:5771042"
FT                   /locus_tag="Bmul_R0083"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(26558..26683)
FT                   /db_xref="GeneID:5771043"
FT                   /locus_tag="Bmul_5342"
FT   CDS_pept        complement(26558..26683)
FT                   /locus_tag="Bmul_5342"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6642 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="GI:161522375"
FT                   /db_xref="GeneID:5771043"
FT                   /translation="MTTLACLSKAHCRYPREWLDLSEADLKITPETIDESTGYVA"
FT                   /protein_id="YP_001585304.1"
FT   gene            complement(26759..27376)
FT                   /db_xref="GeneID:5770613"
FT                   /locus_tag="Bmul_5343"
FT   CDS_pept        complement(26759..27376)
FT                   /locus_tag="Bmul_5343"
FT                   /gene_family="HOG000267624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6644 hypothetical protein"
FT                   /db_xref="GI:161522376"
FT                   /db_xref="GeneID:5770613"
FT                   /translation="MMMVDQGVASVLGVVGSAVSLVAAVPYALAIYRRTVRPHLFTWLI
FT                   WSVVTVIAAAGQFVAGAGPSAWCTAAIAVTCVLTFVASIFRGERGWTRADWVFLCAALS
FT                   AIPLWMLTDDPTLSICVVTLIELAGLGPTVRKTIRDPWSESLTYFALCIVKYALAVLAL
FT                   RSWSVAVAFYPVVNVLASIGICVVMVEGRHRLRSKTKVERGS"
FT                   /protein_id="YP_001585305.1"
FT   sig_peptide     complement(27305..27376)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.696 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5343"
FT                   /product="hypothetical protein"
FT   gene            complement(27555..28559)
FT                   /db_xref="GeneID:5770614"
FT                   /locus_tag="Bmul_5344"
FT   CDS_pept        complement(27555..28559)
FT                   /locus_tag="Bmul_5344"
FT                   /gene_family="HOG000217016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_C6649 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="GI:161522377"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:5770614"
FT                   /translation="MGPQMISPGFVEDALACMRRQGLPIAPVLHAAGLPPVVREPVTPQ
FT                   QYGRLWLEIASALDDEFFGLAARPMRRGSFTLLCHAVLNAGTLEKALRRALQFLRVVLD
FT                   EPHGELVVADGLAQIVLVPSDTPYPAFAYRTFWLILLGVACWLIGRRIPLQRIDFACAS
FT                   PEQRSDYHRFFGVPVHFDRPDSRLTFNAAYLSLPTIRSAQALKTFLRGAPGNLLVRYRH
FT                   DTGWVARTRTHLKALPAAEWPDFDTLAARLGTTPPTLRRRLRSEGQSFASIKDELRGAL
FT                   AQSLLREQTLSVAEIAAALGFTEPSAFHRAFRKWTGTSPGAFRRDVNATQAEQ"
FT                   /protein_id="YP_001585306.1"
FT   misc_feature    complement(27576..>27848)
FT                   /note="transcriptional regulator HilD; Provisional; Region:
FT                   PRK15185"
FT                   /db_xref="CDD:185107"
FT                   /locus_tag="Bmul_5344"
FT   misc_feature    complement(27585..27689)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bmul_5344"
FT   gene            28706..30373
FT                   /db_xref="GeneID:5770615"
FT                   /locus_tag="Bmul_5345"
FT   CDS_pept        28706..30373
FT                   /locus_tag="Bmul_5345"
FT                   /gene_family="HOG000229982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_C6650 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:161522378"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:5770615"
FT                   /translation="MPDGATARAVPAYADAVARFRIDTVAAQLHGDLEHGLNACVECCD
FT                   RHASGDAVALDWIDIDGAHHRFTFAQMKALAARVANLLVERGVKPGDVVAGLLPRTPEL
FT                   VATILGTWRAGAVYQPLFTAFGPKAIEHRLRMSDARLVVTNVANRAKLDEVADCPPVAT
FT                   VRAAEAPLPDGDIDFRAALDAQSDTFEPVLRKGTDLFMMMSTSGTTGLPKGVPVPLRAL
FT                   LAFRQYMCDAVDLRAEDRFWNIADPGWAYGLYYAITGPLLVGHATTLYEGGFTVDSTYD
FT                   VIERLGITSLAGSPTAYRMLMAAGSDAAARIKGKLRVVSSAGEPLNPEVVRWFDAALGA
FT                   PIYDHYGQTELGMVVNNHHGLAHVVHPGSAGFAMPGYRVAVLDDAGRELGPGEPGTLAI
FT                   DIARSPLLWFDGYWRQDTPAIAGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGP
FT                   FDVESALIEHEAVSEAAVIGVPDPERTEIVKAFVVLSNGYEGTPALAEALSLHVKRRLS
FT                   AHAYPRAIEFVDALPKTPSGKIQRFVLRKMEADKAAQP"
FT                   /protein_id="YP_001585307.1"
FT   misc_feature    28814..30361
FT                   /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
FT                   [Lipid metabolism]; Region: Acs; COG0365"
FT                   /db_xref="CDD:30714"
FT                   /locus_tag="Bmul_5345"
FT   misc_feature    28883..30355
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Bmul_5345"
FT   gene            30397..31164
FT                   /db_xref="GeneID:5771080"
FT                   /locus_tag="Bmul_5346"
FT   CDS_pept        30397..31164
FT                   /locus_tag="Bmul_5346"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_C6651 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522379"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5771080"
FT                   /translation="MKIKDRVFLITGAGSGLGAAVARMVVAEGGKAMLLDVNGDALASV
FT                   AHELGAAARLLKTDVTSEADGQAAIAAARDAFGRIDGLVNCAGVAPGEKVVGRDGPHSL
FT                   ERFTRAVSINLVGTFNMIRLAAEAMSKQDADAEGERGVIVNTASVAAFDGQIGQAAYAA
FT                   SKGGVVGMTLPIARELARFGIRVVTIAPGIFATPMMAAMPQEVQDALGKSVPFPPRLGR
FT                   PEEFAALVRHIAENTMLNGEVIRLDGALRMAPR"
FT                   /protein_id="YP_001585308.1"
FT   misc_feature    30397..31152
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5346"
FT   misc_feature    30397..31152
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Bmul_5346"
FT   sig_peptide     30397..30480
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.913 at
FT                   residue 28"
FT                   /locus_tag="Bmul_5346"
FT                   /product="hypothetical protein"
FT   gene            31183..32373
FT                   /db_xref="GeneID:5771081"
FT                   /locus_tag="Bmul_5347"
FT   CDS_pept        31183..32373
FT                   /locus_tag="Bmul_5347"
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bch:Bcen2424_6232 acetyl-CoA
FT                   acetyltransferases; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase"
FT                   /db_xref="GI:161522380"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:5771081"
FT                   /translation="MTTQDPIVIVGAARTPMGGFQGDLAAASASDLGAVAIRAALERAN
FT                   VPAERIDEIVFGCVLPAGQGQAPARQAALKAGLPLSAGATTVNKMCGSGMKAAMFAHDL
FT                   LYADSANVAVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGT
FT                   FAEDCAQAYQFTREAQDAFAIASLTRAQRAIAEGRFAAEIAPVTVKAGKTETVVSIDEQ
FT                   PGKAKLDKIPTLKPAFREGGTVTAANASSISDGAAALVMMRRSEAQRLGLTPKAVIVGH
FT                   ATFANKPNLFATAPIGAIRTLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHDKV
FT                   NVHGGACALGHPIGASGARVMVTLLAALESYGLKRGVASLCIGGGEATAIAIERVA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585309.1"
FT   misc_feature    31186..32361
FT                   /note="acetyl-CoA acetyltransferase; Provisional; Region:
FT                   PRK06954"
FT                   /db_xref="CDD:180775"
FT                   /locus_tag="Bmul_5347"
FT   misc_feature    31204..32364
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5347"
FT   misc_feature    order(31258..31260,31339..31341,31381..31383,31390..31392,
FT                   31402..31404,31435..31446,31468..31470,31489..31494,
FT                   31501..31503,31546..31548,32023..32025,32029..32031,
FT                   32035..32037,32095..32097,32332..32337)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5347"
FT   misc_feature    order(31453..31455,32233..32235,32323..32325)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5347"
FT   gene            complement(32483..33175)
FT                   /db_xref="GeneID:5771082"
FT                   /locus_tag="Bmul_5348"
FT   CDS_pept        complement(32483..33175)
FT                   /locus_tag="Bmul_5348"
FT                   /gene_family="HOG000267645" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional regulator YcdC domain protein; KEGG:
FT                   bur:Bcep18194_C6653 transcriptional regulator, TetR family"
FT                   /db_xref="GI:161522381"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="GeneID:5771082"
FT                   /translation="MRHDDASAAVTESDPAHTPLRRRKAHIRESNEAHLLACAEAVFAE
FT                   RGLDGASTAMIAERAGLPKANLHYYFPTKLALYRRVLDDLFEDWHRAAGSFEAGDDPVE
FT                   AIGNYVRAKMALSRRRPLGSKVWANEIIHGAEHMEDILSDRVKPWFDTRVKVIDGWIAR
FT                   GLLAPIDARALMYLIWATTQHYADFDAQIRALSGKRALTQKAFDEKTEQVVQLVLRACG
FT                   AVSPKAPR"
FT                   /protein_id="YP_001585310.1"
FT   misc_feature    complement(32522..33109)
FT                   /note="pyrimidine utilization regulatory protein R; Region:
FT                   RutR; TIGR03613"
FT                   /db_xref="CDD:132652"
FT                   /locus_tag="Bmul_5348"
FT   misc_feature    complement(32933..33073)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Bmul_5348"
FT   misc_feature    complement(32507..32932)
FT                   /note="YcdC-like protein, C-terminal region; Region:
FT                   TetR_C_3; pfam08362"
FT                   /db_xref="CDD:116943"
FT                   /locus_tag="Bmul_5348"
FT   gene            33540..34820
FT                   /db_xref="GeneID:5770643"
FT                   /locus_tag="Bmul_5349"
FT   CDS_pept        33540..34820
FT                   /locus_tag="Bmul_5349"
FT                   /gene_family="HOG000241290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="allantoate amidohydrolase"
FT                   /EC_number="3.5.1.87"
FT                   /note="allantoate amidohydrolase and N-carbamoyl-L-amino
FT                   acid amidohydrolase are very similar; the allantoate
FT                   amidohydrolase from Escherichia coli forms a dimer and
FT                   binds zinc ions for catalytic activity and catalyzes the
FT                   conversion of allantoate to (S)-ureidoglycolate and
FT                   ammonia; carbamoyl amidohydrolase from Bacillus sp.
FT                   converts N-carbamoyl amino acids to amino acids, ammonia,
FT                   and carbon dioxide"
FT                   /db_xref="GI:161522382"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:5770643"
FT                   /translation="MNAVSEALKRTAIDPSIKVDGKRLWNSLMEMAKIGATPKGGVCRL
FT                   ALTDLDKAGRDLIVRWAKEAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGG
FT                   RFDGIYGVLGGLEVIRSLNDHGIETEHPIEVVIWTNEEGSRFAPAMVASGVFAGVFTLE
FT                   YGLSRKDVDGKTIGEELQRIGYAGDVPCGGRPLHAAFELHIEQGPILEAERKTIGVVTD
FT                   AQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPFGCATVGMMQ
FT                   VHPNSRNVIPGRVFFTVDFRHPDDAVLAQMDAALRDGVARIAADIGLETALEQIFYYKP
FT                   VAFDPACVQAVREAAERFGYPHRDIVSGAGHDACYLAQVAPTSMVFVPCVDGISHNEVE
FT                   DATPEWIEAGANVLLHAMLSRACEPVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585311.1"
FT   misc_feature    33588..34811
FT                   /note="allantoate amidohydrolase; Reviewed; Region:
FT                   PRK09290"
FT                   /db_xref="CDD:181761"
FT                   /locus_tag="Bmul_5349"
FT   misc_feature    33603..34700
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:186834"
FT                   /locus_tag="Bmul_5349"
FT   gene            34950..36287
FT                   /db_xref="GeneID:5770644"
FT                   /locus_tag="Bmul_5350"
FT   CDS_pept        34950..36287
FT                   /locus_tag="Bmul_5350"
FT                   /gene_family="HOG000031439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative oxidoreductase"
FT                   /transl_table="11"
FT                   /note="function undetermined; similar to glutamate synthase
FT                   beta subunit and related oxidoreductases which transfer
FT                   electrons from NADPH to an acceptor protein or protein
FT                   domain"
FT                   /db_xref="GI:161522383"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000759"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:5770644"
FT                   /translation="MTTQPTGDIAAHRQSSTQLSCEFADIAPLLDPTAAAAAASRCHYC
FT                   YDAPCVHACPTQIDIPGFIRKIGNGNLKGAAIDILSANPLGGMCARVCPTEILCEGACV
FT                   RNHQDAQPVAIGALQRHATDWAMASGAVRFQRAPDTGYHVAVVGAGPAGLACAHRLALA
FT                   GHRVTLFDARAKAGGLNEYGIAAYKTVDDFAQREVDWLLSVGGIELKTGVALGRDLTLD
FT                   ALREGHDAVFLAIGLGGVRALAVEGEQLAGVMNAVDFIEQVRQADALENVPVGRRVVVI
FT                   GGGNTAVDAAVQSRKLGAERVTIVYRRGVEAMSATWAEREFAQKNGVTLVTHARPVRMF
FT                   GAGGQVTGVEFDTASGERLTIDADMVLKAIGQTLVPDGVAPALLTPDGARIAVDADGRT
FT                   AWPDVWAGGDCAATGGIDLTVQAVQDGKRAAASIDAALAQRSVRAA"
FT                   /protein_id="YP_001585312.1"
FT   misc_feature    34950..36278
FT                   /note="dihydropyrimidine dehydrogenase subunit A;
FT                   Provisional; Region: PRK11749"
FT                   /db_xref="CDD:183296"
FT                   /locus_tag="Bmul_5350"
FT   gene            36346..37653
FT                   /db_xref="GeneID:5770645"
FT                   /locus_tag="Bmul_5351"
FT   CDS_pept        36346..37653
FT                   /locus_tag="Bmul_5351"
FT                   /gene_family="HOG000225106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydropyrimidine dehydrogenase"
FT                   /transl_table="11"
FT                   /note="catalyzes the first step in pyrimidine degradation:
FT                   the NADPH-dependent reduction of uracil and thymine to the
FT                   corresponding 5,6-dihydropyrimidines"
FT                   /db_xref="GI:161522384"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="GeneID:5770645"
FT                   /translation="MADLRCTIAGITSPNPFWLASAPPTDKAYNVNRAFEAGWGGVVWK
FT                   TLGLDPHVVNVSSRYGAVQWNGQRIAGLNNIELITDRPLDVNLREIAQVKRDWPDRALI
FT                   VSLMVPCNERDWKWILPLVEDTGADAVELNFGCPHGMSERGMGAAVGQVPEYVEMVTRW
FT                   VKEGTKLPCLVKLTPNISDIRMGSRAAYKGGADGVSLINTINSIVAVDLDQMAPIPTVD
FT                   GKGTHGGYCGPAVKPIALNMVAEIARDPETPNLPISGIGGISTWRDAAEFIVLGAGSVQ
FT                   VCTAAMHYGFRIVSDLVDGLSNWMDDKGYATLDDVRGRAVPNVTDWKYLNLQYDIKARI
FT                   DQDRCIQCGLCHIACEDTSHQAITREKDGVRHFEVVDADCVGCNLCMHVCPVEQCITME
FT                   RVDAGGYANWTTHPNNPARAEAGAGATPPEKHAKAA"
FT                   /protein_id="YP_001585313.1"
FT   misc_feature    36346..37605
FT                   /note="dihydropyrimidine dehydrogenase subunit B;
FT                   Validated; Region: PRK08318"
FT                   /db_xref="CDD:181383"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    36352..37248
FT                   /note="Dihydropyrimidine dehydrogenase (DHPD) FMN-binding
FT                   domain.  DHPD catalyzes the first step in pyrimidine
FT                   degradation: the NADPH-dependent reduction of uracil and
FT                   thymine to the corresponding 5,6-dihydropyrimidines. DHPD
FT                   contains two FAD, two FMN, and...; Region: DHPD_FMN;
FT                   cd02940"
FT                   /db_xref="CDD:73382"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    order(36412..36417,36427..36435,36439..36444,36502..36510,
FT                   36514..36531,36571..36573,36577..36579,36586..36594,
FT                   36601..36603,36610..36612,36622..36624,36883..36888,
FT                   36958..36963,37021..37026,37042..37044,37054..37056,
FT                   37066..37068,37075..37080,37156..37158,37165..37167,
FT                   37204..37209,37213..37221)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:73382"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    order(36478..36483,36523..36525,36568..36570,36574..36576,
FT                   36745..36747,36751..36756,36868..36870,36946..36954)
FT                   /note="active site"
FT                   /db_xref="CDD:73382"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    order(36478..36480,36523..36525,36568..36570,36574..36576,
FT                   36745..36747,36868..36870,36949..36954)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73382"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    order(36568..36570,36574..36576,36745..36747,36751..36753,
FT                   36949..36954)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73382"
FT                   /locus_tag="Bmul_5351"
FT   misc_feature    <37372..>37617
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl14655"
FT                   /db_xref="CDD:187409"
FT                   /locus_tag="Bmul_5351"
FT   gene            37753..39261
FT                   /db_xref="GeneID:5770511"
FT                   /locus_tag="Bmul_5352"
FT   CDS_pept        37753..39261
FT                   /locus_tag="Bmul_5352"
FT                   /gene_family="HOG000165632" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NCS1 nucleoside transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NCS1 nucleoside transporter family; PFAM:
FT                   permease for cytosine/purines uracil thiamine allantoin;
FT                   KEGG: bur:Bcep18194_C6657 cytosine/purines, uracil,
FT                   thiamine, allantoin transporter"
FT                   /db_xref="GI:161522385"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="GeneID:5770511"
FT                   /translation="MKATANGAEPDGMAMPGGSLYNDDLAPTTPAQRTWKWYHFAALWV
FT                   GMVMNIASYMLAAGLIQEGMSPWQAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVR
FT                   ASFGTQGAKLPALLRAIVACGWYGIQTWLGGSAIYTLLNILTGNALHGAALPLVGISLG
FT                   QLACFLVFWALQLYFIVHGTDSIRWLESWSAPIKVVMCIALVWWATSKAGGVGSMLSAP
FT                   SQFAAGGKKAGLFWATFWPGLTAMVGFWATLALNIPDFTRFAHSQRDQMIGQSLGLPVP
FT                   MALLSVVSVVVTSATVVIYGNAIWDPIDLTSRMTGIGVGIALVILTLDTMCCNLAANLV
FT                   GPAYDFSSLWPKRISYRTGGLITATIAIVMMPWKILATTDGYIFTWLVGYSALLGPVAG
FT                   IMMVDYFLIRGTQLDTHALFDESGGFSYARGWNPAALAALAIGVLPNLPGFLHTAFPAS
FT                   FPNVPAFFNTLYTYAWFVGLVLASCVYGTWMRWRAAQRAQIASA"
FT                   /protein_id="YP_001585314.1"
FT   misc_feature    37780..39243
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:186007"
FT                   /locus_tag="Bmul_5352"
FT   misc_feature    37861..39243
FT                   /note="Purine-cytosine permease and related proteins
FT                   [Nucleotide transport and metabolism]; Region: CodB;
FT                   COG1457"
FT                   /db_xref="CDD:31646"
FT                   /locus_tag="Bmul_5352"
FT   gene            39314..40771
FT                   /db_xref="GeneID:5770512"
FT                   /locus_tag="Bmul_5353"
FT   CDS_pept        39314..40771
FT                   /locus_tag="Bmul_5353"
FT                   /gene_family="HOG000219145" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenylhydantoinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="catalyzes the hydrolytic cleavage of hydantoin with
FT                   aromatic side chains at the 5'position"
FT                   /db_xref="GI:161522386"
FT                   /db_xref="InterPro:IPR005847"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:5770512"
FT                   /translation="MAILIRGGTVIDADRSYRADVLCAEPQDGGTILQIAEKIDAPAGA
FT                   TIVDAHDQYVMPGGIDPHTHMELPFMGTTASDDFYSGTAAGLAGGTTSIIDFVIPSPKQ
FT                   PLMDAFREWRGWAEKAAADYGFHVAVTWWDESVHRDMGTLVREHGVSSFKHFMAYKNAI
FT                   MADDEILVNSFTRSLELGALPTVHAENGELVFRLQQALLARGMTGPEAHPLSRPPEVEG
FT                   EAANRAIRIAQVLGVPVYIVHVSAKDAVDAITRARSEGLRVFGEVLPGHLVIDEAVYRD
FT                   PDWTRAAAHVMSPPFRSAEHREALWRGLQAGQLHTTATDHCVFCASQKAMGRDDFTKIP
FT                   NGCGGVEDRMSVLWHHGVNHGRITPNEFVRITSTNAAQIFNLYPRKGAVQVGADADLVV
FT                   WDPAATKTISVNTHHQQVDFNVFEGMTVQGVATHTLTRGALAWADGELRAVRGAGRYLK
FT                   RPPAAGYYEAARIANRLREPHPVERAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585315.1"
FT   misc_feature    39314..40696
FT                   /note="phenylhydantoinase; Validated; Region: PRK08323"
FT                   /db_xref="CDD:181388"
FT                   /locus_tag="Bmul_5353"
FT   misc_feature    39320..40675
FT                   /note="D-hydantoinases (D-HYD) also called
FT                   dihydropyrimidases (DHPase) and related proteins; DHPases
FT                   are a family of enzymes that catalyze the reversible
FT                   hydrolytic ring opening of the amide bond in five- or
FT                   six-membered cyclic diamides, like...; Region: D-HYD;
FT                   cd01314"
FT                   /db_xref="CDD:30057"
FT                   /locus_tag="Bmul_5353"
FT   misc_feature    order(39353..39358,39362..39364,39413..39418,39818..39820,
FT                   39881..39883,39890..39892,39899..39901,39968..39970,
FT                   39980..39982,39992..39994,40001..40003,40082..40087,
FT                   40091..40096,40445..40447,40460..40462,40475..40477)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:30057"
FT                   /locus_tag="Bmul_5353"
FT   misc_feature    order(39500..39502,39506..39508,39773..39775,39872..39874,
FT                   40040..40042,40271..40273)
FT                   /note="active site"
FT                   /db_xref="CDD:30057"
FT                   /locus_tag="Bmul_5353"
FT   gene            complement(40803..41915)
FT                   /db_xref="GeneID:5770513"
FT                   /locus_tag="Bmul_5354"
FT   CDS_pept        complement(40803..41915)
FT                   /locus_tag="Bmul_5354"
FT                   /gene_family="HOG000267659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rieske (2Fe-2S) domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_C6662 dioxygenase, iron-sulfur subunit"
FT                   /db_xref="GI:161522387"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="GeneID:5770513"
FT                   /translation="MRAVPLPDSNTLEPASGALVRDLRRVPIHPDYWYPLAWSRELKRG
FT                   KTLGVRFAGEPIVLVRTESGAVYALEDRCAHRQVPLHAGVVAGETLRCCYHGWTYDCSS
FT                   GRCVDVPYLGRERLPNGVRAYPCREAHGLIFVFPGDATRADERPFPLLASADDRGYKTR
FT                   RFGREVKCHYSFMHENLMDMNHQFLHRKQMGQMRARCVGRRRGDDWVEVDYTFARMEGK
FT                   QPVGEALVFGSSKKPGDQANKSVMTVRTGYPYQTLQIRSSEGTLVMDLWIVYVPLDAAQ
FT                   RTNRTFGLLSIRKPGVPFALDLAWPLLVWFTERIFGEDRWIVEREQEAHDEQGADWNHE
FT                   VFPVINELRDLLRQCGARTVIPIREVDDVR"
FT                   /protein_id="YP_001585316.1"
FT   misc_feature    complement(40899..41819)
FT                   /note="Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit
FT                   [Inorganic ion transport and metabolism / General function
FT                   prediction only]; Region: HcaE; COG4638"
FT                   /db_xref="CDD:34257"
FT                   /locus_tag="Bmul_5354"
FT   misc_feature    complement(41496..41819)
FT                   /note="Rieske non-heme iron oxygenase (RO) family,
FT                   N-terminal Rieske domain of the oxygenase alpha subunit;
FT                   The RO family comprise a large class of aromatic
FT                   ring-hydroxylating dioxygenases found predominantly in
FT                   microorganisms. These enzymes enable...; Region:
FT                   Rieske_RO_Alpha_N; cd03469"
FT                   /db_xref="CDD:58539"
FT                   /locus_tag="Bmul_5354"
FT   misc_feature    complement(order(41622..41624,41628..41630,41637..41639,
FT                   41685..41690,41694..41696))
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58539"
FT                   /locus_tag="Bmul_5354"
FT   gene            complement(42108..42851)
FT                   /db_xref="GeneID:5770659"
FT                   /locus_tag="Bmul_5355"
FT   CDS_pept        complement(42108..42851)
FT                   /locus_tag="Bmul_5355"
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionine sulfoxide reductase A"
FT                   /EC_number="1.8.4.11"
FT                   /note="this stereospecific enzymes reduces the S isomer of
FT                   methionine sulfoxide while MsrB reduces the R form;
FT                   provides protection against oxidative stress"
FT                   /db_xref="GI:161522388"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="GeneID:5770659"
FT                   /translation="MNTTSSPQPARRRRTAMLRRIGALAVAAAAVIGYQRAGRSAEPPR
FT                   TAPAPTLDETPGASHDETAVLAGGCFWGVQGVFEHVKGVKQVTAGYAGGASETAHYALV
FT                   GTGLTGHAESVRIVYDPARITYGRLLQIFFSVAHDPTELNRQGPDEGTQYRSAIFPTSA
FT                   QQRAIATAYVAQPGRAHTFAAPIVTRVEPFKGFYPAESYHQNYLELHPDAPYIAFNDLP
FT                   KVAALQQRFPALYRADAVLWRDASR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585317.1"
FT   sig_peptide     complement(42738..42851)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.389 at
FT                   residue 38"
FT                   /locus_tag="Bmul_5355"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(42159..42668)
FT                   /note="Peptide methionine sulfoxide reductase; Region:
FT                   PMSR; cl00366"
FT                   /db_xref="CDD:185944"
FT                   /locus_tag="Bmul_5355"
FT   gene            complement(42916..44796)
FT                   /db_xref="GeneID:5770660"
FT                   /locus_tag="Bmul_5356"
FT   CDS_pept        complement(42916..44796)
FT                   /locus_tag="Bmul_5356"
FT                   /gene_family="HOG000267682" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   bur:Bcep18194_C6664 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="GI:161522389"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR011594"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="GeneID:5770660"
FT                   /translation="MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLVG
FT                   MALTFAVVATLAAVGGGWVAQANQAGRWAAIVLLAIFGLSLLMPRVAEHLTRPFVAAGN
FT                   RLTGLAQRDGRPAGPLSSLLLGVATGLLWAPCAGPILGLVLTGAALHGANVGTTLLLIA
FT                   YAAGAATSLGIALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQ
FT                   LSTIATGGLETRLVDRLGGRAAGMPIAMAAADGASGRMQHDAGTGPAMMAAADTAAADR
FT                   SAPPAGAMMRAAAPMATPAALPVEGTLPSLDGAVQWLNSPPLTAAALRGKVVLVDFWTY
FT                   SCINCLRTLPYTNAWARKYARYGLVVIGVHAPEFAFERDIGNVKKAVRDLGIDYPVAID
FT                   NRYAIWRAFNNEYWPAHYFVDAQGRIRRHHFGEGEYAESERAIQQLLAEAGHPDALNVP
FT                   IGLTGGPAQGALAAADSADVRSPETYVGYARAEDFASPGGVVRDAAHRYDAPAHPALND
FT                   WGLAGTWQVGAEHATLAAPAGRIVYRFHARDLHLVLGPGANGKPVRFRVTVDGAAPGDA
FT                   HGTDVDAQGYGTVTGQRLYQLVRQPGAIADRTFSIEFLDAGVDAYAFTFG"
FT                   /protein_id="YP_001585318.1"
FT   misc_feature    complement(44203..44778)
FT                   /note="Cytochrome C biogenesis protein transmembrane
FT                   region; Region: DsbD; cl00515"
FT                   /db_xref="CDD:153822"
FT                   /locus_tag="Bmul_5356"
FT   misc_feature    complement(43498..43872)
FT                   /note="TlpA-like family, DipZ-like subfamily; composed
FT                   uncharacterized proteins containing a TlpA-like TRX domain.
FT                   Some members show domain architectures similar to that of
FT                   E. coli DipZ protein (also known as DsbD). The only
FT                   eukaryotic members of the TlpA...; Region:
FT                   TlpA_like_DipZ_like; cd03012"
FT                   /db_xref="CDD:48561"
FT                   /locus_tag="Bmul_5356"
FT   misc_feature    complement(order(43762..43764,43771..43773))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48561"
FT                   /locus_tag="Bmul_5356"
FT   gene            complement(44834..45349)
FT                   /db_xref="GeneID:5770661"
FT                   /locus_tag="Bmul_5357"
FT   CDS_pept        complement(44834..45349)
FT                   /locus_tag="Bmul_5357"
FT                   /gene_family="HOG000243424" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: bch:Bcen2424_6245
FT                   methionine-R-sulfoxide reductase"
FT                   /db_xref="GI:161522390"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:5770661"
FT                   /translation="MPTRRHFLFAGTAGLAALAALSSAGRRALVGRAFAAPPAGRFEVA
FT                   LSDAEWHRRLTPAQYTVLRDAGTEPPYSSPLNDEHRRGTFACAGCDLALFSSSAKFDSH
FT                   TGWPSFWQPLDHAVGTGADTSFGMVRTEVHCRRCGGHLGHVFGDGPPPTGLRYCMNGLA
FT                   LVFHPAAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585319.1"
FT   sig_peptide     complement(45242..45349)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.504 at
FT                   residue 36"
FT                   /locus_tag="Bmul_5357"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(44846..45226)
FT                   /note="SelR domain; Region: SelR; cl00369"
FT                   /db_xref="CDD:185947"
FT                   /locus_tag="Bmul_5357"
FT   gene            45469..46287
FT                   /db_xref="GeneID:5770704"
FT                   /locus_tag="Bmul_5358"
FT   CDS_pept        45469..46287
FT                   /locus_tag="Bmul_5358"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bam:Bamb_5785 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="GI:161522391"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:5770704"
FT                   /translation="MAAAAARRHSSRAPSDPASAPQPDRAPARRAIAMDHPKRILIVED
FT                   DADIADVLSLHLRDERYEVVHSADGAQGLRLLEQGGWDALILDLMLPGVDGLEICRRAR
FT                   AMARYTPIIITSARSSEVHRILGLEIGADDYLAKPFSVLELVARVKALLRRVDALARDS
FT                   RIDAGTLDVAGLSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVW
FT                   GYQHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPEQRDA"
FT                   /protein_id="YP_001585320.1"
FT   misc_feature    45580..46272
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    45589..45927
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    order(45598..45603,45730..45732,45754..45756,45814..45816,
FT                   45871..45873,45880..45885)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    45730..45732
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    order(45739..45744,45748..45756)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    45880..45888
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    45976..46260
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bmul_5358"
FT   misc_feature    order(46048..46050,46105..46110,46162..46164,46171..46173,
FT                   46195..46200,46234..46236,46249..46251)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bmul_5358"
FT   gene            46287..47801
FT                   /db_xref="GeneID:5770705"
FT                   /locus_tag="Bmul_5359"
FT   CDS_pept        46287..47801
FT                   /locus_tag="Bmul_5359"
FT                   /gene_family="HOG000267761" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bur:Bcep18194_C6810
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="GI:161522392"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:5770705"
FT                   /translation="MRLTLTRRLSLVFSVLLLACSGASAWLQIRANDMREKEVVQALSR
FT                   DLAAHIANSTPLMGANGLRPDAVRTLFGQLMGVNPSVEVYLLDNAGRIVGDDAPPGHVK
FT                   RDRVDLAPVKRFIAGDPLPILGDDPRSADARKVFSAAPLQRAGEPPAGYIYVVLLGEAH
FT                   DQLAARVEAGNVLRTTLWSMALVALLGLLAGLVAFSLITRPLRRLTDAMRRFDADGAPD
FT                   TQPPVPRSAPGRRGDDIAVLESAFAQMADRIGEQWRALTRQDQQRRELIANISHDLRTP
FT                   LTSLHGYLETLSLKADTLAEPDRRRYLSIALAQSAKVGRLAQALFELARLESGGVQPER
FT                   EAFSIVDLVQDVFQKFELTAQARGIALHARIPSRVPAVSADVAMIERVLTNLIDNALRH
FT                   TPAHGEVEVAVEPRGDRVLVTVSDTGEGIPPARREGLFQRPQRPASGAAARSGGLGLLI
FT                   VHRMLLLNDSRIRLVDRAGFGAVFEFALPVASAVSADGASTGGEMR"
FT                   /protein_id="YP_001585321.1"
FT   sig_peptide     46287..46364
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 26"
FT                   /locus_tag="Bmul_5359"
FT                   /product="hypothetical protein"
FT   misc_feature    46737..47771
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    47076..47276
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    order(47094..47096,47106..47108,47118..47120,47127..47129,
FT                   47139..47141,47148..47150,47205..47207,47217..47219,
FT                   47226..47228,47238..47240,47247..47249,47259..47261)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    47112..47114
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    47439..47744
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    order(47457..47459,47469..47471,47478..47480,47547..47549,
FT                   47553..47555,47559..47561,47565..47570,47643..47654,
FT                   47700..47702,47706..47708,47721..47726,47730..47732)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    47469..47471
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5359"
FT   misc_feature    order(47559..47561,47565..47567,47643..47645,47649..47651)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5359"
FT   gene            complement(47895..48995)
FT                   /db_xref="GeneID:5770706"
FT                   /locus_tag="Bmul_5360"
FT   CDS_pept        complement(47895..48995)
FT                   /locus_tag="Bmul_5360"
FT                   /gene_family="HOG000267762" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5783 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="GI:161522393"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:5770706"
FT                   /translation="MTRSTLPNPPAARAAAVQDAPSMHALHDRRYSPTKLAVLVDVASA
FT                   LGVDAAVVLDGTGLDAAAVADPFTLTSSLQFVTAARNAIRAYDGTDLGVRVGSRLHASS
FT                   YGMYGYALLCSTSLAHTFDSAVKYHQLANRVLAIRWVEHDGIASWLFPDPHEVALPDLD
FT                   TALYRFLIDLQFAVHVTIIKDVMGAWCVPARAQFAQPRPPHAALLADVLECPIAFDQPR
FT                   HALGYPSAWLARAPQLANPITAAQVSSQCARLLDELRSQADVTRRVYQELTRTPGQFPD
FT                   IDAIADSLCITSRTLRRKLEAEGTSYSALLTSVRKALAIDYLSTTTLSIDDIASTLGFS
FT                   DAVGFRHAFKRWTGTTPSDVRRKRGR"
FT                   /protein_id="YP_001585322.1"
FT   misc_feature    complement(47913..48158)
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Bmul_5360"
FT   misc_feature    complement(47910..48023)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bmul_5360"
FT   gene            49320..50954
FT                   /db_xref="GeneID:5770307"
FT                   /locus_tag="Bmul_5361"
FT   CDS_pept        49320..50954
FT                   /locus_tag="Bmul_5361"
FT                   /gene_family="HOG000229983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bch:Bcen2424_6272 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:161522394"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:5770307"
FT                   /translation="MTNRPWIASYGPIPAEIDADRDASVTARLGDAMRRFADRPAFRAG
FT                   ARTLTYADVDRLSSALAAYLQQVVGVRRGDRVAVMLPNVPAFPIAFVAVAKLGAVQVNV
FT                   NPLYTARELEHQLNDAGVETIVVCGGSTGTLADVIVRTRIRTVLTVGPDDLGIVPVADA
FT                   ARGALPTATIAFADALEDGARRTFDAVAPNGDDLLLLQYTGGTTGLSKGAALSHRNLVA
FT                   NVAQFEAFMSDALRAGDEVIVTAIPLYHIFALTVNFLSYFTAGAQNWLVANPRDVDALV
FT                   DVLAAARPTVFVGVNTLYAALSAHPRLGNVDWSRLRLSIGGGAATIDVVSARWQAITGN
FT                   FIREGYGLSETSPVVSFNPLFVDRFTGTTGLPLPSTDVKLLDERDREAAIGEPGEICVK
FT                   GPQVMTGYWQQPEANAAAFTADGYFRTGDIGVFDAAGFLRIVDRKKDMILVSGFNVYPN
FT                   EVEAVATALPGVAECACIGMPDERTGEAVKLFAVLAPGATLTEADIVAHCRANLAGYKV
FT                   PKCVRIVERLPKSTVGKILRRELSRVD"
FT                   /protein_id="YP_001585323.1"
FT   misc_feature    49323..50939
FT                   /note="Long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK07059"
FT                   /db_xref="CDD:180816"
FT                   /locus_tag="Bmul_5361"
FT   misc_feature    <49950..50939
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:186997"
FT                   /locus_tag="Bmul_5361"
FT   gene            51071..52117
FT                   /db_xref="GeneID:5770308"
FT                   /locus_tag="Bmul_5362"
FT   CDS_pept        51071..52117
FT                   /locus_tag="Bmul_5362"
FT                   /gene_family="HOG000217016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5781 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="GI:161522395"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:5770308"
FT                   /translation="MTGSDSPTARPGRALPPPSATVPISLVNGFLASAGVQHDIVERYL
FT                   REAGIPAELRSEPHARVTEEQFSTLYRTLAIELDDEMPGIFSRPLRGGTLKYLCLSLLD
FT                   ARNLETAQHRFGQFFHILLDDFFVESKRDGLVAQVLLRPNPAVGPIGALGQELMLKLVH
FT                   GVCSWLIGQRIPLLQIEFACPRPRHAVDHLYFFSGPVQFDCERTLMRFSADYLDAPIRQ
FT                   SKRNLRKFLARAPGDWIFETFSEQRVCHRVRQYLSEALPDLPVIEQAAEHLHCSVRTLS
FT                   RHLAAEGTTFQALKDELRRDIAIQRLTDTQDTIAAIGADIGFDDPSAFHRAFRHWTGST
FT                   PGTYRRRA"
FT                   /protein_id="YP_001585324.1"
FT   misc_feature    <51743..>51859
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5362"
FT   misc_feature    51866..52105
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Bmul_5362"
FT   misc_feature    51980..52108
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bmul_5362"
FT   gene            52434..54224
FT                   /db_xref="GeneID:5770309"
FT                   /locus_tag="Bmul_5363"
FT   CDS_pept        52434..54224
FT                   /locus_tag="Bmul_5363"
FT                   /gene_family="HOG000258862" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bch:Bcen2424_6274 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="GI:161522396"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:5770309"
FT                   /translation="MSYIAPVKDMLFVLKELAGIDAVAQLPGFEDAGYDTAQAVLDESA
FT                   KFCGEVLAPLNVDGDRNPSSWKDGVVTATPGFREAFRQFVEGGWQGLQHPTDYDGQGLP
FT                   KLIATPCIEMLNASNLSFALCPLLTDGAIEALLTAGTDEQKQRYVPKLISGEWTGTMNL
FT                   TEPQAGSDLALVRSRAEPQGDGTYKVFGTKIFITWGEHDMADNIVHLVLARTPNAPEGV
FT                   KGISLFIVPKFLVNEDGTLGARNDVHCVSIEHKLGIKASPTAVLQYGDHGGAIGYLVGE
FT                   ENRGLEYMFIMMNAARFGVGMQGIGVADRAYQKAAAFAKERVQSRPVDGSAKQSVTIIH
FT                   HPDVRRMLGTMRGLTEGARALAYVAAAHSDIAHRHPDEATRARHQAVYEYLVPIVKGWS
FT                   TEMVNDVASLGVQVHGGMGFIEETGAAQYYRDARILAIYEGTTAIQANDLVGRKTLRDG
FT                   GAVARALIAEIGETVAALGKLDGAAAASMKAQLEQGAQALSSVVDYVLANAKQDPNAVF
FT                   LGSVPYLKLAGIVLCGWQMARALVAADAQRANDPAFFDAKIAIAQCYAENVLVQANGLA
FT                   ASIVGAKNGQGVLAMTEDQF"
FT                   /protein_id="YP_001585325.1"
FT   misc_feature    52434..54152
FT                   /note="acyl-CoA dehydrogenase; Provisional; Region:
FT                   PTZ00456"
FT                   /db_xref="CDD:185635"
FT                   /locus_tag="Bmul_5363"
FT   misc_feature    52434..52532
FT                   /note="Acyl-CoA dehydrogenase N terminal; Region:
FT                   AcylCoA_DH_N; pfam12418"
FT                   /db_xref="CDD:152852"
FT                   /locus_tag="Bmul_5363"
FT   misc_feature    52551..53795
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Bmul_5363"
FT   misc_feature    order(52824..52826,52914..52916,52920..52922,53016..53018,
FT                   53022..53024,53742..53750,53754..53756,53760..53762)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Bmul_5363"
FT   gene            54264..55937
FT                   /db_xref="GeneID:5770936"
FT                   /locus_tag="Bmul_5364"
FT   CDS_pept        54264..55937
FT                   /locus_tag="Bmul_5364"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; KEGG: bvi:Bcep1808_5643
FT                   electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="GI:161522397"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="GeneID:5770936"
FT                   /translation="MTTQDLIAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGT
FT                   EIGVCVLEKGSEIGAHILSGAVMDPRALTELFPDWKERGAPLNVEVTEDRFLFLSEKSA
FT                   VQTPNWALPDNFKNHGNYVISLGNVTRWLGQQAEALGVEIFPGFPAAEILYNDDGSVKG
FT                   VATGNMGVGKDGEPTENFQLGMELHAKYTLFAEGCRGHLGRQLIAKFKLDANADPQAYG
FT                   IGIKELWEIDPAKHKPGLVIHTAGWPLKPDTYGGSFLYHMDNNQVVVGFVVGLGYTNPY
FT                   LSPFEEFQRYKTHPSIRAFLEGGKRVSYGARAITAGGLMSLPKTVFPGGALIGDDAGFL
FT                   NASRIKGSHAAIKTGMLAADAAFDAVQAGRQSDELNAYPDAFRQSWLYTELYRARNFKQ
FT                   WMAKGLYLGTLMVGIEQKLMGGNVPWTLHHKHADHEMLKPASQCEPIVYPKPDGKLTFD
FT                   RLSSVFISNTNHEENQLAHLTLKDPSVPVNVNLRTYAGPEGRFCPAAVYEFVKNDDGSD
FT                   RLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585326.1"
FT   misc_feature    54306..55673
FT                   /note="Dehydrogenases (flavoproteins) [Energy production
FT                   and conversion]; Region: FixC; COG0644"
FT                   /db_xref="CDD:30989"
FT                   /locus_tag="Bmul_5364"
FT   misc_feature    54312..>55280
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bmul_5364"
FT   misc_feature    55473..55802
FT                   /note="Electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; Region: ETF_QO; pfam05187"
FT                   /db_xref="CDD:147396"
FT                   /locus_tag="Bmul_5364"
FT   misc_feature    <55692..55925
FT                   /note="Ferredoxin-like protein [Energy production and
FT                   conversion]; Region: FixX; COG2440"
FT                   /db_xref="CDD:32561"
FT                   /locus_tag="Bmul_5364"
FT   gene            55950..57179
FT                   /db_xref="GeneID:5770937"
FT                   /locus_tag="Bmul_5365"
FT   CDS_pept        55950..57179
FT                   /locus_tag="Bmul_5365"
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-ketothiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="catalyzes the formation of beta-ketovaleryl-CoA from
FT                   acetyl-CoA and propionyl-CoA"
FT                   /db_xref="GI:161522398"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:5770937"
FT                   /translation="MHGRARTNRSKTMSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTQL
FT                   GAKVVREVLSRANVPGDAVGHVVFGHVVNTEPKDMYLARVAAIDGGVAQHTPALTVNRL
FT                   CGSGLQAIVSAAQTILLGDADVAIGGGSESMTRAPYSVPAARFGQRMGDAKLVDMMLGA
FT                   LHDPFQSIHMGVTAENVAAKYGISRDAQDALALESHRRAARAIAEGRFKDQILPISIRT
FT                   KKGEVAFDTDEHVRHEASAEDFSKLRPVFAKENGTVTAGNASGINDAAAAVLMMSGDAA
FT                   RAQGVKPLARLVAYAHAGVDPAYMGIGPVPATQKVLERAGLKIDDLDVIEANEAFAAQA
FT                   CAVTQELGLDPAKVNPNGSGISLGHPIGATGALITVKALYELKRIGGRYALVTMCIGGG
FT                   QGIAAIFENI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585327.1"
FT   misc_feature    55995..57176
FT                   /note="beta-ketothiolase; Provisional; Region: PRK09051"
FT                   /db_xref="CDD:181625"
FT                   /locus_tag="Bmul_5365"
FT   misc_feature    56010..57173
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5365"
FT   misc_feature    order(56064..56066,56145..56147,56190..56192,56199..56201,
FT                   56211..56213,56244..56255,56277..56279,56298..56303,
FT                   56310..56312,56355..56357,56832..56834,56838..56840,
FT                   56844..56846,56904..56906,57141..57146)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5365"
FT   misc_feature    order(56262..56264,57042..57044,57132..57134)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Bmul_5365"
FT   gene            57229..58083
FT                   /db_xref="GeneID:5770938"
FT                   /locus_tag="Bmul_5366"
FT   CDS_pept        57229..58083
FT                   /locus_tag="Bmul_5366"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bch:Bcen2424_6277 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="GI:161522399"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="GeneID:5770938"
FT                   /translation="MAIETVGVVGAGTMGNGIAQTAAVAGLNVVMIDVTDAALEKGLAT
FT                   LKGSLERLVSKDKLAAAARDAALARISTSTDYAKLASVDIVIEAATENVELKSRILKQI
FT                   ESVARPDAIIATNTSSISITALAALLADPSRFVGMHFFNPVPLMPLVEIIRGLQTSDAT
FT                   AAAVRALTERFDKSPIGVRNAPGFVVNRILVPMINEAFFVLAEGIASAEEIDAGMKLGA
FT                   NHPIGPLALADLVGLDVCLAVMDVFLKDFGDPKYRACPLLREMVAAGRLGRKTGRGVYD
FT                   YSK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585328.1"
FT   misc_feature    57229..58074
FT                   /note="3-hydroxybutyryl-CoA dehydrogenase; Validated;
FT                   Region: PRK05808"
FT                   /db_xref="CDD:180269"
FT                   /locus_tag="Bmul_5366"
FT   misc_feature    57241..57780
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5366"
FT   misc_feature    57784..58074
FT                   /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   Region: 3HCDH; pfam00725"
FT                   /db_xref="CDD:109769"
FT                   /locus_tag="Bmul_5366"
FT   gene            58488..59630
FT                   /db_xref="GeneID:5770740"
FT                   /locus_tag="Bmul_5367"
FT   CDS_pept        58488..59630
FT                   /locus_tag="Bmul_5367"
FT                   /gene_family="HOG000113756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mandelate racemase/muconate lactonizing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bch:Bcen2424_3214 mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein"
FT                   /db_xref="GI:161522400"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="GeneID:5770740"
FT                   /translation="MRIAAIEVIRLSLAFDAGRRPAATSAPAADTYNAADRSLRRMESL
FT                   LVKVTDEAGHVGWGEAFGHLINPVTFAALEGPVGRWFRGAEFEPTPGGIAALRDAADRA
FT                   LHAFGRTGPVLYALSAIDTALHDLSAQHAGQPLHRWLGARRDEIDVYASLVSYENELGE
FT                   VARHVRRAWDEGFRRIKLHETERAAIAAARDALPVGGELMVDVNCPWTANEAVRRVGEL
FT                   ADLGLGWIEEPVWPCDDARAIARVRGTGVRVAAGENASGVAGFRNLFEHDALDVAQPSV
FT                   AKIGGPTAMRAVIALAAQHRVRVVPHCFYFGAGLLATAHLVATLPVDVALEIPYLDWPE
FT                   RLHDAQRPGARLRLPDMPGLGFVPDDAVLARNTIAHATIC"
FT                   /protein_id="YP_001585329.1"
FT   misc_feature    58488..59621
FT                   /note="L-alanine-DL-glutamate epimerase and related enzymes
FT                   of enolase superfamily [Cell envelope biogenesis, outer
FT                   membrane / General function prediction only]; Region:
FT                   COG4948"
FT                   /db_xref="CDD:34556"
FT                   /locus_tag="Bmul_5367"
FT   misc_feature    58590..59576
FT                   /note="Mandelate racemase (MR)-like subfamily of the
FT                   enolase superfamily. Enzymes of this subgroup share three
FT                   conserved carboxylate ligands for the essential divalent
FT                   metal ion (usually Mg2+), two aspartates and a glutamate,
FT                   and conserved catalytic residues...; Region: MR_like;
FT                   cd03316"
FT                   /db_xref="CDD:48191"
FT                   /locus_tag="Bmul_5367"
FT   misc_feature    order(59025..59027,59031..59033,59100..59102,59178..59180,
FT                   59256..59258,59325..59327,59406..59408,59481..59483)
FT                   /note="active site pocket"
FT                   /db_xref="CDD:48191"
FT                   /locus_tag="Bmul_5367"
FT   gene            59750..61048
FT                   /db_xref="GeneID:5770741"
FT                   /locus_tag="Bmul_5368"
FT   CDS_pept        59750..61048
FT                   /locus_tag="Bmul_5368"
FT                   /gene_family="HOG000113641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_3215 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:161522401"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:5770741"
FT                   /translation="MKTRYRWWVGALLFGAGMLNYLDRAALSVVAPIIKRDLGISDAQM
FT                   GVLFSSFFVGYCVFCFVGGWAADRFGPRRVFAWAAGVWSLFCGATALAGSFVHLLVVRV
FT                   AFGIGEGPMGTTTNKAISNWFPRREAGRAVGWTNAGQPLGAAIAAPIVGLVALQFGWRV
FT                   SFVVIAALGFLWLVAWWRLFRDEPAAHPRVSLEEAREIAADRGVDAVHGTRDVHAADAH
FT                   AARPLLHYLLSRPVLGVALAFFSFNYVLYFFLSWLPSYLTDYQHLNIKQMSVVGILPWL
FT                   GATVGFVAGGTVSDRIYRHSGDVLFARKIVIVVGLGVAAACVLLASRVNSLGAAVTLIA
FT                   IASLFAFMAPQACWSLLQEIVPRERVGAAGGFVHLLANLAGILSPSLTGWLVQYGGGYA
FT                   GAFVLAGASALAGAAILTVAVRPRTVAQMRGAV"
FT                   /protein_id="YP_001585330.1"
FT   misc_feature    59780..60937
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5368"
FT   misc_feature    59795..60928
FT                   /note="d-galactonate transporter; Region: 2A0114;
FT                   TIGR00893"
FT                   /db_xref="CDD:162094"
FT                   /locus_tag="Bmul_5368"
FT   misc_feature    order(59819..59821,59828..59836,59840..59845,59894..59896,
FT                   59903..59908,59915..59917,59927..59932,59936..59941,
FT                   60077..60082,60089..60094,60101..60106,60113..60115,
FT                   60149..60154,60161..60166,60182..60184,60488..60490,
FT                   60497..60502,60509..60514,60521..60523,60563..60565,
FT                   60575..60577,60587..60589,60596..60598,60608..60610,
FT                   60776..60778,60785..60790,60797..60799,60809..60814,
FT                   60821..60823,60854..60859,60866..60871,60878..60883,
FT                   60890..60892)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5368"
FT   gene            61619..62782
FT                   /db_xref="GeneID:5770742"
FT                   /locus_tag="Bmul_5369"
FT   CDS_pept        61619..62782
FT                   /locus_tag="Bmul_5369"
FT                   /gene_family="HOG000072798" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: bch:Bcen2424_6371
FT                   aldose 1-epimerase"
FT                   /db_xref="GI:161522402"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="GeneID:5770742"
FT                   /translation="MKRLWLQRAIAMIFLYATIGTAANAASPSADVSVHRSDYGVTRTG
FT                   RAVSQYTLSNAHGVTLKVITYGGIVTALEVPDRTGKVADIVLGFDSLADYEAHNGNIHF
FT                   GALIGRYANRIAHGRFSLDGNTWQLPLNDGPNTLHGGPDSFDAKVWTVTAARSDGQRAS
FT                   VTLRYVSPDGENGFPGTLTTDVTYTLTNDDVIRIDYRATTDKDTVVNLTNHSYFNLAGH
FT                   DSGSVERQLIEIDASRFTPTDATSIPTGELASVAGTPMDLRAPTPIGARLRSAYPQLAM
FT                   AHGYDHNWVLDHGGEAAPAFAARAYDPASGRFLALYTTQPGLQFYTSNGLNGSVVGKGG
FT                   TVYRQTDAFALEAEHFPDSPNHPSFPTTVLKPGQTLHEVTLWKVGAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585331.1"
FT   sig_peptide     61619..61696
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT                   /locus_tag="Bmul_5369"
FT                   /product="hypothetical protein"
FT   misc_feature    61733..62758
FT                   /note="Galactose mutarotase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: GalM;
FT                   COG2017"
FT                   /db_xref="CDD:32200"
FT                   /locus_tag="Bmul_5369"
FT   misc_feature    61766..62767
FT                   /note="galactose mutarotase_like; Region:
FT                   galactose_mutarotase_like; cd09019"
FT                   /db_xref="CDD:185696"
FT                   /locus_tag="Bmul_5369"
FT   misc_feature    order(61925..61927,61958..61960,62033..62035,62258..62260,
FT                   62264..62266,62474..62476,62594..62596,62672..62674)
FT                   /note="active site"
FT                   /db_xref="CDD:185696"
FT                   /locus_tag="Bmul_5369"
FT   misc_feature    order(62258..62260,62672..62674)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:185696"
FT                   /locus_tag="Bmul_5369"
FT   gene            62877..63239
FT                   /db_xref="GeneID:5770562"
FT                   /locus_tag="Bmul_5370"
FT   CDS_pept        62877..63239
FT                   /locus_tag="Bmul_5370"
FT                   /gene_family="HOG000144508" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bch:Bcen2424_5459 transcriptional regulator, ArsR family"
FT                   /db_xref="GI:161522403"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5770562"
FT                   /translation="MDKYQSSIGDVFHALADPTRVAIVCALASGAQTVSTLAAPFDMAL
FT                   PSFMKHLTVLERSGLILTSKSGRTRTCELQPQRLQQAERWLAEQRAMWEARSDRMVEFV
FT                   ERLHQQEQADDPKRRR"
FT                   /protein_id="YP_001585332.1"
FT   misc_feature    62910..>63086
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5370"
FT   misc_feature    order(62910..62915,62919..62921,62928..62930,62937..62942,
FT                   62949..62954,62961..62963,63051..63053)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5370"
FT   misc_feature    order(62913..62918,62928..62936,62973..62981,63006..63017,
FT                   63021..63026,63033..63038,63042..63047,63063..63071,
FT                   63084..63086)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5370"
FT   misc_feature    order(62973..62975,62982..62984)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5370"
FT   gene            63217..63702
FT                   /db_xref="GeneID:5770563"
FT                   /locus_tag="Bmul_5371"
FT   CDS_pept        63217..63702
FT                   /locus_tag="Bmul_5371"
FT                   /gene_family="HOG000159694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="activator of Hsp90 ATPase 1 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bam:Bamb_4802 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="GI:161522404"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="GeneID:5770563"
FT                   /translation="MTRNAADSADSRDLMITRVLRAPRAALWRAWSEPDLLKVWWCPKP
FT                   WTTDVLAFDLKPGGAFHTLMKGPDGGISDNPGCFLEIVPQSRLAFTSMLTAGWRPNTPW
FT                   MGFTAIITMTDEGEGTRYVAHVMHPDDASREQHEKLGFFDGWNMVITQLDELACTLR"
FT                   /protein_id="YP_001585333.1"
FT   misc_feature    63253..63687
FT                   /note="Putative hydrophobic ligand-binding SRPBCC domain of
FT                   an uncharacterized subgroup of CalC- and Aha1-like
FT                   proteins; Region: SRPBCC_CalC_Aha1-like_3; cd08896"
FT                   /db_xref="CDD:176905"
FT                   /locus_tag="Bmul_5371"
FT   misc_feature    order(63256..63258,63262..63264,63268..63270,63295..63303,
FT                   63307..63312,63325..63327,63367..63369,63391..63393,
FT                   63397..63399,63403..63405,63409..63411,63436..63438,
FT                   63442..63447,63451..63453,63460..63462,63478..63480,
FT                   63484..63489,63538..63543,63547..63549,63553..63555,
FT                   63583..63585,63589..63591,63595..63597,63601..63603,
FT                   63628..63654,63658..63666,63673..63675)
FT                   /note="putative hydrophobic ligand binding site; other
FT                   site"
FT                   /db_xref="CDD:176905"
FT                   /locus_tag="Bmul_5371"
FT   gene            64240..64464
FT                   /db_xref="GeneID:5770564"
FT                   /locus_tag="Bmul_5372"
FT   CDS_pept        64240..64464
FT                   /locus_tag="Bmul_5372"
FT                   /gene_family="HOG000218303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1150 hypothetical protein"
FT                   /db_xref="GI:161522405"
FT                   /db_xref="GeneID:5770564"
FT                   /translation="MQATNTQHYGGYAVAPSAHRLPDGSFSSNLTLRRTGCRAEPTCYE
FT                   FYSLDYFSSEEAALRHSARWARNWIDTRG"
FT                   /protein_id="YP_001585334.1"
FT   gene            64780..65064
FT                   /db_xref="GeneID:5770283"
FT                   /locus_tag="Bmul_5373"
FT   CDS_pept        64780..65064
FT                   /locus_tag="Bmul_5373"
FT                   /gene_family="HOG000221324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5957 hypothetical protein"
FT                   /db_xref="GI:161522406"
FT                   /db_xref="GeneID:5770283"
FT                   /translation="MSMHLYRGFEIYPLIYPHVPAQLGSAHNYDAGFDAAVKICQRGAG
FT                   DMLTRSQTFRLAELSPFDTAGDARRASLRYAETMIDDNRDKPGFFADTL"
FT                   /protein_id="YP_001585335.1"
FT   gene            65102..65311
FT                   /db_xref="GeneID:5770284"
FT                   /locus_tag="Bmul_5374"
FT   CDS_pept        65102..65311
FT                   /locus_tag="Bmul_5374"
FT                   /gene_family="HOG000266561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5958 hypothetical protein"
FT                   /db_xref="GI:161522407"
FT                   /db_xref="GeneID:5770284"
FT                   /translation="MIIDDLLDLIRRGEVSGTDTALPSGVGDSALAHQQEFRMFAAVRA
FT                   LTIGSGYTEFESDEIASAVMTRLG"
FT                   /protein_id="YP_001585336.1"
FT   gene            65348..65560
FT                   /db_xref="GeneID:5770285"
FT                   /locus_tag="Bmul_5375"
FT   CDS_pept        65348..65560
FT                   /locus_tag="Bmul_5375"
FT                   /gene_family="HOG000157460" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S21"
FT                   /transl_table="11"
FT                   /note="PFAM: ribosomal protein S21; KEGG: bam:Bamb_5802
FT                   ribosomal protein S21"
FT                   /db_xref="GI:161522408"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="GeneID:5770285"
FT                   /translation="MTSITLKANEPIDVALRRFRRDIEKTGLIRELRSRTSYEKPTAMR
FT                   KRKKASAVVRQRSRVRRALPPRKLY"
FT                   /protein_id="YP_001585337.1"
FT   misc_feature    65348..>65494
FT                   /note="Ribosomal protein S21; Region: Ribosomal_S21;
FT                   cl00529"
FT                   /db_xref="CDD:186062"
FT                   /locus_tag="Bmul_5375"
FT   gene            65681..66022
FT                   /db_xref="GeneID:5770770"
FT                   /locus_tag="Bmul_5376"
FT   CDS_pept        65681..66022
FT                   /locus_tag="Bmul_5376"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bxe:Bxe_B0304
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="GI:161522409"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5770770"
FT                   /translation="MDSNHVVRALSALAHESRLAIFRALVVAGPNGLAAGEIAQRLGLS
FT                   PSGLSFHLKDLSHAGLVQSRQEGRFVFYTAHFDAMNGLIGFLTENCCAGASCAASDARG
FT                   CCPPAANPS"
FT                   /protein_id="YP_001585338.1"
FT   misc_feature    65708..>65899
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5376"
FT   misc_feature    order(65708..65713,65717..65719,65726..65728,65735..65740,
FT                   65747..65752,65759..65761,65858..65860)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5376"
FT   misc_feature    order(65711..65716,65726..65734,65780..65788,65813..65824,
FT                   65828..65833,65840..65845,65849..65854,65870..65878,
FT                   65891..65899)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5376"
FT   misc_feature    order(65780..65782,65789..65791)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5376"
FT   gene            66041..66562
FT                   /db_xref="GeneID:5770771"
FT                   /locus_tag="Bmul_5377"
FT   CDS_pept        66041..66562
FT                   /locus_tag="Bmul_5377"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: rme:Rmet_0331 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="GI:161522410"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:5770771"
FT                   /translation="MTDRPYSILILCTGNTSRSVMAEALFNVLGNGRFRAYSAGSRPAG
FT                   VVNPFAIEQCAALGYDTSQLRSKSWDEFARPDAPQMDFVLTVCDAAAGEACPVWPGRPI
FT                   TAHWGFEDPAACAGSDDEKRSVFDKVRRQIAHRVSRFLALPLDALDRDAIRHAMRAIGE
FT                   EPGQACDERH"
FT                   /protein_id="YP_001585339.1"
FT   sig_peptide     66041..66109
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.895 at
FT                   residue 23"
FT                   /locus_tag="Bmul_5377"
FT                   /product="hypothetical protein"
FT   misc_feature    66056..66463
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5377"
FT   misc_feature    66056..66463
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bmul_5377"
FT   misc_feature    order(66074..66076,66080..66085,66089..66097)
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5377"
FT   gene            66549..67634
FT                   /db_xref="GeneID:5770772"
FT                   /locus_tag="Bmul_5378"
FT   CDS_pept        66549..67634
FT                   /locus_tag="Bmul_5378"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical-resistance protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bxe:Bxe_B0303
FT                   arsenite/antimonite exporter, ArsB like"
FT                   /db_xref="GI:161522411"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="GeneID:5770772"
FT                   /translation="MSGTDTTLGAARPAIGFFERYLSAWVALCIVAGIALGQLLPDVFR
FT                   ALGRMQVAQVNLPVGVLVWVMIVPMLVKIDLAAMSRVRSQWRGIGVTLFVNWLIKPFSM
FT                   ALLGWVFVRHVFAPWLPAAQLDSYVAGLILLAAAPCTAMVFVWSQLCDGDPYFTLSQVA
FT                   LNDAIMVVAFAPLVALLLGLSAITVPWDTLIMSVVLYIVIPALVAQWLRRRWLARGEAY
FT                   FRRAVARLGPYSIGALLATLVLLFAFQGDAIVDAPRVIALLAVPILIQVLFNSGLAYLL
FT                   NRRLGVAHCVAGPSSLIGASNFFELAVATAISLFGFHSGAALATVVGVLIEVPVMLFVV
FT                   GVVNRSRRWYEAAPHTHHGAR"
FT                   /protein_id="YP_001585340.1"
FT   misc_feature    66591..67577
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Bmul_5378"
FT   gene            complement(67660..69081)
FT                   /db_xref="GeneID:5771012"
FT                   /locus_tag="Bmul_5379"
FT   CDS_pept        complement(67660..69081)
FT                   /locus_tag="Bmul_5379"
FT                   /gene_family="HOG000268052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6929 hypothetical protein"
FT                   /db_xref="GI:161522412"
FT                   /db_xref="GeneID:5771012"
FT                   /translation="MEGVPFPLRVLAMPPIPLPALLDRILRTVVRRYRLPPLARSSSLD
FT                   ASTNAATVIATVIEEARVALAAHTAPEAALQDRFVAALARMIRDAVDPHMGDPAFQAAV
FT                   LRHDAPSVRDYAALSAHADQDRRALRSTVNTLAHPAKRERCAHAWQRDALAELHTAAFS
FT                   ASWSAFDATVRRWRAHPDTASDPAFARELAKLTDSPALARLQRIDALASDPSVRRYRAL
FT                   LARHGPQSGSALAVAQGVTSRQRGAAVEAAAAQALDALAQRLDAHDGTPRYRVVTSMRV
FT                   PSAIPGPHDRAKTEWDAVLLERANDDAQAPVWNVCFLVEAKASADAATTDLPRLQRGLR
FT                   LLAQADAGTVYSFDTRQGAVRVTGASLRALTTDEATLPREVMYCCDEHAEVTPRLLGAA
FT                   SRMQLLCAQASLDYASTLLRTGDADPRMLGVIWEALVGVPQWRSVLHQYSTLRQVRELM
FT                   VRIDDLLVAIGDAAA"
FT                   /protein_id="YP_001585341.1"
FT   gene            complement(69123..69887)
FT                   /db_xref="GeneID:5771013"
FT                   /locus_tag="Bmul_5380"
FT   CDS_pept        complement(69123..69887)
FT                   /locus_tag="Bmul_5380"
FT                   /gene_family="HOG000179638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5715 2-keto-4-pentenoate
FT                   hydratase-like protein"
FT                   /db_xref="GI:161522413"
FT                   /db_xref="GeneID:5771013"
FT                   /translation="MTTTIERVDGAAQHLVAARHAGAPGPLLPDAFRPEDVDTALAIQH
FT                   RVADLLGEAIGGWKCALPPPERVVVAPIFASTIREAGAPYRVVTSTPSVRIEPEIAFVL
FT                   DRDLPTRAQPYSDADVRDAIREVRLVLEVLGCRYAEPARATKLELLADAQFNQGLCVGP
FT                   VVRDGLHASLEAFEIAFEGELHRTIDGRHPDGDPLKPLVWLANFAASRGEPLRAGQIVT
FT                   TGSYAGAIEVPLGDALTVRFGELGSLAVTLTA"
FT                   /protein_id="YP_001585342.1"
FT   misc_feature    complement(69141..69878)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:187031"
FT                   /locus_tag="Bmul_5380"
FT   gene            70144..70632
FT                   /db_xref="GeneID:5771014"
FT                   /locus_tag="Bmul_5381"
FT   CDS_pept        70144..70632
FT                   /locus_tag="Bmul_5381"
FT                   /gene_family="HOG000238897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UspA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UspA domain protein; KEGG: bvi:Bcep1808_5654
FT                   UspA domain protein"
FT                   /db_xref="GI:161522414"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="GeneID:5771014"
FT                   /translation="MYNTIMVAFDGSASSKHALDEALKIAKANGAQVAVVYVVDRSALF
FT                   AYAGRFDPQALVDELRRDGIDALRAAEHAIRQASVNGDTGLVETDGLGEDVAARLQRYA
FT                   NEHDVDLAVVGTHGRRGIQRMLLGSVAERFVRRACCPVLLIRGERAPASSDVGSGADA"
FT                   /protein_id="YP_001585343.1"
FT   misc_feature    70153..70578
FT                   /note="Usp: Universal stress protein family. The universal
FT                   stress protein Usp is a small cytoplasmic bacterial protein
FT                   whose expression is enhanced when the cell is exposed to
FT                   stress agents. Usp enhances the rate of cell survival
FT                   during prolonged exposure to...; Region: USP_Like; cd00293"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Bmul_5381"
FT   misc_feature    order(70165..70173,70255..70257,70483..70488,70492..70497,
FT                   70525..70536)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Bmul_5381"
FT   gene            70629..70823
FT                   /db_xref="GeneID:5770646"
FT                   /locus_tag="Bmul_5382"
FT   CDS_pept        70629..70823
FT                   /locus_tag="Bmul_5382"
FT                   /gene_family="HOG000217131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5713 hypothetical protein"
FT                   /db_xref="GI:161522415"
FT                   /db_xref="GeneID:5770646"
FT                   /translation="MMSGRPSKIVIATVAVFVTLLGMMAVVVGLLFDEPTALHGGAIAL
FT                   IVGVCGFVVMLNVADKRDA"
FT                   /protein_id="YP_001585344.1"
FT   sig_peptide     70629..70718
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.454 at
FT                   residue 30"
FT                   /locus_tag="Bmul_5382"
FT                   /product="hypothetical protein"
FT   misc_feature    70650..70805
FT                   /note="Protein of unknown function (DUF2964); Region:
FT                   DUF2964; pfam11177"
FT                   /db_xref="CDD:151619"
FT                   /locus_tag="Bmul_5382"
FT   gene            71081..74857
FT                   /db_xref="GeneID:5770647"
FT                   /locus_tag="Bmul_5383"
FT   CDS_pept        71081..74857
FT                   /locus_tag="Bmul_5383"
FT                   /gene_family="HOG000237341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: bam:Bamb_5711 nitrate
FT                   reductase, alpha subunit"
FT                   /db_xref="GI:161522416"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="GeneID:5770647"
FT                   /translation="MSHFLDRLRYFTTARPRFSDGHGAVTDEDRQWEDGYRLRWQHDKV
FT                   VRSTHGVNCTGSCSWKVYVKGGIVTWETQQTDYPRTRPDMPNHEPRGCSRGASYSWYLY
FT                   SANRLKHPLVRSALVKLWRERRRTMAPVEAWRSIVDDDEARRAYQSRRGLGGFVRASWD
FT                   EVNEIVAAANVHTVGRHGPDRVVGFSPIPAMSMVSYAAGSRYLSLIGGVCLSFYDWYCD
FT                   LPPASPQTWGEQTDVPESADWYNSTFIMMWGSNVPQTRTPDAHFLVEARYRGTKVVSVF
FT                   PDYSEGAKFGDLWLHPKQGTDAALALAMGHVILKEFHLAGPTRSDYFVDYCKRYTDMPC
FT                   LVRLVPHGDGYVPERLVRASDFDDALDEAAHPEWKTVMIDDATGEFVVPVGSVGFRWAQ
FT                   QGAADAGKWNLRSETSGGAALSPRLSCTTEHDDVVEVRFPYFGNQPHAHFNSTQHRAEL
FT                   SRRIGVRRIATRNGEMLVATVYDLFVANYGLDQGLGGRDVAASYDDDLPYTPAWQEAIT
FT                   GVKRADVIAVARQFAENAHKTQGKSMVIIGAGINHWFHMDMSYRAIINMLIMCGCIGKP
FT                   GGGWSHYVGQEKLRPQTGWTALAFALDWHRPPRHMNSTSFFYAHTDQWRYDPMDPAALL
FT                   SPLADPSQFQGAPIDYNVRAERMGWLPSAPQLARNPLQVGAQLADPAQAGAEIAQQLKS
FT                   GTLRMACEDPDAPENHPRNLFVWRSNLLGSSGKGHEYFLKHLLGTTHGVQGEDLGATGG
FT                   RRPDEVTWRDDAPRGKLDLLVTLDFRMSTTCMYSDVVLPTATWYEKDDMNTSDMHPFIH
FT                   PLSAAVDPAWEAKSDWEIFKGIAKRFSELCDGHLGVERDVVLAPIAHDTPAELAQPFDV
FT                   RDWKRGECEPVPGRTMPSVAVVERDYPNTYARFTSLGPLMDTLGNAGKGIGWDTQDEVK
FT                   LLGELNYRVEAGATQGRPRIDTALDAAEVILALAPETNGEVAVKAWRALSRTTGIDHTH
FT                   LAAARADEKIRFRDIQAQPRKIISSPTWSGIESEHVSYNAGYVNVHELVPWRTLTGRQQ
FT                   LYQDHPWMRAFGESLCVYKPPIDTGSYAHMLGKRSNGNPERVLNFLTPHQKWGIHSTYT
FT                   DNLLMLTLSRGGPIVWMSEDDAKAIGVADNDWIECYNANGALCARAVVSQRIPAGMVMM
FT                   YHAQEKIVNTPGSEITGTRGGIHNSVTRIALKPTHMIGGYAQLSYGFNYYGTVGSNRDE
FT                   FLIVRKMNRIDWLDGEEHAGHPTTQAVREGEAS"
FT                   /protein_id="YP_001585345.1"
FT   misc_feature    71081..74791
FT                   /note="Nitrate reductase alpha subunit [Energy production
FT                   and conversion]; Region: NarG; COG5013"
FT                   /db_xref="CDD:34618"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    71207..>72106
FT                   /note="Respiratory nitrate reductase A (NarGHI), alpha
FT                   chain (NarG) and related proteins. Under anaerobic
FT                   conditions in the presence of nitrate, E. coli synthesizes
FT                   the cytoplasmic membrane-bound quinol-nitrate
FT                   oxidoreductase (NarGHI), which reduces nitrate...; Region:
FT                   MopB_Nitrate-R-NarG-like; cd02750"
FT                   /db_xref="CDD:73319"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    order(71228..71230,71240..71242,71252..71254,71258..71260,
FT                   71357..71359)
FT                   /note="[4Fe-4S] binding site; other site"
FT                   /db_xref="CDD:73319"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    <72524..>72844
FT                   /note="Molybdopterin-Binding (MopB) domain of the MopB
FT                   superfamily of proteins, a  large, diverse, heterogeneous
FT                   superfamily of enzymes that, in general, bind molybdopterin
FT                   as a cofactor. The MopB domain is found in a wide variety
FT                   of molybdenum- and tungsten-...; Region:
FT                   Molybdopterin-Binding; cl09928"
FT                   /db_xref="CDD:158783"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    <73211..73594
FT                   /note="Molybdopterin-Binding (MopB) domain of the MopB
FT                   superfamily of proteins, a  large, diverse, heterogeneous
FT                   superfamily of enzymes that, in general, bind molybdopterin
FT                   as a cofactor. The MopB domain is found in a wide variety
FT                   of molybdenum- and tungsten-...; Region:
FT                   Molybdopterin-Binding; cl09928"
FT                   /db_xref="CDD:158783"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    <74192..74284
FT                   /note="Molybdopterin-Binding (MopB) domain of the MopB
FT                   superfamily of proteins, a  large, diverse, heterogeneous
FT                   superfamily of enzymes that, in general, bind molybdopterin
FT                   as a cofactor. The MopB domain is found in a wide variety
FT                   of molybdenum- and tungsten-...; Region:
FT                   Molybdopterin-Binding; cl09928"
FT                   /db_xref="CDD:158783"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    74348..74770
FT                   /note="Respiratory nitrate reductase A (NarGHI), alpha
FT                   chain (NarG) and related proteins. Under anaerobic
FT                   conditions in the presence of nitrate, E. coli synthesizes
FT                   the cytoplasmic membrane-bound quinol-nitrate
FT                   oxidoreductase (NarGHI), which reduces nitrate...; Region:
FT                   MopB_CT_Nitrate-R-NarG-like; cd02776"
FT                   /db_xref="CDD:30308"
FT                   /locus_tag="Bmul_5383"
FT   misc_feature    order(74363..74374,74381..74395,74582..74584,74648..74650,
FT                   74744..74749)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30308"
FT                   /locus_tag="Bmul_5383"
FT   gene            74854..76389
FT                   /db_xref="GeneID:5770648"
FT                   /locus_tag="Bmul_5384"
FT   CDS_pept        74854..76389
FT                   /locus_tag="Bmul_5384"
FT                   /gene_family="HOG000237353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrate reductase, beta subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   bam:Bamb_5710 nitrate reductase, beta subunit"
FT                   /db_xref="GI:161522417"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="GeneID:5770648"
FT                   /translation="MKVRAQIAMVLNLDKCIGCHTCSVTCKNVWTSREGMEYAWFNNVE
FT                   TKPGIGYPKDWENQDRWRGGWQRRADGKIEPRLGSKWRLLAQIFANPHLPEIDDYYEPF
FT                   TFDYAHLQEAGNTNAMPVARPRSLVSGQRLEKIEWGPNWEEILGGEFEKRAQDYNFEDV
FT                   QKEIYGQFENTFMMYLPRLCEHCLNPACVASCPSGSIYKREEDGIVLIDQDKCRGWRMC
FT                   VSGCPYKKIYYNWQSGKAEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADRIGE
FT                   AASVENDKDLYDAQLSLFLDPDDPAVIAQAERDGVPAAWLEAARRSPTYKMAIDWKIAF
FT                   PLHPEYRTLPMVWYVPPLSPINAAANSGTLGMNGYLPDVESLRIPLRYLANLLTAGDEA
FT                   PVKLALERLLAMRAFMRARHVDGIEARGVLDQVGLSVAQVDEMYRYLAIANYEDRFVIP
FT                   TTHREYAENAYDLRASCGFSFGNGCSDGRSSASLFSAKKEKGTKTIPIREVSR"
FT                   /protein_id="YP_001585346.1"
FT   misc_feature    74854..76332
FT                   /note="nitrate reductase, beta subunit; Region: narH;
FT                   TIGR01660"
FT                   /db_xref="CDD:130721"
FT                   /locus_tag="Bmul_5384"
FT   gene            76386..77078
FT                   /db_xref="GeneID:5770671"
FT                   /locus_tag="Bmul_5385"
FT   CDS_pept        76386..77078
FT                   /locus_tag="Bmul_5385"
FT                   /gene_family="HOG000237365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   KEGG: bam:Bamb_5709 nitrate reductase molybdenum cofactor
FT                   assembly chaperone"
FT                   /db_xref="GI:161522418"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="GeneID:5770671"
FT                   /translation="MSSAPDPTYAAFAALLDYPDDALVDALDSIEAHLRDGTRTRWPKA
FT                   VRTGLERFFAYLRERDLLTLQENYVALFDRGRATSLHLFEHVHGESRDRGQAMVDLLQM
FT                   YEQHGLYLKPGELPDYLPVFLEYLSRLPAPDARNLLGETGDILRALAAQLAQRGSHYSF
FT                   VVGALLPMAGLAPADAPTSAADDAAAERPDYRGLDAAYADEAVRFVGAATPAEQTVQFH
FT                   DRRPARRA"
FT                   /protein_id="YP_001585347.1"
FT   misc_feature    76407..76880
FT                   /note="Nitrate reductase delta subunit; Region:
FT                   Nitrate_red_del; cl00958"
FT                   /db_xref="CDD:186283"
FT                   /locus_tag="Bmul_5385"
FT   gene            77104..77787
FT                   /db_xref="GeneID:5770672"
FT                   /locus_tag="Bmul_5386"
FT   CDS_pept        77104..77787
FT                   /locus_tag="Bmul_5386"
FT                   /gene_family="HOG000237376" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="KEGG: bam:Bamb_5708 respiratory nitrate reductase,
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit; PFAM: Nitrate reductase gamma subunit"
FT                   /db_xref="GI:161522419"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="GeneID:5770672"
FT                   /translation="MNDYLHTFLFGIYPYICLAVLLLGSLIRFDREQYTWKSDSSQLLR
FT                   HGALRLGSNLFHWGVLVVVLGHFAGFLAPHWLVSPFLSASGHQLVAMVAGGAAGLVSIV
FT                   GLTILIWRRLGDVRIRRSSRQSDIVIVLMLWLQLALGLGTVVLSTRHMDGAMFEQLTDY
FT                   VKGVVTFRPDVASLLVGVPLTYRLHILLGFTIFLVSPFTRMVHIWSGIASVAYLVRPYQ
FT                   LVRKR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585348.1"
FT   misc_feature    77113..77784
FT                   /note="Nitrate reductase gamma subunit; Region:
FT                   Nitrate_red_gam; cl00959"
FT                   /db_xref="CDD:163938"
FT                   /locus_tag="Bmul_5386"
FT   gene            77797..78585
FT                   /db_xref="GeneID:5770673"
FT                   /locus_tag="Bmul_5387"
FT   CDS_pept        77797..78585
FT                   /locus_tag="Bmul_5387"
FT                   /gene_family="HOG000146309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bam:Bamb_5707 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="GI:161522420"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="GeneID:5770673"
FT                   /translation="MNDVLSEAATAPLVVNGIAIGDDAIAAEAEHHGDARDPLDAARHA
FT                   LAVRELLRQRAVSLALLDEGAPLDDAALDALLARELTHVPEPDRADCERYYAQHPARFR
FT                   RNDIVYASHVLFAVTDRVPLAPLRQRAERALADVVAAPDTFDAVARASSNCPSAQVGGS
FT                   LGQVLRGDTVPEFEAALFDTDGLGVLPKLVNTRFGFHIVRIDRRVAGDTVPFDAVAAQI
FT                   AAHLTARVRQRAMRQYVAILAGGARIEGVRFDGANGPLVQ"
FT                   /protein_id="YP_001585349.1"
FT   misc_feature    78133..78414
FT                   /note="PPIC-type PPIASE domain; Region: Rotamase; cl08278"
FT                   /db_xref="CDD:186815"
FT                   /locus_tag="Bmul_5387"
FT   gene            78603..79871
FT                   /db_xref="GeneID:5770595"
FT                   /locus_tag="Bmul_5388"
FT   CDS_pept        78603..79871
FT                   /locus_tag="Bmul_5388"
FT                   /gene_family="HOG000237389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_5706 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:161522421"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:5770595"
FT                   /translation="MAIRQQQSPVPPAGAPAIPLRAWSVLAGSTLAFIVCFVVWMMFGV
FT                   LGVQLRTELGLNSTEFGLLTSTPVLTGALMRLPLGTWTDRFGGRIVMTVLLVVCAVPVY
FT                   LVSYANALWQFLVIGLFLGCVGASFAVGTPYVARFFPPERRGLAMGVFGAGTCGAAVNL
FT                   FVTPLLLSAYGWRTVPRVYAVALLVTAVIFWLMSARDPGAGKAAGSWLDSFKVLRDPRV
FT                   WRLCQYYSITFGGFTALSLWIPQYLKAEYGMSLVMASAFAAGFSLPGSVLRALGGALAD
FT                   RFGAHAVTWWGLWVAWICLFLLSYPATDFVIHTIDGTAAINVSMPVAGFVALTFVLGAV
FT                   FALGMASTFKYVADDFPDNMGVVTGIVGLAGGLGGFLLPILFGLLLDLLRVRTTCFMLL
FT                   YGVVWVSLILIYLSEVRRTPVTG"
FT                   /protein_id="YP_001585350.1"
FT   misc_feature    78663..79865
FT                   /note="Nitrate/nitrite transporter [Inorganic ion transport
FT                   and metabolism]; Region: NarK; COG2223"
FT                   /db_xref="CDD:32405"
FT                   /locus_tag="Bmul_5388"
FT   misc_feature    78678..79649
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5388"
FT   misc_feature    order(78720..78722,78729..78737,78741..78746,78795..78797,
FT                   78804..78809,78816..78818,78828..78833,78837..78842,
FT                   78978..78983,78990..78995,79002..79004,79011..79013,
FT                   79047..79052,79059..79064,79077..79079,79299..79301,
FT                   79308..79313,79320..79325,79332..79334,79374..79376,
FT                   79386..79388,79398..79400,79407..79409,79419..79421,
FT                   79560..79562,79569..79574,79581..79583,79593..79598,
FT                   79605..79607,79638..79643)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5388"
FT   gene            79980..81707
FT                   /db_xref="GeneID:5770596"
FT                   /locus_tag="Bmul_5389"
FT   CDS_pept        79980..81707
FT                   /locus_tag="Bmul_5389"
FT                   /gene_family="HOG000220306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bur:Bcep18194_C6948 phage integrase"
FT                   /db_xref="GI:161522422"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:5770596"
FT                   /translation="MKPRVTLLSSSDPVPAPAGFPDADELAALRAWYAGMPVRDAVERY
FT                   LPDRLGNGRSARGVIGGIRRRLVRIAREVGRPDLAACLAHPDGERLREAKAATDAIGVL
FT                   RHARAPVPQIGDAIDAWLPARAVAALRAHGIATLADLTVRIPRRRQWWKAIAGLGLAGA
FT                   RRIEAFFAAHPALTERARALIAATPRGTIVPWEQLKLPHEVDGSAGTFRAPRATCTLDA
FT                   DNDYAAVHAWLSLHESAATRRAYRKEAERLILWAIVERGRALSSLTTEDALAYRAFLRR
FT                   PTPHERWIGPVRPRGAPDWRPFSGALSARSAAYALSVLGAMFRWLIEQRYVLANPFAGV
FT                   KVRDSRGASALDTSHAFTEGEWLLVRTIADGLEFRKTDVPAAAWTPAAAQRLRFILDFG
FT                   YATGLRASELVGATLGDIDTDAHGDAWLKVVGKGSKAARVALPPLARTALDRYLVARRL
FT                   PVTPVRWRPDTPLISRLTEDGAAPITSVRLWKVMQRFFVQTADLVEADNPALAQKLRQA
FT                   SPHWMRHTHATHALARGAELTTVRDNLRHASISTTSIYLHGDDVKRARQLASAFAADK"
FT                   /protein_id="YP_001585351.1"
FT   misc_feature    80286..80564
FT                   /note="Phage integrase protein; Region: DUF3701; pfam12482"
FT                   /db_xref="CDD:152916"
FT                   /locus_tag="Bmul_5389"
FT   misc_feature    80637..81656
FT                   /note="Site-specific recombinase XerC [DNA replication,
FT                   recombination, and repair]; Region: XerC; COG4973"
FT                   /db_xref="CDD:34579"
FT                   /locus_tag="Bmul_5389"
FT   misc_feature    81045..81650
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bmul_5389"
FT   misc_feature    order(81192..81194,81273..81275,81537..81539,81546..81548,
FT                   81615..81617,81642..81644)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bmul_5389"
FT   gene            82072..82983
FT                   /db_xref="GeneID:5770597"
FT                   /locus_tag="Bmul_5390"
FT   CDS_pept        82072..82983
FT                   /locus_tag="Bmul_5390"
FT                   /gene_family="HOG000268063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5703 hypothetical protein"
FT                   /db_xref="GI:161522423"
FT                   /db_xref="GeneID:5770597"
FT                   /translation="MELSERLRPMRFAGLAARALVALCCIAWSALSFGADGAAALLERY
FT                   HSLGDQLKNNPFHRPLYLESSEAASTLKGDIYAVVDYPFQVVNGKLNDPAQGPANWCAV
FT                   LILHLNTKYCHASSGGNGAVLDVNIGRKTEQKLSDTYRLQFRYRVAAATPDYFQVDLTA
FT                   DSGPMSTKDYRIALEAVPLGESRTFLHLTYSYGFGTVGRLAMKTYLSTIGSDKVGFTTV
FT                   ADASGGKPHYVGGVRGLLERNTMRYYLAIDAYLATLDKPLDQRLVRWFDATEQYPRQLH
FT                   EVDRSDYLQMKAQEVQRQQTAR"
FT                   /protein_id="YP_001585352.1"
FT   sig_peptide     82072..82176
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.830 at
FT                   residue 35"
FT                   /locus_tag="Bmul_5390"
FT                   /product="hypothetical protein"
FT   gene            complement(83071..84393)
FT                   /db_xref="GeneID:5770878"
FT                   /locus_tag="Bmul_5391"
FT   CDS_pept        complement(83071..84393)
FT                   /locus_tag="Bmul_5391"
FT                   /gene_family="HOG000268726" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HipA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: reh:H16_A2073 hypothetical protein"
FT                   /db_xref="GI:161522424"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="GeneID:5770878"
FT                   /translation="MTERTLIAAIGAEPIGTLHENRNLWAFEYAPSWLAHPAHFALSPH
FT                   LPLQADMLRDGATTRPVQWYFDNLLPEEAVRALLARDAGLPDIGDAFALLEHYGRESAG
FT                   SVTLRLPDDAADDDTTLRPLDAAALDARIRALPAVPLTHDAPKKMSLAGAQHKLPVVLR
FT                   DGRLFEPSGQAVSTHILKPNHPHAHDYPHSVVNEWFVMTLARRVGLDVPDVERRYVPAP
FT                   VYVIRRFDRIDTDAGVERRHAIDGCQVLNLPATMKYTGWSLDALAALANACRAPAPVRL
FT                   RIFRWLVFCVIVGNGDSHLKNLSFIVGDSGLALAPHYDLLCDSVYETAAYSARGRWPDL
FT                   TEFTRPVAGVQRYADFTRDVLERAGAALGLTRATAQRHLDTLVAQIPAHADALLAEVAR
FT                   ENDAMRDARPELTATLGGEMHLLRAIRHIVIQEMVERLRPR"
FT                   /protein_id="YP_001585353.1"
FT   misc_feature    complement(84076..84381)
FT                   /note="HipA N-terminal domain; Region: couple_hipA;
FT                   TIGR03071"
FT                   /db_xref="CDD:163125"
FT                   /locus_tag="Bmul_5391"
FT   misc_feature    complement(83701..83946)
FT                   /note="HipA-like N-terminal domain; Region: HipA_N;
FT                   pfam07805"
FT                   /db_xref="CDD:149074"
FT                   /locus_tag="Bmul_5391"
FT   misc_feature    complement(83437..83676)
FT                   /note="HipA-like C-terminal domain; Region: HipA_C;
FT                   pfam07804"
FT                   /db_xref="CDD:149073"
FT                   /locus_tag="Bmul_5391"
FT   gene            complement(84386..84937)
FT                   /db_xref="GeneID:5770879"
FT                   /locus_tag="Bmul_5392"
FT   CDS_pept        complement(84386..84937)
FT                   /locus_tag="Bmul_5392"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   rso:RSc2661 putative transcription regulator protein"
FT                   /db_xref="GI:161522425"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:5770879"
FT                   /translation="MRYTIEQASDIGGVIRAARKAQQLRQDDAAGSVGVSESFMVKAER
FT                   GADTVQWGKVFQILQGLGVQVVVDLPDVSGELLERQSARAAQRAEIRARRAAERLLLRA
FT                   DAAAPASDRRAGERTTDARVLAAARLVLAAGTAPRGARSGKRADTGASRAHDIARRVLA
FT                   EAGEAPPPVARTNDGEASHD"
FT                   /protein_id="YP_001585354.1"
FT   misc_feature    complement(84761..84913)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Bmul_5392"
FT   gene            85416..86840
FT                   /db_xref="GeneID:5770880"
FT                   /locus_tag="Bmul_5393"
FT   CDS_pept        85416..86840
FT                   /locus_tag="Bmul_5393"
FT                   /gene_family="HOG000133006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_C6954 transcriptional
FT                   regulator, GntR family, contains an aminotransferase
FT                   domain"
FT                   /db_xref="GI:161522426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:5770880"
FT                   /translation="MKLYEKLADDIERLIRQGVYRHGDRIPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDAHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVEFATRVNMPL
FT                   IENGVYNELYFGDSHPSTLKSYDRSGIVLHCSSFSKSLTAAYRIGWALPGRYRDQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRLRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWIELPAQVDAMRLYQLALDEGITIGPGYMFSITDNYRNFIRLNYSSPWSPEI
FT                   EQAVITVGKLAAGCVR"
FT                   /protein_id="YP_001585355.1"
FT   misc_feature    85416..86822
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    85419..85616
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    order(85419..85421,85425..85427,85494..85496,85500..85505,
FT                   85527..85541,85545..85550,85557..85559,85587..85592,
FT                   85596..85607)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    85746..86801
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    order(85953..85961,86031..86033,86181..86183,86274..86276,
FT                   86355..86357,86361..86366,86385..86387)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    order(85962..85964,86061..86063,86253..86255,86379..86387,
FT                   86469..86471,86478..86480)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5393"
FT   misc_feature    86364..86366
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5393"
FT   gene            complement(86862..87215)
FT                   /db_xref="GeneID:5770939"
FT                   /locus_tag="Bmul_5394"
FT   CDS_pept        complement(86862..87215)
FT                   /locus_tag="Bmul_5394"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1367 protein of unknown
FT                   function DUF81"
FT                   /db_xref="GI:161522427"
FT                   /db_xref="GeneID:5770939"
FT                   /translation="MDLAISAAASLPAIAGMQVVRPLRDRMSPTLFRRVVLRFVLVAAL
FT                   QMIWKSGVLPHASAIRQRVRMGSESSQAYDGQAGRIAGTVPLQRFDMETYLLLGCGLGV
FT                   GLLIAIWGVWSLR"
FT                   /protein_id="YP_001585356.1"
FT   gene            complement(87262..87519)
FT                   /db_xref="GeneID:5770940"
FT                   /locus_tag="Bmul_5395"
FT   CDS_pept        complement(87262..87519)
FT                   /locus_tag="Bmul_5395"
FT                   /gene_family="HOG000280988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: bch:Bcen2424_6402 thiamineS
FT                   protein"
FT                   /db_xref="GI:161522428"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010034"
FT                   /db_xref="GeneID:5770940"
FT                   /translation="MKLTIKYFASIREQLQVDEETVDIDASELTVDALRGTLAARDARS
FT                   ADALRMDRPVRAAVNLEMVTGDFVVRDDSEVAFFPPVTGG"
FT                   /protein_id="YP_001585357.1"
FT   misc_feature    complement(87265..87510)
FT                   /note="Ubiquitin domain of MoaD-like proteins; Region:
FT                   MoaD; cd00754"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Bmul_5395"
FT   misc_feature    complement(order(87265..87267,87274..87282,87295..87297,
FT                   87340..87342,87481..87486,87490..87498))
FT                   /note="MoaE interaction surface; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Bmul_5395"
FT   misc_feature    complement(order(87265..87267,87274..87276,87280..87282,
FT                   87481..87486,87493..87498))
FT                   /note="MoeB interaction surface; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Bmul_5395"
FT   misc_feature    complement(87265..87267)
FT                   /note="thiocarboxylated glycine; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Bmul_5395"
FT   gene            complement(87525..88088)
FT                   /db_xref="GeneID:5770941"
FT                   /locus_tag="Bmul_5396"
FT   CDS_pept        complement(87525..88088)
FT                   /locus_tag="Bmul_5396"
FT                   /gene_family="HOG000280876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   bam:Bamb_5689 molybdopterin biosynthesis MoaE"
FT                   /db_xref="GI:161522429"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="GeneID:5770941"
FT                   /translation="MTTFTEPHAEPPDDPLRGEHPPETAVPHGTPLPAIAAGFEVRVQY
FT                   QPIDAGVELAPIVRNPHVGAVVNFLGVVRNEGDIDDVVALEVEHYPTMTEQALWSIVEE
FT                   ATARWQLETVRIVHRVGRIPLGHPVVLVVVAAAHRAAAFDACEFLMDFLKTHAPFWKKE
FT                   IRQDGASGWVEAKALDDHAMRRWG"
FT                   /protein_id="YP_001585358.1"
FT   misc_feature    complement(87570..87947)
FT                   /note="MoaE family. Members of this family are involved in
FT                   biosynthesis of the molybdenum cofactor (Moco), an
FT                   essential cofactor for a diverse group of redox enzymes.
FT                   Moco biosynthesis is an evolutionarily conserved pathway
FT                   present in eubacteria, archaea and...; Region: MoaE;
FT                   cd00756"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Bmul_5396"
FT   misc_feature    complement(order(87636..87638,87648..87650,87672..87674,
FT                   87678..87680,87705..87707,87867..87869,87873..87875,
FT                   87879..87893,87897..87899,87912..87914,87927..87929))
FT                   /note="MoaE homodimer interface; other site"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Bmul_5396"
FT   misc_feature    complement(order(87573..87575,87606..87614,87618..87620,
FT                   87624..87629,87735..87737,87789..87791,87801..87803,
FT                   87810..87812,87819..87821,87825..87827))
FT                   /note="MoaD interaction; other site"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Bmul_5396"
FT   misc_feature    complement(order(87606..87608,87627..87629))
FT                   /note="active site residues"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Bmul_5396"
FT   gene            complement(88134..89360)
FT                   /db_xref="GeneID:5770945"
FT                   /locus_tag="Bmul_5397"
FT   CDS_pept        complement(88134..89360)
FT                   /locus_tag="Bmul_5397"
FT                   /gene_family="HOG000228681" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6404 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="GI:161522430"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="GeneID:5770945"
FT                   /translation="MPLPADARALSSREGSPRPVHPHATAPRRRPAHPMQADEPIVNAI
FT                   ASAAPAGAAVSGDAASDALLRTVDTLDRPLRDLRLSVIDRCNFRCGYCMPREIFGSDYA
FT                   FMPPADRLSFAQLERIARAFVSLGVEKIRITGGEPLLRRHLETLIERLAALTTVDGRPV
FT                   ELALTTNGALLAAKARTLRDAGLTRVTVSLDALDDAVFRRMSDADVPVSRVLAGIEAAQ
FT                   AAGLAPVKVNAVIERGANDDQILPLVRHFRHTGVSVRFIEYMDVGGAYGWSHDKVVTAT
FT                   RMRELIDAEYPLVTVGGPAHDATAIRCRHVDGGGEVGFIASVSHPFCGTCSRARVSADG
FT                   TLYTCLFATQGTDLRPWLDDATPLDGLAAAVRARWTQRGDRASEQRAARAARTPRHPYP
FT                   TVRMSLVGG"
FT                   /protein_id="YP_001585359.1"
FT   misc_feature    complement(88137..89120)
FT                   /note="molybdenum cofactor biosynthesis protein A;
FT                   Reviewed; Region: moaA; PRK00164"
FT                   /db_xref="CDD:178909"
FT                   /locus_tag="Bmul_5397"
FT   misc_feature    complement(88494..89111)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Bmul_5397"
FT   misc_feature    complement(order(88572..88574,88581..88583,88659..88661,
FT                   88785..88787,88863..88871,88947..88952,88956..88958,
FT                   89079..89087,89091..89093,89097..89099,89103..89105))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Bmul_5397"
FT   misc_feature    complement(88218..88589)
FT                   /note="Molybdenum Cofactor Synthesis C; Region:
FT                   Mob_synth_C; pfam06463"
FT                   /db_xref="CDD:115139"
FT                   /locus_tag="Bmul_5397"
FT   gene            complement(89419..90633)
FT                   /db_xref="GeneID:5770946"
FT                   /locus_tag="Bmul_5398"
FT   CDS_pept        complement(89419..90633)
FT                   /locus_tag="Bmul_5398"
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molybdenum cofactor synthesis domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: bur:Bcep18194_C6966 molybdopterin binding protein,
FT                   MoeA"
FT                   /db_xref="GI:161522431"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="GeneID:5770946"
FT                   /translation="MKPLLDFDTAQQYFATAFAPLDAAVTVPLADAVGRILAAPLFASL
FT                   DQPPVDQSAMDGYAVRAADLAGAEPLRVAQRCYAGDAPAPLAPRTAARIFTGAPIPAGA
FT                   DTVVMQEHAHERDGCVTFDAPPRAGTHIRRRAEELRAGDLLIPAGVRLGAMHVGVAAAQ
FT                   GVSTLDVRPPLRVGILTTGDELVACGAPRAPQQIYNSNAPMLAALVAGTGAAVVANLHA
FT                   QDTADAVERALRDLHARCELVVCVGGASVGDKDLLRGTLNALGAAFVVSGVRMKPGKPV
FT                   ALARLDARPVVLLPGNPGAATTAFALFVAPLIRRLQGRAERLPVVPSLPLDIDVEPDPQ
FT                   RERFIRVRCDVAPNGLPLLDALRQQGAGTLNSLAHASGLARVPAGERIARGEPVPYYDF
FT                   ARWLA"
FT                   /protein_id="YP_001585360.1"
FT   misc_feature    complement(89428..90633)
FT                   /note="Molybdopterin biosynthesis enzyme [Coenzyme
FT                   metabolism]; Region: MoeA; COG0303"
FT                   /db_xref="CDD:30651"
FT                   /locus_tag="Bmul_5398"
FT   misc_feature    complement(89437..90606)
FT                   /note="MoeA family. Members of this family are involved in
FT                   biosynthesis of the molybdenum cofactor (MoCF), an
FT                   essential cofactor of a diverse group of redox enzymes.
FT                   MoCF biosynthesis is an evolutionarily conserved pathway
FT                   present in eubacteria, archaea and...; Region: MoeA;
FT                   cd00887"
FT                   /db_xref="CDD:58168"
FT                   /locus_tag="Bmul_5398"
FT   misc_feature    complement(order(89449..89451,89530..89532,89653..89655,
FT                   90025..90027,90034..90036,90040..90042,90142..90144,
FT                   90148..90153,90160..90162,90166..90177,90220..90222,
FT                   90544..90546))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:58168"
FT                   /locus_tag="Bmul_5398"
FT   misc_feature    complement(order(89890..89892,89962..89964,90082..90084,
FT                   90088..90093))
FT                   /note="putative functional site; other site"
FT                   /db_xref="CDD:58168"
FT                   /locus_tag="Bmul_5398"
FT   misc_feature    complement(order(89725..89727,89734..89736,89746..89751,
FT                   89884..89892))
FT                   /note="putative MPT binding site; other site"
FT                   /db_xref="CDD:58168"
FT                   /locus_tag="Bmul_5398"
FT   gene            complement(90630..91484)
FT                   /db_xref="GeneID:5770947"
FT                   /locus_tag="Bmul_5399"
FT   CDS_pept        complement(90630..91484)
FT                   /locus_tag="Bmul_5399"
FT                   /gene_family="HOG000079468" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: bch:Bcen2424_6406 formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="GI:161522432"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="GeneID:5770947"
FT                   /translation="MESCVRDEAPAGSISCHVTRHRAGASQRVVDRVVDRVVDECPVAL
FT                   VFNGIAHTVMMATPIDLDAFGVGFALSEGIVERASDVFDIDTVYRAGSAEVQLTVSQQA
FT                   FMALKAHRRALAGRTGCGVCGIESIAQLDLHPPRIAAAGSAADIAAAAVARAARTLPAR
FT                   QTLMHATGGIHAAAWCDRDGNVLDVFEDVGRHNALDKLIGCLARRRADFGAGFVFLSSR
FT                   ASYELVRKAARVGIPMLATISAPTSLAIDVAREAGIRLLGFCRNDGFVEYVSPAATLST
FT                   LSR"
FT                   /protein_id="YP_001585361.1"
FT   misc_feature    complement(90669..91436)
FT                   /note="FdhD/NarQ family; Region: FdhD-NarQ; cl00659"
FT                   /db_xref="CDD:186130"
FT                   /locus_tag="Bmul_5399"
FT   gene            91906..93306
FT                   /db_xref="GeneID:5770421"
FT                   /locus_tag="Bmul_5400"
FT   CDS_pept        91906..93306
FT                   /locus_tag="Bmul_5400"
FT                   /gene_family="HOG000084937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bam:Bamb_5685 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="GI:161522433"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="GeneID:5770421"
FT                   /translation="MEIFDAFHLARLQFAFTVSFHIVFPAISIGMASFLAVLEWRYLVT
FT                   GDAAYKSMFQFWSKIFAIGFGMGVVSGVVMAYEFGTNWSGFSRIAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWQRVSPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGYRIEN
FT                   GLVVPVDWFKVVFNPSFPYRLVHMTIAAFIVAGFIVAACGAWHLLKGRRDEPVKRSFSM
FT                   ALWMLLLLAPIQIVVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLVGLPDMQAET
FT                   TRYAIQVPHLGSLILTHSWDGEIRGLKEFAPQDRPYSPVVFWTFRIMAGLGMLMLLTAL
FT                   LGLLLRKGGRLYETRWFQWFVLCMGPSGIVALLAGWITTEVGRQPWTVYGVLRTVDSVS
FT                   PLTAQQVGVSLLVFVVVYFLVFGTGIYYMMKLMKHGPAAQAGYIELHRHPGLRNRALST
FT                   SLDTAEAE"
FT                   /protein_id="YP_001585362.1"
FT   misc_feature    91930..93213
FT                   /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
FT                   Bac_Ubq_Cox; cl00562"
FT                   /db_xref="CDD:186082"
FT                   /locus_tag="Bmul_5400"
FT   gene            93310..94317
FT                   /db_xref="GeneID:5770422"
FT                   /locus_tag="Bmul_5401"
FT   CDS_pept        93310..94317
FT                   /locus_tag="Bmul_5401"
FT                   /gene_family="HOG000084825" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   bch:Bcen2424_6408 cytochrome d ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="GI:161522434"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="GeneID:5770422"
FT                   /translation="MQIDLPVVWAAIIGLGVFLYVMLDGFDLGIGLLFPFFDAKAERQV
FT                   MLDTVAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLILMVVGLIFRGAAFELR
FT                   AKANRTQHMWDLAFMGGSALAAFCQGIVLGSLLQGIRIENNHFAGGPFDWLSPFSLFCG
FT                   IGVLVTYATLGCGWLILKVDGELQRKMRELMKPLTAVLLGVMAVVSLWTVIGLPAVAHR
FT                   WFGSGNLGWFLPVPVLVVACVWGIFHTVKYRHEATPFLLTLAIVFLGYTGLIISIWPNI
FT                   VPPSLSIWDASSSHSSQLFALVGTVIVLPVILVYNAMQYRVFRGKVREGDIGYH"
FT                   /protein_id="YP_001585363.1"
FT   misc_feature    93319..94281
FT                   /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
FT                   pfam02322"
FT                   /db_xref="CDD:145462"
FT                   /locus_tag="Bmul_5401"
FT   misc_feature    93433..94305
FT                   /note="cytochrome bd-II oxidase subunit 2; Provisional;
FT                   Region: PRK15028; cl12219"
FT                   /db_xref="CDD:187194"
FT                   /locus_tag="Bmul_5401"
FT   gene            94420..95340
FT                   /db_xref="GeneID:5770423"
FT                   /locus_tag="Bmul_5402"
FT   CDS_pept        94420..95340
FT                   /locus_tag="Bmul_5402"
FT                   /gene_family="HOG000200177" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   bam:Bamb_5683 protein of unknown function UPF0187"
FT                   /db_xref="GI:161522435"
FT                   /db_xref="InterPro:IPR007913"
FT                   /db_xref="GeneID:5770423"
FT                   /translation="MIVRPRQNWLRMLFVWNGSVLQSIIPQLAFMAIVSTLAVFTNGRI
FT                   FGEKIPLNTAPFTLFGLALAIFLAFRNNASFERFKEARLLWGNLLIAARALTSQMRRYL
FT                   PDSVDDAQRNRLADWLIAFTYALKHELRHTDPLPDLERILGAERAGLLARKAYRPVAIL
FT                   DLLRGELVHALGRTPGSETICWMFDAQLDALGKTVGGCERILSTPIPFSYSVLLHRTVY
FT                   AYCVLLPFGLVDSTEFFTPLICVFISYTLIALEAIANEVAEPFGLAPNALALDAMTRTI
FT                   ERSVLELGERDLPEEYVPASTYQIT"
FT                   /protein_id="YP_001585364.1"
FT   misc_feature    94447..95277
FT                   /note="Bestrophin; Region: Bestrophin; cl01544"
FT                   /db_xref="CDD:154463"
FT                   /locus_tag="Bmul_5402"
FT   gene            complement(95394..95852)
FT                   /db_xref="GeneID:5770686"
FT                   /locus_tag="Bmul_5403"
FT   CDS_pept        complement(95394..95852)
FT                   /locus_tag="Bmul_5403"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5679 hypothetical protein"
FT                   /db_xref="GI:161522436"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="GeneID:5770686"
FT                   /translation="MARKKLALPRRLDGRPRAPGRARVRLGRSRSSVSRNVQTKRRAAR
FT                   CPRNGPRFTACGPTIVDGLRRAELVRCASFSLIVTPPRAGPAPLQQPPEPRARASNMKK
FT                   LMQYLRTLHRLDRTLVARACALLSMAALLYLMWPSAEIARLAMESTLR"
FT                   /protein_id="YP_001585365.1"
FT   gene            95963..97288
FT                   /db_xref="GeneID:5770687"
FT                   /locus_tag="Bmul_5404"
FT   CDS_pept        95963..97288
FT                   /locus_tag="Bmul_5404"
FT                   /gene_family="HOG000240760" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_C6991 flavin-containing monooxygenase FMO"
FT                   /db_xref="GI:161522437"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:5770687"
FT                   /translation="MTVETTAIDTLVVGAGQAGVAMSEHLGKLDVPHLVLERDRIAERW
FT                   RTARWDSLVANGPAWHDRFPGLEFDGLDPDAFASKDQVADYFEAYARKIGAPIRTGVEV
FT                   TSVVRQAGKPGFVVETSAGRFDAMRVVVATGPFQRPVIPPIAPRDARLTQIHSADYRNP
FT                   AQLPDGGVLVVGAGSSGVQIADELQRAGRRVYLSVGPHDRPPRAYRGRDFCWWLGVLGE
FT                   WDKEVATPGREHVTIAVSGARGGHTVDFRALANQGVTLVGMTRAFDGGVVTFEADLAAN
FT                   LARGDANYLALLDAADAYAARNGLDLPDEPEARRILPDPDCVAHPLATLDLAAAGVTSI
FT                   VWATGYAVDYGWLKVDAFAENGKPQHQRGVSKEPGIYFVGLPWLSRRGSSFIWGVWHDA
FT                   RHIADHIATQRKYLDYHTGAQRRAAQDAGTAPAACPLADALS"
FT                   /protein_id="YP_001585366.1"
FT   misc_feature    95975..97243
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="Bmul_5404"
FT   misc_feature    <96233..>96391
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bmul_5404"
FT   gene            97392..97841
FT                   /db_xref="GeneID:5770688"
FT                   /locus_tag="Bmul_5405"
FT   CDS_pept        97392..97841
FT                   /locus_tag="Bmul_5405"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bam:Bamb_5674
FT                   endoribonuclease L-PSP"
FT                   /db_xref="GI:161522438"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="GeneID:5770688"
FT                   /translation="MSEPTHTRIRMFNTRDTYPNQSLDNDLCQAVRAGNTVYVRGQVGT
FT                   DFDGNLIGLGDPRAQAEQAMKNVKQLLEEAGSDLTHIVKTTTYLIDPRYREPVYREVGK
FT                   WLKGVYPISTGLVVSALGQPQWLMEIDVIAVIPDNWQPNRTQEAA"
FT                   /protein_id="YP_001585367.1"
FT   misc_feature    97473..97793
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Bmul_5405"
FT   misc_feature    order(97473..97475,97482..97484,97488..97490,97497..97499,
FT                   97503..97505,97509..97514,97632..97634,97638..97643,
FT                   97647..97649,97653..97655,97686..97688,97695..97697,
FT                   97722..97745,97776..97778,97782..97784,97788..97790)
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Bmul_5405"
FT   misc_feature    order(97674..97676,97686..97688,97728..97730,97776..97778)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Bmul_5405"
FT   gene            97838..98515
FT                   /db_xref="GeneID:5770689"
FT                   /locus_tag="Bmul_5406"
FT   CDS_pept        97838..98515
FT                   /locus_tag="Bmul_5406"
FT                   /gene_family="HOG000035803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   bur:Bcep18194_C6993 protein of unknown function DUF1028"
FT                   /db_xref="GI:161522439"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="GeneID:5770689"
FT                   /translation="MTFSIVGRCPETGQLGIAISSSSIAVGARCPWVRAGVGAVATQNV
FT                   TLPALGPQILDRIEREQCAPRTALDRALSANGWSQYRQVTVIDGQGRTACFTGSEALGT
FT                   HHAATGEQCVAAGNLLASTGVIDAMVEAFERAHGLLADRLLAAMHAAVAAGGEAGPVHS
FT                   AALQVAGDLTWPIVDLRVDWADTAPIAQLDALWRAYRPQMHDYQTRALDPTAAPSYGVP
FT                   GDE"
FT                   /protein_id="YP_001585368.1"
FT   misc_feature    97841..98413
FT                   /note="Family of unknown function (DUF1028); Region:
FT                   DUF1028; pfam06267"
FT                   /db_xref="CDD:148087"
FT                   /locus_tag="Bmul_5406"
FT   gene            98508..99671
FT                   /db_xref="GeneID:5770690"
FT                   /locus_tag="Bmul_5407"
FT   CDS_pept        98508..99671
FT                   /locus_tag="Bmul_5407"
FT                   /gene_family="HOG000243772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetylornithine deacetylase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of L-ornithine from
FT                   N(2)-acetyl-L-ornithine"
FT                   /db_xref="GI:161522440"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:5770690"
FT                   /translation="MNDGASRALLERLIGFATVSRDSNLAMIDFIRDYLRGFGIESELF
FT                   YNAERTKASLYATIGPRGGGGIALSGHTDVVPVDGQAWTVDPFRLTERDGRLYGRGTAD
FT                   MKGFIASVLAAVPAFVARPLREPVHLAFSYDEEIGCVGVRPMLEALAQRADRPRLCVIG
FT                   EPTELKPVLGHKGKLAMRCHVKGAACHSAYAPSGVNAIHYAAKLIGRLGEIGDTLARPE
FT                   HRDGRFDPPFSTVQAGLIDGGRALNIVPAECTFDFEVRALPGFDAEHVPRALQDYAQTE
FT                   LLPAMRAVQPDTDIRLQPLGAYPGLATARDSDAARLLAMLTGSDAFGTVAFGTEGGLFG
FT                   AAGIPAVVCGPGSMDQGHKPDEFVTLAQLHGCDAMLARLAAHLAQGA"
FT                   /protein_id="YP_001585369.1"
FT   misc_feature    98508..99665
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases [Amino acid transport
FT                   and metabolism]; Region: ArgE; COG0624"
FT                   /db_xref="CDD:30969"
FT                   /locus_tag="Bmul_5407"
FT   misc_feature    98508..99662
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:186834"
FT                   /locus_tag="Bmul_5407"
FT   gene            complement(99726..100649)
FT                   /db_xref="GeneID:5770691"
FT                   /locus_tag="Bmul_5408"
FT   CDS_pept        complement(99726..100649)
FT                   /locus_tag="Bmul_5408"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5671 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:161522441"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5770691"
FT                   /translation="MAHYTLRQLKYFVTTVEAGSVAEASRQLFIAQPSISSAIKGLEES
FT                   FGVMLFIRHHAQGVSLTPSGTRFYRKAQELLRIAREFEQNALADNDVVSGQIDIGCFET
FT                   VAPLYLPQLIAGFRERYPGVAIRLRDGDQQELVQGLTAGSFDLAFLYDHDLDATIETEP
FT                   LMPPQQPYVLLPENHRFASQAQVSLHDLSVEPMILLDVQPSRTYFVSLFHELGLTPNIV
FT                   FASPSIEMVRGMVGQGFGFSLLVTRPHSEYTYDGRRVVTIGISETVSPSGLVSARLKRG
FT                   QLTKQAQAFVEFSRERLAQIHAAPPG"
FT                   /protein_id="YP_001585370.1"
FT   misc_feature    complement(99738..100637)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bmul_5408"
FT   misc_feature    complement(100455..100634)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5408"
FT   misc_feature    complement(99771..100364)
FT                   /note="The C-terminal substrate-binding domain of putative
FT                   LysR-type transcriptional regulator PAO1-like, a member of
FT                   the type 2 periplasmic binding fold protein superfamily;
FT                   Region: PBP2_PAO1_like; cd08412"
FT                   /db_xref="CDD:176104"
FT                   /locus_tag="Bmul_5408"
FT   misc_feature    complement(order(99915..99917,99966..99968,100038..100040,
FT                   100140..100142,100197..100199,100326..100328,
FT                   100338..100340))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:176104"
FT                   /locus_tag="Bmul_5408"
FT   misc_feature    complement(order(99882..99887,99906..99908,99936..99941,
FT                   99948..99953,99963..99971,99975..99983,99999..100004,
FT                   100227..100229,100236..100238,100260..100262,
FT                   100266..100268,100305..100310,100314..100319,
FT                   100326..100334))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176104"
FT                   /locus_tag="Bmul_5408"
FT   gene            100874..102295
FT                   /db_xref="GeneID:5770755"
FT                   /locus_tag="Bmul_5409"
FT   CDS_pept        100874..102295
FT                   /locus_tag="Bmul_5409"
FT                   /gene_family="HOG000095879" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /transl_table="11"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: bur:Bcep18194_C6996 cytosine/purines,
FT                   uracil, thiamine, allantoin transporter"
FT                   /db_xref="GI:161522442"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="GeneID:5770755"
FT                   /translation="MTTADRNASPMIEKHTIGYVPPADRHGKVRDLFTLWFGGNIAPLP
FT                   IVTGALGVQIFHLNLMWAIVAIVVGQAVGGVLMALHSAQGPQMGIPQMIQSRAQFGSWG
FT                   ALLVTVIAAVMYVGFFASNIVLAGKSVHGIAPAVPVPVGIVIGAVGSGLIGIVGYRFIH
FT                   ILNRIGTWVLGIGIAVGFWMILSHVSTDDFFTRGGFNFAGWLATVSLSALWQIAFAPYV
FT                   SDYSRYLPENVGVASTFWATYLGCAIGSTLAFIFGAVAVLAVPAGADTMDAVKQATGAL
FT                   GPLMLVLFLLSVISHNALNLYGAVLAVITSVQTFAYRWIPTAKARAVLSVVIFVACCYA
FT                   AIGASTNFIGHLVDLVLALLVVLVPWTAINLIDFYVIHKGKYDIKSIFLVDGGIYGRFN
FT                   PQALLAYAVGIVVQIPFMNTPMYAGPIPAHLGGADLSWLVGLVLTSPLYYWLATRDSAY
FT                   RRKQTAASLPSSAAR"
FT                   /protein_id="YP_001585371.1"
FT   misc_feature    100922..102262
FT                   /note="Purine-cytosine permease and related proteins
FT                   [Nucleotide transport and metabolism]; Region: CodB;
FT                   COG1457"
FT                   /db_xref="CDD:31646"
FT                   /locus_tag="Bmul_5409"
FT   misc_feature    100928..102193
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:186007"
FT                   /locus_tag="Bmul_5409"
FT   gene            complement(102366..104738)
FT                   /db_xref="GeneID:5770756"
FT                   /locus_tag="Bmul_5410"
FT   CDS_pept        complement(102366..104738)
FT                   /locus_tag="Bmul_5410"
FT                   /gene_family="HOG000200066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: bur:Bcep18194_C6997
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="GI:161522443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="GeneID:5770756"
FT                   /translation="MTVCVRRAQTSPPSHGATRAARTAAQLMENHMTNRREVPGIRKYD
FT                   GPAGGWGALRATAEAVRTQMETIEAPITLMRTNQPDGFDCPGCAWPDKEHKSTFQFCEN
FT                   GAKAVTWEATTKRVTPEFFAANTVSSLLRMSDYELENMGRLTHPLVYDRATDTFRAVEW
FT                   DDAFARIGEVLRALPPEQIEFYTSGRASNEAAYLYQLFARELGTNNFPDCSNMCHEPTS
FT                   VGLPQSIGIGKGTVSLEDFDQCELIISIGHNPGTNHPRMMGTLHECARRHVPIIVFNPL
FT                   RERALERFADPQDMIEMASFGSTRIASTYYQVDAGGDAAALKGIMKALLQLEAERGDVL
FT                   DRAFIAQHTEGFDAFAADLEATSWDDIEHASGLSQAQLEQVALAYAKSNATIVTYGMGV
FT                   TQHNKGTANVRLIADLLLLRGNIGKPGAGICPLRGHSNVQGNRTVGITEKPSAEFLKKL
FT                   EDVFGFTPPSHHGHDAVQAMQAMIDGTAKALLCLGGNFAVALPDPEQSFPAMSKLDLSV
FT                   HLGTKLNRSHLLVAKETYILPVLGRTELDVQASGPQSVTVEDSMSMVHASAGKLKPASE
FT                   HLRSEPAIVAGIAHATLPNSKVAWLDLIADYDRIRDLIDRTIPGFEAFNERIRTPGGFR
FT                   LPLPPTERVWRTPTGKAMFSVYKGVAEDAEVLGGEQVLRLITLRSHDQYNTTIYGLDDR
FT                   YRGVFGRRDVLFMNPADLEKYGLEHGDLVDIETIGASGRTLRLEKITAIEYDIAPGSVG
FT                   AYYPEANVLVPLDYIDKESGTPSYKSVPVRVVRSATV"
FT                   /protein_id="YP_001585372.1"
FT   misc_feature    complement(102378..104600)
FT                   /note="oxidoreductase alpha (molybdopterin) subunit;
FT                   Region: Fdhalpha-like; TIGR01701"
FT                   /db_xref="CDD:162496"
FT                   /locus_tag="Bmul_5410"
FT   misc_feature    complement(102777..104495)
FT                   /note="The MopB_ydeP CD includes a group of related
FT                   uncharacterized bacterial molybdopterin-binding
FT                   oxidoreductase-like domains with a putative molybdopterin
FT                   cofactor binding site. These members belong to the
FT                   molybdopterin_binding (MopB) superfamily of proteins;
FT                   Region: MopB_ydeP; cd02767"
FT                   /db_xref="CDD:29463"
FT                   /locus_tag="Bmul_5410"
FT   misc_feature    complement(order(103062..103064,103119..103124,
FT                   103167..103169,103176..103184,103254..103262,
FT                   103434..103439,103542..103553,103785..103787,
FT                   103899..103907,103968..103973,103980..103982,
FT                   103986..103991,104085..104093,104097..104099,
FT                   104361..104363))
FT                   /note="putative molybdopterin cofactor binding site; other
FT                   site"
FT                   /db_xref="CDD:29463"
FT                   /locus_tag="Bmul_5410"
FT   misc_feature    complement(102387..102722)
FT                   /note="The MopB_CT_ydeP CD includes a group of related
FT                   uncharacterized bacterial molybdopterin-binding
FT                   oxidoreductase-like domains with a putative molybdopterin
FT                   cofactor binding site. This CD is of the conserved
FT                   molybdopterin_binding C-terminal (MopB_CT)...; Region:
FT                   MopB_CT_ydeP; cd02787"
FT                   /db_xref="CDD:30319"
FT                   /locus_tag="Bmul_5410"
FT   misc_feature    complement(order(102405..102410,102459..102461,
FT                   102471..102473,102681..102692,102696..102710))
FT                   /note="putative molybdopterin cofactor binding site; other
FT                   site"
FT                   /db_xref="CDD:30319"
FT                   /locus_tag="Bmul_5410"
FT   gene            complement(104821..107682)
FT                   /db_xref="GeneID:5770757"
FT                   /locus_tag="Bmul_5411"
FT   CDS_pept        complement(104821..107682)
FT                   /locus_tag="Bmul_5411"
FT                   /gene_family="HOG000218210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_6423 ATPase AAA-2 domain protein"
FT                   /db_xref="GI:161522444"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="GeneID:5770757"
FT                   /translation="MPALCDICHARPAVARATVMQDGERKTISICDYHFRQLMRHQSML
FT                   NPFDSLLGGGPSSLFGGLDEASPLAAEIPRESVDPTDAFSEQTLELLQRAAEKAHELRR
FT                   NELDTEHLLYALADTDVCAALLKELKLSPQDTKAYIDEHAHTGNADPDQSLEKLSISPR
FT                   VKKAVQYAFQASRDLGHSYIGPEHLLIGLASVPDSIAGTLLKKYGVTPEALRQKVVKVV
FT                   GKGAEDGRVDTPTGTPNLDKFGRDLTALARQGKLDPVLGRAQEIESAIEVLARRKKNNP
FT                   VLIGEPGVGKTAIVEGLAQRIVNGDVPEVLRGKRLVEVNINSMVAGAKYRGEFEERAKQ
FT                   LIDEVTAKQDELILFIDELHTIVGAGQGGGEGGLDIANVLKPALARGELSLIGATTLNE
FT                   YQKYIEKDAALERRFQPVFVPEPSVEQTIVILRGLRDSLEAHHQVTFSDDAFVGAAEFA
FT                   DRYITSRFLPDKAIDLIDQAAARVRIGATSRPVDIQEDEAQIAQLKREQDYATSRKRFD
FT                   EAKQFEEQINAKQKALDEKMEAWQRKTGSETLEVTVESVAEVVSRLTGIPVSELTQEER
FT                   QKLLKMEEQLRERVVGQNDAVVAVSDAVRLSRAGLGQTHRPIATFLFLGPTGVGKTELA
FT                   KALAESVFGDEQAIIRIDMSEYMERHAVARLIGAPPGYVGYDEGGQLTERVRRRPYSVI
FT                   LLDEIEKAHPDVYNVLLQVFDDGRLTDGKGRVVDFSNTIIIATSNLGAAIIMDNLTQPE
FT                   AARKTDKAIREELMQVLKGHFRPEFLNRIDEVIVFHALSKENIRSIVQIQLDRVVRTAA
FT                   AQDIQLVMGESLIEHLTEAGYQPEFGARELKRQVRQTIETRLAKEILADALKSGDRVEV
FT                   DYDKDRGEVTFNKLPPAEATDAKDAKAAKQAGNGSAKGNGSAAAADGRPDGEAGASDGA
FT                   PAEAPPPAKKSGKKSSGAKKDAP"
FT                   /protein_id="YP_001585373.1"
FT   misc_feature    complement(105052..107433)
FT                   /note="ATP-dependent chaperone ClpB; Region:
FT                   chaperone_ClpB; TIGR03346"
FT                   /db_xref="CDD:163223"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(107014..107172)
FT                   /note="Clp amino terminal domain; Region: Clp_N; pfam02861"
FT                   /db_xref="CDD:145814"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(106417..106902)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(106807..106830)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(order(106495..106497,106612..106614,
FT                   106804..106827))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(106609..106626)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(106444..106446)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(105439..105912)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(105787..105810)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(order(105466..105468,105592..105594,
FT                   105784..105807))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(105589..105606)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5411"
FT   misc_feature    complement(105055..105312)
FT                   /note="C-terminal, D2-small domain, of ClpB protein;
FT                   Region: ClpB_D2-small; pfam10431"
FT                   /db_xref="CDD:151009"
FT                   /locus_tag="Bmul_5411"
FT   gene            complement(108304..108573)
FT                   /db_xref="GeneID:5770903"
FT                   /locus_tag="Bmul_5412"
FT   CDS_pept        complement(108304..108573)
FT                   /locus_tag="Bmul_5412"
FT                   /gene_family="HOG000268167" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6424 hypothetical protein"
FT                   /db_xref="GI:161522445"
FT                   /db_xref="GeneID:5770903"
FT                   /translation="MSDTNDAMQKLQAAVDGLKQTVDANAGSQTAEVAVLFTVVSLMLA
FT                   ELPPDTRNLIEDSFSVWADGLPDAALSASVKQIARQRLAMTFDA"
FT                   /protein_id="YP_001585374.1"
FT   gene            complement(108676..109491)
FT                   /db_xref="GeneID:5770904"
FT                   /locus_tag="Bmul_5413"
FT   CDS_pept        complement(108676..109491)
FT                   /locus_tag="Bmul_5413"
FT                   /gene_family="HOG000268188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Linocin_M18 bacteriocin protein; KEGG:
FT                   bch:Bcen2424_6425 Linocin_M18 bacteriocin protein"
FT                   /db_xref="GI:161522446"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="GeneID:5770904"
FT                   /translation="MNNLHRELAPISSAAWEQIEEEVARTFKRSVAGRRVVDVEGPKGP
FT                   ELSAVGTGHLRDVAAPREHVDARLREVRTIVELTVPFELDRAAIDSVERGARDADWQAA
FT                   KEAAQRLAFAEDSAIFDGYPAAGIVGIREGTSNRKLTLPSDVGAYPDAISDALEALRLA
FT                   GVDGPYSVLLGADAYTALSEARDQGYPVIEHIKRIVSGEIIWAPAISGGCVLSTRGGDY
FT                   ELHLGEDVSIGYASHTDKVVRLYLRETLTFLMLTSEASVAVAPAAGTPA"
FT                   /protein_id="YP_001585375.1"
FT   misc_feature    complement(108739..109380)
FT                   /note="Encapsulating protein for peroxidase; Region:
FT                   Linocin_M18; cl12047"
FT                   /db_xref="CDD:159707"
FT                   /locus_tag="Bmul_5413"
FT   gene            complement(109488..110549)
FT                   /db_xref="GeneID:5770905"
FT                   /locus_tag="Bmul_5414"
FT   CDS_pept        complement(109488..110549)
FT                   /locus_tag="Bmul_5414"
FT                   /gene_family="HOG000151980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dyp-type peroxidase family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: bam:Bamb_5665 Dyp-type peroxidase family"
FT                   /db_xref="GI:161522447"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="GeneID:5770905"
FT                   /translation="MTDRQAAMETRAPLSQAVHSPITRSAIFLVATINPGDAHADTIRS
FT                   WCGDIAALVRSVGKRVPGGNLSCVCGFGSDAWDALFGEPRPAALHPFREFGAGQRVAIA
FT                   TPGDILLHIRADAMDLCFELATQLLAALGDAVTVVDEVHGFRNFDQRAMIGFVDGTENP
FT                   EGRDAVDFTVIGDEDAAFAGGSYVIVQKYLHDMAGWNALPVETQERIIGRTKLSDIELA
FT                   PDVKPSSSHSSLTTLDENGKEVKILRDNMPFGRPGAGEFGTYFIGYARSPAPIEQMLEN
FT                   MFVGRPPGNYDRLLDFSRAVTGSLFFVPSADLLDALPDRAAPAEAAAPAPSSNEPHRDG
FT                   SLKIGSLKGVKSV"
FT                   /protein_id="YP_001585376.1"
FT   misc_feature    complement(109626..110504)
FT                   /note="Dyp-type peroxidase family; Region: Dyp_perox;
FT                   cl01067"
FT                   /db_xref="CDD:163949"
FT                   /locus_tag="Bmul_5414"
FT   gene            110958..111287
FT                   /db_xref="GeneID:5770580"
FT                   /locus_tag="Bmul_5415"
FT   CDS_pept        110958..111287
FT                   /locus_tag="Bmul_5415"
FT                   /gene_family="HOG000024021" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   bur:Bcep18194_C7002 transcriptional regulator, LysR family"
FT                   /db_xref="GI:161522448"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="GeneID:5770580"
FT                   /translation="MNLLEAMRIYVAVVEHGGLPGAASELKLGAAHVSDRIDGLERYLG
FT                   CRLLLRCADDGVACTDAGIAFHQCCVRTLSAVDDAMADAGIRPPDAHVAEARRAAPHAL
FT                   HAARR"
FT                   /protein_id="YP_001585377.1"
FT   misc_feature    110967..111146
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5415"
FT   gene            111319..111771
FT                   /db_xref="GeneID:5770581"
FT                   /locus_tag="Bmul_5416"
FT   CDS_pept        111319..111771
FT                   /locus_tag="Bmul_5416"
FT                   /gene_family="HOG000293672" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphate-starvation-inducible E"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate-starvation-inducible E; KEGG:
FT                   bur:Bcep18194_C7003 phosphate-starvation-inducible protein
FT                   E"
FT                   /db_xref="GI:161522449"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="GeneID:5770581"
FT                   /translation="MLNTSTVACSPAERIRRRFGHFLHVAELAGLIVIGLATAFAMAQE
FT                   AWKVVLAGEVSLTDLLLMFLYLEVLAMDVRYLRLGRLPVRFPLFIAMTSLARDLILRGA
FT                   TDSPERMLMTTFGIVLLALGVLILSFGQHRYPAEVGDVEDDVRASR"
FT                   /protein_id="YP_001585378.1"
FT   sig_peptide     111319..111450
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.916 at
FT                   residue 44"
FT                   /locus_tag="Bmul_5416"
FT                   /product="hypothetical protein"
FT   misc_feature    111487..>111621
FT                   /note="Phosphate-starvation-inducible E; Region: PsiE;
FT                   cl01264"
FT                   /db_xref="CDD:186407"
FT                   /locus_tag="Bmul_5416"
FT   gene            112290..112595
FT                   /db_xref="GeneID:5770582"
FT                   /locus_tag="Bmul_5417"
FT   CDS_pept        112290..112595
FT                   /locus_tag="Bmul_5417"
FT                   /gene_family="HOG000268200" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5663 membrane protein"
FT                   /db_xref="GI:161522450"
FT                   /db_xref="GeneID:5770582"
FT                   /translation="MLDAQARPFRGAAIGAIAGALLGLLAGPLGVVTGFAAGAGAGVLA
FT                   DAAGSALLDGRFVESVAATLAPGSAAVILEAKEATPFSVDNVVTGFGGKVMRHALG"
FT                   /protein_id="YP_001585379.1"
FT   sig_peptide     112290..112400
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.434 at
FT                   residue 37"
FT                   /locus_tag="Bmul_5417"
FT                   /product="hypothetical protein"
FT   misc_feature    <112455..112592
FT                   /note="Protein of unknown function (DUF1269); Region:
FT                   DUF1269; cl01978"
FT                   /db_xref="CDD:154690"
FT                   /locus_tag="Bmul_5417"
FT   gene            112631..112879
FT                   /db_xref="GeneID:5770884"
FT                   /locus_tag="Bmul_5418"
FT   CDS_pept        112631..112879
FT                   /locus_tag="Bmul_5418"
FT                   /gene_family="HOG000268211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6429 hypothetical protein"
FT                   /db_xref="GI:161522451"
FT                   /db_xref="GeneID:5770884"
FT                   /translation="MQIERTYRRLDISAPLSPLSDNRAIAAVDVSTDDAERVADPGTGR
FT                   CLQIRRWVEALDAAQLTVVVDACKVAIGHDANDVDDA"
FT                   /protein_id="YP_001585380.1"
FT   gene            113185..114609
FT                   /db_xref="GeneID:5770885"
FT                   /locus_tag="Bmul_5419"
FT   CDS_pept        113185..114609
FT                   /locus_tag="Bmul_5419"
FT                   /gene_family="HOG000133006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_C6954 transcriptional
FT                   regulator, GntR family, contains an aminotransferase
FT                   domain"
FT                   /db_xref="GI:161522452"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:5770885"
FT                   /translation="MKLYEKFANDIERLIRQGVYRHGDRVPSVRQASQQHRISITTVLH
FT                   AYLLLESRGLLESRPQSGYFVNLRRDDAHAPVRELRPSKPIAISSSVDVSRLVLSTLRS
FT                   IGTDDAVPLGSPYPDPSLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRY
FT                   LENGMSVDPNEIIVTVGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIE
FT                   VATHPEYGIDIAALAAIAKSQPIAACMVMPNFQNPLGFQMPDERKRELVEFATRVNMPL
FT                   IENGVYNELYFGNAHPSALKSFDREGIVLHCSSFSKSLTAAYRIGWALPGRYREQVEKL
FT                   KFLNTLATPSLPQLAIAEFLERDGYEHHLRRLRKAYAQQANLMRAMVSRFFPEGTRISS
FT                   PAGGYVLWIELPAQVDAMRLYQLALDEGITIGPGYMFSITDNYRNFIRLNYSSPWSPEI
FT                   EQAVITVGKLAAARVG"
FT                   /protein_id="YP_001585381.1"
FT   misc_feature    113185..114600
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    113188..113385
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    order(113188..113190,113194..113196,113263..113265,
FT                   113269..113274,113296..113310,113314..113319,
FT                   113326..113328,113356..113361,113365..113376)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    113515..114570
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    order(113722..113730,113800..113802,113950..113952,
FT                   114043..114045,114124..114126,114130..114135,
FT                   114154..114156)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    order(113731..113733,113830..113832,114022..114024,
FT                   114148..114156,114238..114240,114247..114249)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5419"
FT   misc_feature    114133..114135
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5419"
FT   gene            complement(114622..115782)
FT                   /db_xref="GeneID:5770886"
FT                   /locus_tag="Bmul_5420"
FT   CDS_pept        complement(114622..115782)
FT                   /locus_tag="Bmul_5420"
FT                   /gene_family="HOG000136703" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formate dehydrogenase"
FT                   /transl_table="11"
FT                   /note="Catalyzes the reversible two-electron oxidation of
FT                   formate to carbon dioxide. It allows the assimilation of
FT                   carbon dioxide and provides energy for growth through
FT                   oxidative phosphorylation coupled to the reduction of
FT                   oxygen, nitrate, sulphate or fumarate"
FT                   /db_xref="GI:161522453"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="GeneID:5770886"
FT                   /translation="MATVLCVLYPDPVDGYPPRYVRDTIPVITHYADGQLAPTPSGPPG
FT                   FRPGELVGSVSGALGLRDYLAAHGHTLIVTSDKDGPDSEFERRLPEADVVISQPFWPAY
FT                   LTAEGIARAPKLRLALTAGIGSDHVDLAAAARAGITVAEVTGSNSVSVAEHVVMTTLAL
FT                   VRNYLPSHAIAQQGGWNIADCVSRSYDIEGMHFGTVGAGRIGLAVLRRLKPFGLALHYT
FT                   QRHRLDPAIEHELALTYHADVASLASAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYL
FT                   INTARAKLVDRDAVVRAVASGHLAGYGGDVWFPEPAPADHPWRAMPFNGMTPHISGTSL
FT                   SAQARYAAGTLEILQCWFERRPIREAYLIVDGGTLAGTGEQSYRLT"
FT                   /protein_id="YP_001585382.1"
FT   misc_feature    complement(114625..115782)
FT                   /note="formate dehydrogenase; Provisional; Region:
FT                   PRK07574"
FT                   /db_xref="CDD:181041"
FT                   /locus_tag="Bmul_5420"
FT   misc_feature    complement(114775..115314)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5420"
FT   gene            115995..117521
FT                   /db_xref="GeneID:5770502"
FT                   /locus_tag="Bmul_5421"
FT   CDS_pept        115995..117521
FT                   /locus_tag="Bmul_5421"
FT                   /gene_family="HOG000276711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_C7008 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:161522454"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:5770502"
FT                   /translation="MSGNASSAPRPDLAQGIALDDIADGAMIEGRVGDEAVLLVRRGDA
FT                   LFAVGAQCPHYGAPLAQGLLVGDTLRCPWHHAAFCLRSGARLRAPALDGLNCWRVERRD
FT                   GRAVVVDARAPAPSPAPIEAPDSIVIVGGGAAAISAAVTLRDEGYTRAITLLSGDDEPP
FT                   YDRPNLSKDYLAGTAEADWLPLRSPSFYADRKIDLRCGTRVARIDAAQRAVELADGSRL
FT                   GYGALLLATGAVPNRLTVPGADLPHVCVLRSRADCDALIARLATARRCVVVGASFIGLE
FT                   AAAALRTRTLDVHVVAPGSHPMAHVLGDALGDAVRALHESHGVVFHLGATLARIEHDRV
FT                   TLSTGDVLPADLVVVGIGVRPDVALAQDAGLEVDRGVSVDRYLQTSAPGIYAAGDIARW
FT                   PDPLTGERIRVEHWVVAQRQGSTAAHNMLGRQRPFDAVPFFWTQHYDMTIRYVGHAEHW
FT                   DRVEIEGDLHAHDGSVSYWRGDVRLAVATIGRDLDCLRAEAALETQIAGG"
FT                   /protein_id="YP_001585383.1"
FT   misc_feature    116034..116288
FT                   /note="AIFL (apoptosis-inducing factor like) family,
FT                   N-terminal Rieske domain; members of this family show
FT                   similarity to human AIFL, containing an N-terminal Rieske
FT                   domain and a C-terminal pyridine nucleotide-disulfide
FT                   oxidoreductase domain (Pyr_redox). The...; Region:
FT                   Rieske_AIFL_N; cd03478"
FT                   /db_xref="CDD:58548"
FT                   /locus_tag="Bmul_5421"
FT   misc_feature    order(116151..116153,116157..116162,116208..116210,
FT                   116217..116219,116223..116225)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58548"
FT                   /locus_tag="Bmul_5421"
FT   misc_feature    116448..>117284
FT                   /note="NAD(P)H-nitrite reductase [Energy production and
FT                   conversion]; Region: NirB; COG1251"
FT                   /db_xref="CDD:31443"
FT                   /locus_tag="Bmul_5421"
FT   misc_feature    116805..117032
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bmul_5421"
FT   gene            117643..117837
FT                   /db_xref="GeneID:5770503"
FT                   /locus_tag="Bmul_5422"
FT   CDS_pept        117643..117837
FT                   /locus_tag="Bmul_5422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522455"
FT                   /db_xref="GeneID:5770503"
FT                   /translation="MDKYLVDALLNAIAERNIGHRVVDRDTAGSTSVELTLDDVSQLMR
FT                   DAFDAGRCVRAPARPGGER"
FT                   /protein_id="YP_001585384.1"
FT   gene            complement(117849..118067)
FT                   /db_xref="GeneID:5770504"
FT                   /locus_tag="Bmul_5423"
FT   CDS_pept        complement(117849..118067)
FT                   /locus_tag="Bmul_5423"
FT                   /gene_family="HOG000268222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6434 hypothetical protein"
FT                   /db_xref="GI:161522456"
FT                   /db_xref="GeneID:5770504"
FT                   /translation="MHASEMFMGHEIRVEATRNERGAWVAHVRIFRDGAPVDLPAPELV
FT                   TPEWLTCDEALRGGLDQGRIMLKTHDR"
FT                   /protein_id="YP_001585385.1"
FT   gene            118264..118728
FT                   /db_xref="GeneID:5770508"
FT                   /locus_tag="Bmul_5424"
FT   CDS_pept        118264..118728
FT                   /locus_tag="Bmul_5424"
FT                   /gene_family="HOG000268234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6436 hypothetical protein"
FT                   /db_xref="GI:161522457"
FT                   /db_xref="GeneID:5770508"
FT                   /translation="MNTLIALSYPDLDTAHRALAALAALRDAQTVALSGVVLVECARDG
FT                   SRTAHAADPARVSHGSLLADAFARIDASLDALRDRPVDDALIGRVARKVRAGTVTLAFA
FT                   VTQLDVVRLGAALAPFGGDVLDTTLSLDDELKLVEAISKARDGAADAEPD"
FT                   /protein_id="YP_001585386.1"
FT   misc_feature    <118489..118695
FT                   /note="Protein of unknown function (DUF1269); Region:
FT                   DUF1269; cl01978"
FT                   /db_xref="CDD:154690"
FT                   /locus_tag="Bmul_5424"
FT   gene            118959..120047
FT                   /db_xref="GeneID:5770509"
FT                   /locus_tag="Bmul_5425"
FT   CDS_pept        118959..120047
FT                   /locus_tag="Bmul_5425"
FT                   /gene_family="HOG000250874" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   pol:Bpro_0415 aminoglycoside phosphotransferase"
FT                   /db_xref="GI:161522458"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="GeneID:5770509"
FT                   /translation="MHDAAAGPFRHDTLFSVASPRIGIDEAEALAADAFGIVGTASALA
FT                   SERDQNFRIDAADGASYVLKLTHPAEQAGVTEFQTFAQLQVIEADATLPVPRLMRDRSG
FT                   RYIHWRDVAGEHARQAVRMITFAPGIPLHRVERSRRQRRALGTALGRFDRALRGFTHAH
FT                   AGHRLLWDIQHLSQLRPLLDYVDGGERRALARHLLDRHDAHTARRMTTLRRQVIHNDLN
FT                   PYNVLVDETDTDRITAILDFGDMVHAPLVNELAVASSYQLADTPNPLETAVDCICAYHR
FT                   ENPLSGDELAVLPELIVARLLMTVLITGWRAREHPENSAYILRNNALSWTGLHRLAALP
FT                   DGDAARIIGDAIRHEQENRHAQ"
FT                   /protein_id="YP_001585387.1"
FT   misc_feature    119109..119846
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:186871"
FT                   /locus_tag="Bmul_5425"
FT   misc_feature    order(119109..119111,119145..119147,119151..119153,
FT                   119244..119246,119328..119339,119616..119618,
FT                   119628..119633,119637..119639,119676..119681,
FT                   119736..119738)
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Bmul_5425"
FT   misc_feature    order(119109..119111,119145..119147,119151..119153,
FT                   119244..119246,119328..119339,119616..119618,
FT                   119628..119633,119637..119639,119676..119681)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Bmul_5425"
FT   misc_feature    order(119616..119618,119736..119738)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Bmul_5425"
FT   gene            120037..121365
FT                   /db_xref="GeneID:5770510"
FT                   /locus_tag="Bmul_5426"
FT   CDS_pept        120037..121365
FT                   /locus_tag="Bmul_5426"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase class-III"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   pol:Bpro_0414 aminotransferase class-III"
FT                   /db_xref="GI:161522459"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:5770510"
FT                   /translation="MRSDPAMLNAFDPQRASALDAQARALVERRARVLGPAYRLFYETP
FT                   LHIVRGEGVWLYDSAGRAYLDAYNNVASIGHCRPEVVEAIAKQASTLNTHTRYLHDGIL
FT                   DYAERLLRTMPDALSQAMFTCTGSEANDLALRIAKQYTGGTGVIVTQLAYHGVTAAIAE
FT                   ISPSLGRHVPLGLHVRAVAPPDTYRDGDADVGARFARDVQRAIDDLVRHGVRPAALIID
FT                   TLFTSDGVFADPRGFLQGAVAAIRQAGGVFIADEVQAGFARTGSKMWGFERHDVVPDLV
FT                   TMGKPMGNGHPIAGLAARAEVLERFGKDTRYFNTFGGNPVSCAAAAATLDVIVNDGLQA
FT                   NASRIGAYLREGFRTLARKHDLIGDVRGDGLFLGVELVRDRHAKTPAEDERQRVVNLMR
FT                   ERGVLISATGVRGNVLKIRPLLPFTQEHADLLLAAADGALAAL"
FT                   /protein_id="YP_001585388.1"
FT   misc_feature    120142..121317
FT                   /note="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase [Coenzyme metabolism]; Region: BioA;
FT                   COG0161"
FT                   /db_xref="CDD:30510"
FT                   /locus_tag="Bmul_5426"
FT   misc_feature    120142..121317
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase...; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bmul_5426"
FT   misc_feature    order(120412..120420,120496..120501,120505..120507,
FT                   120700..120702,120799..120801,120805..120810,
FT                   120889..120891)
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bmul_5426"
FT   misc_feature    order(120415..120420,120496..120501,120700..120702,
FT                   120799..120801,120808..120810,120889..120891)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bmul_5426"
FT   misc_feature    120889..120891
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bmul_5426"
FT   gene            complement(121386..122858)
FT                   /db_xref="GeneID:5770868"
FT                   /locus_tag="Bmul_5427"
FT   CDS_pept        complement(121386..122858)
FT                   /locus_tag="Bmul_5427"
FT                   /gene_family="HOG000223052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bvi:Bcep1808_4394 putative
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="GI:161522460"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:5770868"
FT                   /translation="MRAVLLTDLLARALSDGGSDTLQHRIYDVVRRGVLDHTLAAGQKL
FT                   PSSRTLAQELGISRITVSLAYDRLIAENYLVARTGSGTFVAPTSPRPLSGPGEIVHTRH
FT                   SMTLSQRGAMLDRLPGGVTQSYGPFVPGVADTPMFPFHVWRRLIARHIGKGDLSLSGYA
FT                   LDGGYAPLRAAVARYLKISRSVVCEPEQVIITSGTHQSIDLCARLLADPGDVAIVENPC
FT                   HWAFPTVLSAAGLELVASAIDAAGLSLTDIDTPARARLVVTSPSHQYPTGAVMPLSRRL
FT                   ELLQSARSRNLWVMEDDYDSEFRYDGIPLPSLQGLDSDARVIYGGTFSKAMYPGVRIAY
FT                   LVVPAHLADTFAKACAKLYRPGQLHIQAALADFIDDGHFAQHVRRMRIEYAQRQQLLRD
FT                   ALHAEFGNTIRLSDARAGLHLFASFDADVSTRALTDVARADGLILGRPHFVAPHALADR
FT                   SIVLGYGGVAQSAIGDGVKRLGRAYARTLDAT"
FT                   /protein_id="YP_001585389.1"
FT   misc_feature    complement(121413..122798)
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(122601..122798)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(order(122610..122621,122625..122630,
FT                   122658..122660,122667..122672,122676..122690,
FT                   122712..122717,122721..122723,122790..122792,
FT                   122796..122798))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(121527..122477)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(order(121848..121850,121869..121874,
FT                   121878..121880,121959..121961,122052..122054,
FT                   122190..122192,122262..122270))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(order(121752..121754,121761..121763,
FT                   121848..121856,121980..121982,122160..122162,
FT                   122259..122261))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5427"
FT   misc_feature    complement(121869..121871)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5427"
FT   gene            123063..124169
FT                   /db_xref="GeneID:5770869"
FT                   /locus_tag="Bmul_5428"
FT   CDS_pept        123063..124169
FT                   /locus_tag="Bmul_5428"
FT                   /codon_start="1"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B2170 spermidine/putrescine ABC
FT                   transporter ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; TOBE domain protein; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="GI:161522461"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="GeneID:5770869"
FT                   /translation="MKADDVIVSFRGVRKTYDGETLVVKSLDLDIRRGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIRLDGELLNHVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKLPAAERAERVAHALKMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKALHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIARVDGEFCELRLGDGTRLIGRNVANAAPGAPA
FT                   IACIRPERMRLCREPEPPAAHGDAANRVAGEALGLIYFGDHVRMRCAVPGQGECFVKVP
FT                   LGTEALDNFFPGAPVSLSFAPAHLRVFA"
FT                   /protein_id="YP_001585390.1"
FT   misc_feature    123081..124166
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123084..123782
FT                   /note="PotA is an ABC-type transporter and the ATPase
FT                   component of the spermidine/putrescine-preferential uptake
FT                   system consisting of PotA, -B, -C, and -D.  PotA has two
FT                   domains with the N-terminal domain containing the ATPase
FT                   activity and the residues...; Region: ABC_PotA_N; cd03300"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123183..123206
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    order(123192..123197,123201..123209,123321..123323,
FT                   123549..123554,123651..123653)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123312..123323
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123477..123506
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123537..123554
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123561..123572
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123639..123659
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Bmul_5428"
FT   misc_feature    123921..124163
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Bmul_5428"
FT   gene            124262..125308
FT                   /db_xref="GeneID:5770870"
FT                   /locus_tag="Bmul_5429"
FT   CDS_pept        124262..125308
FT                   /locus_tag="Bmul_5429"
FT                   /gene_family="HOG000159582" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bur:Bcep18194_B2169 ABC spermidine/putrescine
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="GI:161522462"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:5770870"
FT                   /translation="MNRTRFTARRIAVALTLAAFGASASAAELTVVNFGGANGDAQKAA
FT                   FNQPFEKATGNKVTAVEYNGEQAKVKAMVEAKHVSWDVVDVESGDVGRGCDEGLYEKLD
FT                   WSKIAKKTDLIPEAYQTCGAGIFVWSTVLSYNADKLKTAPANWADFWDVKKFPGKRAMR
FT                   KGARYNLEFALMADGVAPKDVYKVLNTKAGQDRAFKKLDELKPNIQWWEAGAQPPQFLV
FT                   AGDVVMSTAFSGRIDAARKEGKNLKIVWNGSIYDLDYWAIPKGSPNKALAEQFIAYTLT
FT                   PKPQQAYAQHIAYGPVNLAAIKSLDAKTLANLPNSPANGKNAVLQDIGFWTDHGDELEQ
FT                   RFAAWASK"
FT                   /protein_id="YP_001585391.1"
FT   sig_peptide     124262..124342
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 27"
FT                   /locus_tag="Bmul_5429"
FT                   /product="hypothetical protein"
FT   misc_feature    124343..125299
FT                   /note="Spermidine/putrescine-binding periplasmic protein
FT                   [Amino acid transport and metabolism]; Region: PotD;
FT                   COG0687"
FT                   /db_xref="CDD:31031"
FT                   /locus_tag="Bmul_5429"
FT   misc_feature    124409..125185
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bmul_5429"
FT   gene            125316..126704
FT                   /db_xref="GeneID:5770844"
FT                   /locus_tag="Bmul_5430"
FT   CDS_pept        125316..126704
FT                   /locus_tag="Bmul_5430"
FT                   /gene_family="HOG000263580" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bch:Bcen2424_3920
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:161522463"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:5770844"
FT                   /translation="MRGRERVHARTPSAARRSVTHRAACRRTAGRGLRSGPERPPLNTM
FT                   TIASSPQSGAALKRELKAAEARKRTMALLLIAPLAIFLLLVFVVPIGTLLTRAVQNPEI
FT                   AAALPNTVAALSHWDRKTPPADAAYAALAADMTKVADSDAMGALARRLNTEIPGYRSLV
FT                   AKTARAMPLKNDDGTALTPAGTRSKLIELDARWGEVAYWQAIAKNGSTYSPFYLLAALD
FT                   HKQDGFGHIVHADPDQSIYLAIFGRTFVIGIAVTLFALLLGYPLAYWISTLSERRANLA
FT                   MILVLIPFWTSVLVRVAAWIVLLQNEGLINKALIGSGLLAHPLALLFNRVGVYISMTHI
FT                   LLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYVPQTYPGVGAGALLVFILAI
FT                   GYYITPALLGGPNDQMVSYYVAYFTNVTINWGMACALGGLLLAATLVLYAVYGRFTRTN
FT                   VSLG"
FT                   /protein_id="YP_001585392.1"
FT   misc_feature    126048..126617
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5430"
FT   misc_feature    order(126096..126101,126108..126113,126126..126128,
FT                   126156..126167,126171..126200,126210..126215,
FT                   126219..126221,126294..126299,126339..126341,
FT                   126345..126347,126354..126359,126363..126365,
FT                   126375..126380,126387..126389,126438..126440,
FT                   126480..126485,126492..126494,126513..126524,
FT                   126531..126536,126570..126572,126600..126605,
FT                   126612..126617)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5430"
FT   misc_feature    order(126174..126200,126204..126221,126513..126530)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5430"
FT   misc_feature    order(126219..126221,126279..126281,126531..126533,
FT                   126567..126569,126570..126572,126600..126602)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5430"
FT   misc_feature    order(126390..126428,126444..126449,126459..126461)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5430"
FT   gene            126735..127571
FT                   /db_xref="GeneID:5770845"
FT                   /locus_tag="Bmul_5431"
FT   CDS_pept        126735..127571
FT                   /locus_tag="Bmul_5431"
FT                   /gene_family="HOG000263700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bam:Bamb_3299
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:161522464"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:5770845"
FT                   /translation="MKLARPLFAPHMSFIERAWYVALRVLVVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGFSTRWYENLIASDEWRMAAKNSFIVAPSATLVATVLGTLAAIGLTK
FT                   AEFRGKGLLMAVLLSPMIVPVVVVGVGMYLFFAPLGLANTYTGLIAAHAALGVPFVVTT
FT                   VAATLQGFNQNLVRASLSLGANPVTTFFRVTLPVIAPGVMSGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIVFSTSLLLALEWLRGRQARRAVA"
FT                   /protein_id="YP_001585393.1"
FT   misc_feature    126963..127505
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5431"
FT   misc_feature    order(127011..127016,127023..127028,127041..127043,
FT                   127071..127082,127086..127115,127122..127127,
FT                   127131..127133,127209..127211,127218..127223,
FT                   127227..127229,127239..127244,127251..127253,
FT                   127302..127304,127344..127349,127356..127358,
FT                   127377..127388,127395..127400,127437..127442,
FT                   127470..127475,127482..127487,127491..127496,
FT                   127503..127505)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5431"
FT   misc_feature    order(127089..127133,127377..127394)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5431"
FT   misc_feature    order(127131..127133,127191..127193,127395..127397,
FT                   127431..127433,127440..127442,127470..127472)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5431"
FT   misc_feature    order(127254..127292,127308..127313,127323..127325)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bmul_5431"
FT   gene            127872..129077
FT                   /db_xref="GeneID:5770846"
FT                   /locus_tag="Bmul_5432"
FT   CDS_pept        127872..129077
FT                   /locus_tag="Bmul_5432"
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bam:Bamb_5660 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="GI:161522465"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:5770846"
FT                   /translation="MKAVVFHGIGDIRIDTVPDPEVADTTDAVVRLTASAICGTDLHMV
FT                   RGTLGGMKPGTILGHEGVGIVEAVGRDVRNLRRDDRVLIPSTIACGHCVYCRAGYTAQC
FT                   DVANPGGPRAGTAFFGGPADTGAFDGLQAEYARTPLANASLIRLPDEIDDDRAILMSDI
FT                   FPTGYFGAQLAEVKPGDTVAVFGAGPVGQFAIASAKLMGAGRVIAIDRIASRLDMACAQ
FT                   GAEAVDFSEEDPVDTVLRLTGGIGVDRVIDAVGVDAMRATHGPAAADHEAARAFDAEVD
FT                   AVAPRRKPDGRYWVPGDGPSQVLQWAVRAVAKAGTVAVIGVYPPQARVFPIGEAMNRNL
FT                   TIKMGNCNHRTITPQLIELVRSGAFDPLSVLTQREPLTNAIDAYRAFDVREPGWIKVKL
FT                   EP"
FT                   /protein_id="YP_001585394.1"
FT   misc_feature    127872..129074
FT                   /note="Glutathione-dependent formaldehyde dehydrogenase
FT                   related proteins, child 1; Region: FDH_like_1; cd08283"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5432"
FT   misc_feature    127872..129074
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="Bmul_5432"
FT   misc_feature    order(127983..127991,127998..128000,128127..128129,
FT                   128355..128357,128367..128369,128424..128429,
FT                   128433..128441,128496..128504,128514..128516,
FT                   128556..128558,128628..128636,128778..128780,
FT                   128829..128837,128904..128912,129030..129032)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5432"
FT   misc_feature    order(127983..127985,127989..127991,128049..128051,
FT                   128355..128357)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5432"
FT   misc_feature    order(128139..128144,128148..128150,128157..128159,
FT                   128181..128183)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5432"
FT   gene            129080..129430
FT                   /db_xref="GeneID:5770652"
FT                   /locus_tag="Bmul_5433"
FT   CDS_pept        129080..129430
FT                   /locus_tag="Bmul_5433"
FT                   /gene_family="HOG000099005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   bam:Bamb_5659 protein of unknown function DUF326"
FT                   /db_xref="GI:161522466"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="GeneID:5770652"
FT                   /translation="MEPATNRTELNARYDTCMAACDACAHACDACAGACLAEPDPRALT
FT                   ACIALDIDCALLCRFASGAMARRSVLAPQVCALCAQVCERCAAECRRHTHEHCRRCALA
FT                   CDACAAMCRAMA"
FT                   /protein_id="YP_001585395.1"
FT   misc_feature    <129191..>129343
FT                   /note="Cysteine-rich 4 helical bundle widely conserved in
FT                   bacteria; Region: DUF326; cd08026"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Bmul_5433"
FT   misc_feature    order(129224..129229,129233..129238,129245..129250,
FT                   129257..129259,129266..129271,129287..129292,
FT                   129299..129301,129311..129313,129320..129325)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Bmul_5433"
FT   gene            complement(129441..131060)
FT                   /db_xref="GeneID:5770653"
FT                   /locus_tag="Bmul_5434"
FT   CDS_pept        complement(129441..131060)
FT                   /locus_tag="Bmul_5434"
FT                   /gene_family="HOG000217841" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bch:Bcen2424_6439 PAS/PAC sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="GI:161522467"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:5770653"
FT                   /translation="MAFHLQLSSPLMTKDDIRPHSNPPPSPAPDGGDLLHRFAEFRFQT
FT                   VVASITDYAVFMLDTEGHVVTWNAGAERIKGYRASEIVGNHFSRFYPPEALAAGRPSYG
FT                   LREAATHGRFEDEGWRVRKDGSLFWANVTITAVRDESGQLCGFIKITRDMTERRRLEEL
FT                   ETSTHRLSVFIAMLAHELRNHLAPLRHSVGVLQSLPDPAPALAQCRDAVHRQVAQLTRL
FT                   VDDLLDVGRITSGKVELEDRPVTVRDLVARGVESVQPKLATREQQIHVDLPPEPIVLRG
FT                   DDARLVQVLHNLLDNASKFSPRGGRIDISARVEGPVVAIRVIDRGVGIAPGALESIFDL
FT                   FEQEGAAHRPTDGFGLGLAICRSFVELHGGMISAESDGPGHGATFIIRLPVERAARAEP
FT                   ELPVASAAADTPVAPLRIVVVDDNRDSADTLAVLLQVKGHAPRVAYSADEALALARDYT
FT                   PHLMLIDLTMPDVDGYSLLQALRRIDALADTACVALSGHAQPSDRARSTSAGFDDHLVK
FT                   PVEMPVLDALLQRVARKFQARP"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585396.1"
FT   misc_feature    complement(129894..130937)
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(130599..130910)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(130686..130688,130698..130700,
FT                   130782..130793,130830..130832,130848..130850,
FT                   130860..130862))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(130659..130661,130665..130667,
FT                   130746..130748,130755..130757,130764..130766,
FT                   130788..130790,130800..130802))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(130368..130544)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(130383..130385,130395..130397,
FT                   130404..130406,130416..130418,130425..130427,
FT                   130437..130439,130488..130490,130497..130499,
FT                   130509..130511,130518..130520,130530..130532,
FT                   130542..130544))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(130524..130526)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(129894..130205)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(129906..129908,129912..129917,
FT                   129933..129935,129939..129941,129987..129998,
FT                   130074..130079,130083..130085,130089..130091,
FT                   130095..130097,130164..130166,130173..130175,
FT                   130185..130187))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(130173..130175)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(129990..129992,129996..129998,
FT                   130077..130079,130083..130085))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(129465..129809)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(129507..129512,129519..129521,
FT                   129576..129578,129642..129644,129666..129668,
FT                   129795..129800))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(129666..129668)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(order(129642..129650,129654..129659))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5434"
FT   misc_feature    complement(129504..129512)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5434"
FT   gene            131518..131901
FT                   /db_xref="GeneID:5770654"
FT                   /locus_tag="Bmul_5435"
FT   CDS_pept        131518..131901
FT                   /locus_tag="Bmul_5435"
FT                   /gene_family="HOG000227225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcn:Bcen_1390 hypothetical protein"
FT                   /db_xref="GI:161522468"
FT                   /db_xref="GeneID:5770654"
FT                   /translation="MSTLNPDNEPAGPDDENASRGRDGRALGPSDSSDSGSDTAGARRH
FT                   SFDVDSPLDAHALERGDATLDSDTDRAGTGERAAADGDATFEESADIEPDRLEQLAEPP
FT                   DAGEPDESDELDERGGQRDGEPG"
FT                   /protein_id="YP_001585397.1"
FT   misc_feature    131686..>131886
FT                   /note="Small-conductance mechanosensitive channel [Cell
FT                   envelope biogenesis, outer membrane]; Region: COG3264"
FT                   /db_xref="CDD:33075"
FT                   /locus_tag="Bmul_5435"
FT   gene            131846..133039
FT                   /db_xref="GeneID:5770893"
FT                   /locus_tag="Bmul_5436"
FT   CDS_pept        131846..133039
FT                   /locus_tag="Bmul_5436"
FT                   /gene_family="HOG000268245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport-associated protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transport-associated; KEGG: bch:Bcen2424_6440
FT                   transport-associated"
FT                   /db_xref="GI:161522469"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:5770893"
FT                   /translation="MNRTNWTSAAVSATASPADAHAKTAIRLQIGTTGACGARVRAPHA
FT                   RHADCAGDAARAPGGMGPLVAHAAKEDTMQRRYPGRPVERRGPPDWQERSERAYRDAGE
FT                   RGFPDDPALRPEEDYESAYRRFASEDVGPEEWGSEWTERAARPAAELGGRGARTEWHGG
FT                   PGGPGEPRGAAYEAERGRGQPGGGPDPHRYGGGRDEAPGLRGHFRLGWYGGGERGYDDP
FT                   RTADAPDLSRFGSGAARDAMRGRRGPKGYTRSDERIREDVCERLAHALDIDVSDVSVQV
FT                   SDGRVELDGTVPARWTKHAIEDIADDCMCVRDVENRVRVKREGEHDSGMVLHPAQRTVT
FT                   PTQPAVREPEPGTSAQGAGSSDAGGGGTAGSGAAGSGTAAGTGGTAAGGTPGRERHH"
FT                   /protein_id="YP_001585398.1"
FT   sig_peptide     131846..131914
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.688 at
FT                   residue 23"
FT                   /locus_tag="Bmul_5436"
FT                   /product="hypothetical protein"
FT   misc_feature    132620..132808
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="Bmul_5436"
FT   gene            133087..135831
FT                   /db_xref="GeneID:5770894"
FT                   /locus_tag="Bmul_5437"
FT   CDS_pept        133087..135831
FT                   /locus_tag="Bmul_5437"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter transmembrane region; response
FT                   regulator receiver; ABC transporter related; ATP-binding
FT                   region ATPase domain protein; SMART: AAA ATPase; KEGG:
FT                   bch:Bcen2424_6441 response regulator receiver protein"
FT                   /db_xref="GI:161522470"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="GeneID:5770894"
FT                   /translation="MTPATGDTRRDTRSLRLRIAGELWRAIWRYRARVLAAIALLVLAK
FT                   AAAVSVPLLLKEIVDDFGQLAQRPASLPVLLLFAYAVVRFASNALNEVRDMTFVQVTQS
FT                   TVAAFTVRTFGHLHRLGARFHSQRETGAVVRDLEKGTAGIGYLLGVAVFTIMPTAIEIG
FT                   SVLVIVVSKYGGGFTAIIFVTFAVYAAYTIVFTRRRMRYQRRVNALEAESNSRIVDSLL
FT                   NVDTVKYFAREDVERDRLDRVLNAWSDAGVDNQYALSTLHIGQSACIGAGIAAVMLLAG
FT                   ERVATGAMTVGDLVLINAYIIQISLPLNALGFVFREANDAMTNIERLFGLLDARGKPGE
FT                   DGDVPGAQPLVVRGGAIEFEHVDFGYEPSRQILWDVSFRIEPGQSVAVVGGSGSGKSTL
FT                   ARLLFRLYQPDAGTIRIDGQDLRLVTERSLRDALGIVPQDTILFNDTIAYNIAYGKREA
FT                   TRAEVVAAARSAQLDTFIERLPDAYDTRVGERGVRLSGGERQRVAIARALLKAPPIVVF
FT                   DEATSALDTRSERAIQQELMRVAQHRTSLIIAHRLSTIVDADRILVMEYGRLVEQGTHD
FT                   ELLANGGVYAQMWALQAKQRELERTEAKFARQPVRINPLVSQVLDGLADAAERRGVPVF
FT                   RHLSDEDLIVKADPAALRRFVWELCRNGIDVSGSGGRVQVYTERHDPDARITVACAGVD
FT                   APELSLLALEPLQNAIEEAGGYVVRERDDTGVTLHVSLPLCAIAPASMQPADAEPAPIA
FT                   DRPLDGLRIACVDDHDEARDALTALLTVAGAQVDAFASGQALLDTLWRARRADWPALLV
FT                   CDIDLGDDEEDGYTVMTRVRQLEAARANEDGASSLEALALSGHARERDRARAVEAGFHA
FT                   YLTKPAAPADLIAALRALAFSSGDSHAHSSESVPRRADRTSRR"
FT                   /protein_id="YP_001585399.1"
FT   misc_feature    133297..134010
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:186074"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    133366..134853
FT                   /note="ABC-type transport system involved in Fe-S cluster
FT                   assembly, permease and ATPase components [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: ATM1;
FT                   COG5265"
FT                   /db_xref="CDD:34862"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134155..134862
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134254..134277
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    order(134263..134268,134272..134280,134398..134400,
FT                   134638..134643,134734..134736)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134389..134400
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134566..134595
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134626..134643
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134650..134661
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    134722..134742
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    <134875..135153
FT                   /note="sensory histidine kinase CreC; Provisional; Region:
FT                   PRK11100"
FT                   /db_xref="CDD:182962"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    135376..135714
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    order(135382..135387,135526..135528,135556..135558,
FT                   135643..135645,135700..135702,135709..135714)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    135526..135528
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    order(135535..135540,135550..135558)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5437"
FT   misc_feature    135709..135714
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5437"
FT   gene            135776..136300
FT                   /db_xref="GeneID:5770895"
FT                   /locus_tag="Bmul_5438"
FT   CDS_pept        135776..136300
FT                   /locus_tag="Bmul_5438"
FT                   /gene_family="HOG000268256" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6442 hypothetical protein"
FT                   /db_xref="GI:161522471"
FT                   /db_xref="GeneID:5770895"
FT                   /translation="MPTHLNPSPEGLTARRGGSAFADRQAAIAAVELLLPTLSAALQSD
FT                   FVGDSGCLHIVIMDPALGPHDASFEDAILYEFSLPDPKDWDADYRAYARAKARLSWETG
FT                   RDGHVVQALEPYRLRAGDTNLWGAVAQHGIVVGVSGAQPWFDEAFAGCIAHCLRALAKH
FT                   RAQATPDALAI"
FT                   /protein_id="YP_001585400.1"
FT   gene            136488..137237
FT                   /db_xref="GeneID:5770568"
FT                   /locus_tag="Bmul_5439"
FT   CDS_pept        136488..137237
FT                   /locus_tag="Bmul_5439"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bch:Bcen2424_6443 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522472"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770568"
FT                   /translation="MNGTHDPAQLPLAGRTALVTGGGRGLGEAICEELARNGAHVVVAD
FT                   LDGDRAAAVAQRLTRHGVKAVGRPLDVRDEASVLQAVHDAREVVGDLDVIVNNAAIDVT
FT                   APIDDVSVDAWQQVLMTNLFGPYLMCHAVVPMMKARGGGHIVNIASTASKRAWPNASAY
FT                   HATKWGLLGLSHALHAELRPAGVRVSAIVAGGMRTPFLLDRFPDIDEDTLQPPENVAAA
FT                   VRFVLTQPPGTVVPEVMVLPMKETSWP"
FT                   /protein_id="YP_001585401.1"
FT   misc_feature    136518..137162
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Bmul_5439"
FT   misc_feature    136521..137219
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5439"
FT   gene            137228..137839
FT                   /db_xref="GeneID:5770569"
FT                   /locus_tag="Bmul_5440"
FT   CDS_pept        137228..137839
FT                   /locus_tag="Bmul_5440"
FT                   /gene_family="HOG000016501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; histidinol-phosphate phosphatase family protein;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG:
FT                   bch:Bcen2424_6444 histidinol-phosphate phosphatase family
FT                   protein"
FT                   /db_xref="GI:161522473"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="GeneID:5770569"
FT                   /translation="MALKHDPRPRGAVLLDKDGTLLDDVPYNVDPARMRLAPGAARALR
FT                   SLASTGMPIAVVSNQPGVALGRFTESQLGAVRQRLAELFEENGAALADFFYCPHHPQGS
FT                   VPRYACDCLCRKPRPGMLRRAVAALGVEAGASWMIGDILDDIEAGRAAQCRTILVDRGY
FT                   ETEWRIDATRTPHFVVDRLDLAADIVVRETARRHGSRVRQ"
FT                   /protein_id="YP_001585402.1"
FT   misc_feature    137261..137704
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bmul_5440"
FT   misc_feature    order(137273..137281,137399..137404)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bmul_5440"
FT   misc_feature    137273..137290
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bmul_5440"
FT   misc_feature    137399..137401
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Bmul_5440"
FT   gene            137836..139053
FT                   /db_xref="GeneID:5770570"
FT                   /locus_tag="Bmul_5441"
FT   CDS_pept        137836..139053
FT                   /locus_tag="Bmul_5441"
FT                   /gene_family="HOG000237542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bvi:Bcep1808_5696 glycosyl transferase, family 9"
FT                   /db_xref="GI:161522474"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:5770570"
FT                   /translation="MSAPAWDRARRILCVRLDNLGDVLMTTPALRALKESGNGRHLTLL
FT                   TSSTGAALGAHLPMVDDVWTYDAPWVKHPDAPANPVADLDMIDRLLSARFDAAVIFTVY
FT                   SQSPLPAAMMCWLAGIPLRLAHCRENPYRLLTDRVAETEPDQQVRHEVARQLALVRTIG
FT                   AKTADWRMAFEPGDAARRAVQARLRAALQRFGGPRRGDAQGCGRWLVVHPGASAASRRW
FT                   PAERFGDAAARLVSQFDGVAVTGGSGERALVDAVCERVGPRALPLAGTLPLGELGALIE
FT                   TADLLLSNNSGPAHLAAALGTPVVDLYALTNPQHTPWRVPHRVLNVDVPCRNCYRSVCE
FT                   QPGHPCLRGVRVDDVVDAAHALLRGNARGARHAGARAAAASDTSLAGSAAGASNVIPFA
FT                   HVITRS"
FT                   /protein_id="YP_001585403.1"
FT   misc_feature    137863..138861
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bmul_5441"
FT   misc_feature    137866..>138252
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bmul_5441"
FT   misc_feature    <138451..138873
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5441"
FT   misc_feature    order(138466..138471,138565..138567,138661..138666,
FT                   138700..138702,138709..138714,138721..138723)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5441"
FT   gene            139057..140802
FT                   /db_xref="GeneID:5770460"
FT                   /locus_tag="Bmul_5442"
FT   CDS_pept        139057..140802
FT                   /locus_tag="Bmul_5442"
FT                   /gene_family="HOG000268277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbamoyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carbamoyltransferase; KEGG: bch:Bcen2424_6446
FT                   carbamoyltransferase"
FT                   /db_xref="GI:161522475"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="GeneID:5770460"
FT                   /translation="MPEPIYTLGINAAFHDSAACLVRDGVVVAAAEEERFTHVKHAKRP
FT                   VPFSTWELPYHAIDYCLAEAGIALADVQHVAYSYDPWLELDRHAGQPSLTLPLEPSAHA
FT                   RPPGGESPWHPLFLSSIVNAPRQLADGAPHHLQRRFRGVTHDGPFRWHFVEHHLAHEAS
FT                   AFLAAPYERCAVMTMDGRGERATTSYGVFDGRTYRRIAQVDLPHSLGLLYERVTRYLGF
FT                   LHSSDEYKVMALASYGKPIYADQMRQLVRYRGDGRYDVDEADLVALFGPARERGGPITP
FT                   NHCDIAHALQLVLEETTLRAVEWLAAETGEKQLAMAGGVALNCVMNARIRDRGPFDDVW
FT                   VQPAAGDAGTALGAALWTDFRERGARGDWRMDHAYLGPSFEDDAIEAFIREAQLPYRRL
FT                   NDVAAQTAALLAQNRVIGWFQGRMEFGPRALGARSILASPIDPDMQRKLNRIKDREDFR
FT                   PVAPVALESKAHEWFSGGRREPLHAPFMLFVYDVRPERAERIPAVRHIDGTARVQTVGP
FT                   QQNPLLHALLTEFDALTGVPVLVNTSFNTRGEPIVCTPRDAIECFWTSPLDALVIGSFL
FT                   MEKPR"
FT                   /protein_id="YP_001585404.1"
FT   misc_feature    139072..140793
FT                   /note="Predicted carbamoyl transferase, NodU family
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG2192"
FT                   /db_xref="CDD:32375"
FT                   /locus_tag="Bmul_5442"
FT   misc_feature    139540..140595
FT                   /note="Carbamoyltransferase; Region: CmcH_NodU; pfam02543"
FT                   /db_xref="CDD:111443"
FT                   /locus_tag="Bmul_5442"
FT   gene            140799..141800
FT                   /db_xref="GeneID:5770461"
FT                   /locus_tag="Bmul_5443"
FT   CDS_pept        140799..141800
FT                   /locus_tag="Bmul_5443"
FT                   /gene_family="HOG000268278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bam:Bamb_5649 glycosyl transferase, family 2"
FT                   /db_xref="GI:161522476"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:5770461"
FT                   /translation="MNMRDTQLPPVVSVVVPTYRRPDLLERCLDALCVQVFDPTTYEII
FT                   VVDDDPAGSARPVVDACRARMTDVPAIRYLSAPDTQGPAGARNVGWRSARGALIAFTDD
FT                   DTIPDPTWLRHGAAALLAEPSAAAAAGRIEVPLRPRPTDYERDAAGLAHAEFATANCFV
FT                   RRAALERVGGFDERFTRAWREDADLMFALREHAGPIVDVEDARIVHPVRPARWGASIGQ
FT                   QSKVYFDALLYKKHRTTYRRHIRPVPPWHYYGAVFAALAAIVCFVARWNAAGAVFAGIW
FT                   AAITAWFCCKRLRGTALTPSHVAEMIVTSIAIPPVSLYWRIRGALHFRVFFL"
FT                   /protein_id="YP_001585405.1"
FT   misc_feature    140838..141425
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:187019"
FT                   /locus_tag="Bmul_5443"
FT   misc_feature    order(140847..140849,140853..140855,140937..140939,
FT                   141105..141107,141111..141113)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Bmul_5443"
FT   gene            141797..142873
FT                   /db_xref="GeneID:5770462"
FT                   /locus_tag="Bmul_5444"
FT   CDS_pept        141797..142873
FT                   /locus_tag="Bmul_5444"
FT                   /gene_family="HOG000237543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bvi:Bcep1808_5699 glycosyl transferase, family 9"
FT                   /db_xref="GI:161522477"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:5770462"
FT                   /translation="MTLDTSSPPAPRTIAVFRALQLGDMLCAVPALRALRRGAPDAHIT
FT                   LIGLPWAREFASRFGDYINDFIAFPGAPGLGEQAEPDAAARDAFLAKCRAREFDLAIQL
FT                   HGSGARTNAIVASLGAARTAGFMPADGDAAALDCSIVWRDEEPEVTRYLRLMRALGYPD
FT                   WGDYLEFPLGGLDYALWHVLCDEYALEAGRYVIVHPGARMASRRWPVERFANAARRLAD
FT                   DGWQIVLTGTRAEIALAGAFAEQLGRPCVNLCGRTPLGALAALIGRARLLLCNDTGVSH
FT                   VAAALGTPSVVVACGSDTARWAPLDGERHRVLANYPSCRPCMYDACPYEHECAVAIGVD
FT                   DVIDQASALLAEERRHVT"
FT                   /protein_id="YP_001585406.1"
FT   misc_feature    141827..142858
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bmul_5444"
FT   misc_feature    141836..142840
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5444"
FT   misc_feature    order(142385..142390,142484..142486,142580..142585,
FT                   142619..142621,142628..142633,142640..142642)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5444"
FT   gene            142863..143813
FT                   /db_xref="GeneID:5770268"
FT                   /locus_tag="Bmul_5445"
FT   CDS_pept        142863..143813
FT                   /locus_tag="Bmul_5445"
FT                   /gene_family="HOG000237554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bvi:Bcep1808_5700 glycosyl transferase, group 1"
FT                   /db_xref="GI:161522478"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:5770268"
FT                   /translation="MSRKRLRVLTWHVHGNYLYYLSQAPHDFFIVTKPQHPPGYAGRVG
FT                   HLPWGDNVHEVPVECVRDTAFDCVLYQHHSHYQHDRLHLLSDAQRALPTLFVEHDPPRE
FT                   HPTDTLHPVQDPNVMLVHVTPFNALMWDNGITPTRVIEHGVLVPDNVAYHGTLPKGVSV
FT                   VNNLARRGRRLGVDVFEQVRRSVPLDLVGMGSSELGGIGEVPNPALPHFLSHYRFFFNP
FT                   IRYTSLGLAVIEAMMIGLPIVALATTEMAQLVKTGVNGAADTRPAVLIEAMRMLIRDAD
FT                   LARAWGEAARRDARERFGIERFVRDWDAALTEVAA"
FT                   /protein_id="YP_001585407.1"
FT   misc_feature    <143388..143795
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bmul_5445"
FT   gene            complement(143856..144899)
FT                   /db_xref="GeneID:5770269"
FT                   /locus_tag="Bmul_5446"
FT   CDS_pept        complement(143856..144899)
FT                   /locus_tag="Bmul_5446"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-54 dependent trancsriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bam:Bamb_5646 sigma54 specific transcriptional regulator,
FT                   fis family"
FT                   /db_xref="GI:161522479"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:5770269"
FT                   /translation="MSKSDDDGTRLFGRSRSIQTLMLKVSRVATTRASVLIVGESGAGK
FT                   DIVARLLHDMSPRRRGPFVPVNCGAIPGDIAESQLFGHEKGSFTGAVAQHVGMFEAARG
FT                   GTLFLDEIAEMPLELQVKLLRTLESNTIMRVGGHEAIPIDVRIVAATHHDPVEAVRSGR
FT                   LREDLFYRIATVALHVPALRQREDDVGEIALQIVERLNTRHRTRKRLSTQAMKALRAYT
FT                   WPGNVRELRNAVERAFILADEQIDLQLPRRQPPREEVRHNAMTLHIGTTLAHTQQRFIV
FT                   ASLRHFNGDKPRTAKALGISLKTLYNRLALLPEHERNLVANLSGGTGNAGGGSGSGTNP
FT                   TTNASSQ"
FT                   /protein_id="YP_001585408.1"
FT   misc_feature    complement(143997..144869)
FT                   /note="psp operon transcriptional activator PspF; Region:
FT                   phageshock_pspF; TIGR02974"
FT                   /db_xref="CDD:163093"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(144384..144809)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(144762..144785)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(order(144444..144446,144570..144572,
FT                   144759..144782))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(144567..144584)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(144387..144389)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5446"
FT   misc_feature    complement(143973..>144062)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Bmul_5446"
FT   gene            145248..146615
FT                   /db_xref="GeneID:5770270"
FT                   /locus_tag="Bmul_5447"
FT   CDS_pept        145248..146615
FT                   /locus_tag="Bmul_5447"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component, sigma54 specific, Fis family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bch:Bcen2424_6451 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="GI:161522480"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:5770270"
FT                   /translation="MPYVLIVEDDADTRTMLATLARSQQLTCDTAATLEEARTLVATHT
FT                   PDLVLCDLVLPDGNGMDLFDALPKRAHCEMVLTTGHASLETAIDALRRGATDYLVKPLN
FT                   MQRLNSIFARVPRTTALHEEIAELRSELQRLGRFGRMLGSSPAMQAVYDAIGRVARTEA
FT                   SVLLTGESGTGKELAAQTIHDLSLRRRGPFLAINCGAIAANLVESEMFGHDRGSFTGAE
FT                   RQHKGFFERADGGTLFLDEITEMPLESQVKLLRVLETGRLTRLGSTREIDVDVRIVAAT
FT                   NRDPEAAMADGKLRPDLYHRINVFPIPLPSLRERGDDIPMLADAFLQRYNEESGRNLRF
FT                   APAAREALKTYAWPGNVRELRNFVQRASIFSDVDVIETLPPPIMDELSSMVDSHEDRVT
FT                   VPFGTPLEEVDRKLILGTIAQCGGVKAQAAEVLDVSLKTIYNRLAQLENESDKSDS"
FT                   /protein_id="YP_001585409.1"
FT   misc_feature    145248..146594
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145260..145571
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    order(145269..145274,145401..145403,145425..145427,
FT                   145482..145484,145539..145541,145548..145553)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145401..145403
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    order(145410..145415,145419..145427)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145548..145556
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145683..146156
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145752..145775
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    order(145755..145778,145965..145967,146091..146093)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    145953..145970
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    146148..146150
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5447"
FT   misc_feature    146463..146585
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Bmul_5447"
FT   gene            complement(146633..147559)
FT                   /db_xref="GeneID:5770340"
FT                   /locus_tag="Bmul_5448"
FT   CDS_pept        complement(146633..147559)
FT                   /locus_tag="Bmul_5448"
FT                   /gene_family="HOG000268289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bam:Bamb_5644 glycosyl transferase, family 2"
FT                   /db_xref="GI:161522481"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:5770340"
FT                   /translation="MRRHVRVTPARVALTPHEPRVTAVVLTYRRPDELARTLARLTALP
FT                   DRPAIVVVDNAADAATAALVHARFPHAALVAAPGNPGAAGRNLGVAVARTPYVAFCDDD
FT                   TWWAAGSLRDAADLLDAYPHVAALTARVLVGPDEREDPTCGVMAASPLEAPVPLPGRPI
FT                   LGLLAGATMFRRDAFVRAGGYHPRYFLGGEEALLALDLCAAGDWLVYVPTLTVHHYPST
FT                   ARDARTRASVAARNDAWTAWLRWPAGAALVHTVRMLPRLRRERGLVRAFAGLPWILRER
FT                   RAIAPHVERMRRLIAADDARRNARARA"
FT                   /protein_id="YP_001585410.1"
FT   misc_feature    complement(146903..>147292)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:187019"
FT                   /locus_tag="Bmul_5448"
FT   gene            complement(147538..148233)
FT                   /db_xref="GeneID:5770341"
FT                   /locus_tag="Bmul_5449"
FT   CDS_pept        complement(147538..148233)
FT                   /locus_tag="Bmul_5449"
FT                   /gene_family="HOG000268300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LmbE family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LmbE family protein; KEGG: bam:Bamb_5643
FT                   hypothetical protein"
FT                   /db_xref="GI:161522482"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="GeneID:5770341"
FT                   /translation="MTAPTRWLVVSPHLDDAVFSCGQLLAQAPGSVVVTVFAGIPPAGT
FT                   VAPPWDRRAGFRSADEAMRARREEDRRALSILDARPVWLDFFDDQYGTPAAPSAIAARV
FT                   AAAIAEHPGYGVLAPAGLFHRDHLQVQQAMLMLLRDDDTARVWRFYEDVPYRRIEGLMA
FT                   KRVVGWREHGWIARPVGAPAGEGTGGRDAKARAVEAYASQIALFEPHMLADLRKPEMYW
FT                   QLECDVTYA"
FT                   /protein_id="YP_001585411.1"
FT   misc_feature    complement(<148093..148212)
FT                   /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929"
FT                   /db_xref="CDD:163934"
FT                   /locus_tag="Bmul_5449"
FT   gene            148254..150653
FT                   /db_xref="GeneID:5770342"
FT                   /locus_tag="Bmul_5450"
FT   CDS_pept        148254..150653
FT                   /locus_tag="Bmul_5450"
FT                   /gene_family="HOG000187353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bur:Bcep18194_C7014 multi-sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="GI:161522483"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:5770342"
FT                   /translation="MRQRPRCASASTRHARTGAAPRRPGDTPGAQPMSEKMRTHAGNCA
FT                   TAVMFVAIATVLQALAIRFGGANMPLAVYYPLLAAIAWATSFLFGLIATLASSVLVWTL
FT                   FLSDPAAYAMSLSERLVRLGEFALIGVLACAVVAAVRHARVTNERARRREAAGRAQFEA
FT                   LLNALPDGVIAADTNGRLTYVNAAAAALLGCRPDDAAGRALRDVLQLTDRDGRRVQTSA
FT                   VEHALGGTRTTCERHWLRAAGGEPVPVAETAAPIADADGNVDGAVLLLRDASADRARAD
FT                   AAQVRRAVVDASPDALIGIDRDARIVSWNPAAQRIFGYDEEAAYGRRFDSLIAMRWLKR
FT                   HPLVQTFDHLREIVGPVDLLCVRRDGGRFRATVAARPVRGEARDGVALSITLRETGAQR
FT                   RQDRRTQRSLRSARDAGEQAATSNRLKDELLATVSHELRTPLNVIYGWIEVLRNSGDDA
FT                   LRVQAIDAIDRSARSLTRMVGDILDASSLSTGKLRLDTMPVDVVRLFADVVAAFQTAAS
FT                   SAGIALEFESRVATCIVSGDAERLRQMLSNLVSNALKFTPAGGDVTVSVAHDDTHAVLT
FT                   VTDTGQGIAPEFVPHVFDMFRRADDSPASSRRGLGLGLSIVRHIVQLHGGTVVVDSAGR
FT                   NRGTTFTVKLPAGWQPIGAMAWGMAQTIVERERLGLDTQRILIVDDDATTRASLTAALR
FT                   TLGAEVAVASSGHQAVTIAAQMRPTVVLSDLAMSDGDGFWLLDAIRRRAAEGDDACNPR
FT                   VVAVTAHAGLADERRARAAGFDGYLCKPVDVGDLAREIARVTSRDD"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585412.1"
FT   misc_feature    148755..149048
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    148764..149438
FT                   /note="FOG: PAS/PAC domain [Signal transduction
FT                   mechanisms]; Region: AtoS; COG2202"
FT                   /db_xref="CDD:32384"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(148803..148805,148815..148817,148833..148835,
FT                   148872..148883,148968..148970,148983..148985)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(148863..148865,148875..148877,148905..148907,
FT                   148914..148919,149004..149006,149010..149012)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149130..150188
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149130..149435
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(149178..149180,149190..149192,149208..149210,
FT                   149247..149258,149334..149336,149349..149351)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(149238..149240,149250..149252,149274..149276,
FT                   149283..149288,149370..149372,149376..149378)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149520..149708
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(149538..149540,149550..149552,149562..149564,
FT                   149571..149573,149583..149585,149592..149594,
FT                   149640..149642,149652..149654,149661..149663,
FT                   149673..149675,149682..149684,149694..149696)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149556..149558
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149874..150188
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(149892..149894,149904..149906,149913..149915,
FT                   149982..149984,149988..149990,149994..149996,
FT                   150000..150005,150084..150095,150141..150143,
FT                   150147..150149,150165..150170,150174..150176)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    149904..149906
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(149994..149996,150000..150002,150084..150086,
FT                   150090..150092)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    150342..150635
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(150423..150425,150447..150449,150525..150527,
FT                   150582..150584,150591..150596)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    150423..150425
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    order(150432..150437,150441..150449)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5450"
FT   misc_feature    150591..150599
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5450"
FT   gene            complement(150673..151719)
FT                   /db_xref="GeneID:5770430"
FT                   /locus_tag="Bmul_5451"
FT   CDS_pept        complement(150673..151719)
FT                   /locus_tag="Bmul_5451"
FT                   /gene_family="HOG000168004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: bvi:Bcep1808_5706 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="GI:161522484"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:5770430"
FT                   /translation="MKGYDRKRVLVTGGAGFLGSHLCERLVTAGHDVLCVDNFYTGAKD
FT                   NIAHLLDAPNFELMRHDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINL
FT                   LGLAKRVKARILQASTSEVYGDPDVHPQDERYCGRVNPIGIRACYDEGKRCAETLFMDY
FT                   HRQYGVDVRIARIFNTYGPRMHPADGRVVSNFITQALAGEPLTVYGDGTQTRSFCYVDD
FT                   MIDALVRLMDEPGDACEPVNLGSDDEIAMIDVAREVVRVVGATVPIEFRPLPADDPRQR
FT                   RPNLDAARKRLGWRATTPFASGLAHTARYFIHRQAAHHAPGDLVRSTQIASHMLAQIGT
FT                   RNRAAPTS"
FT                   /protein_id="YP_001585413.1"
FT   misc_feature    complement(<151609..151719)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5451"
FT   misc_feature    complement(150736..>151713)
FT                   /note="UDP-glucuronate decarboxylase; Region: PLN02206"
FT                   /db_xref="CDD:177856"
FT                   /locus_tag="Bmul_5451"
FT   misc_feature    complement(<151003..>151155)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5451"
FT   gene            complement(151719..153035)
FT                   /db_xref="GeneID:5770431"
FT                   /locus_tag="Bmul_5452"
FT   CDS_pept        complement(151719..153035)
FT                   /locus_tag="Bmul_5452"
FT                   /gene_family="HOG000077288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bam:Bamb_5640 glycosyl transferase, group 1"
FT                   /db_xref="GI:161522485"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:5770431"
FT                   /translation="MQRIALISEHASPLGVIGGVDAGGQNIYVANVAKQLAERGLDVDV
FT                   YTRCDNAHLPEVVRIGTRMRVIHVPAGPPVDVPKEKLLPYMGAFADYMIARMRREPDPV
FT                   DVMHANFFMSGEAALRVKKRLGIPLVTTFHALGRVRRLHQGAADGFPDARFAIEDTLAR
FT                   RSDRLIAECPQDALDLTTHYRADASRIEIVPCGFDAREFRPVPRAAARAQLGWPNDAFV
FT                   VLQLGRLVPRKGIDNVIDALARMPRDPQRPTRLYVVGGSQATPDPANDPELARLVALAH
FT                   DVGIADRVTFVGRRDRDALHLYYSAADVFVTTPWYEPFGITPVEAMACATPVIGSDVGG
FT                   IRTTVEDGKTGYLVPPRDPAALAERLVQLRAQPDHCAALGRAGYERAHRFYTWRGVVDR
FT                   LVDVYRDVARERAGTTAATSRRTPVATTPAVLATRKENA"
FT                   /protein_id="YP_001585414.1"
FT   misc_feature    complement(151857..153029)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. The sucrose-phosphate
FT                   synthases in this family may be unique to plants and
FT                   photosynthetic bacteria. This enzyme catalyzes the
FT                   synthesis of sucrose 6-phosphate from fructose...; Region:
FT                   GT1_Sucrose_synthase; cd03800"
FT                   /db_xref="CDD:99973"
FT                   /locus_tag="Bmul_5452"
FT   misc_feature    complement(151857..153026)
FT                   /note="UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate
FT                   1-alpha-D-N-acetylglucosaminyltransferase; Region:
FT                   mycothiol_MshA; TIGR03449"
FT                   /db_xref="CDD:132490"
FT                   /locus_tag="Bmul_5452"
FT   misc_feature    complement(order(152070..152072,152136..152138,
FT                   152352..152360,152964..152966))
FT                   /note="putative ADP-binding pocket; other site"
FT                   /db_xref="CDD:99973"
FT                   /locus_tag="Bmul_5452"
FT   gene            153302..153706
FT                   /db_xref="GeneID:5770432"
FT                   /locus_tag="Bmul_5453"
FT   CDS_pept        153302..153706
FT                   /locus_tag="Bmul_5453"
FT                   /gene_family="HOG000130654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport-associated protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transport-associated; KEGG: bch:Bcen2424_6457
FT                   transport-associated"
FT                   /db_xref="GI:161522486"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:5770432"
FT                   /translation="MKLNSLQARSPRLRGRRTRRIGLAIAVAAATCALAAPNVYAAGDD
FT                   SASSSSSSSSSHSSTGTKIRDATITTKAKAELVGTSGLTSGDIHVKTRHGVVMLTGSVP
FT                   DEQQRTMAVDAVKKVDGVQSVRDQLTIRPK"
FT                   /protein_id="YP_001585415.1"
FT   sig_peptide     153302..153427
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 42"
FT                   /locus_tag="Bmul_5453"
FT                   /product="hypothetical protein"
FT   misc_feature    153509..153700
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="Bmul_5453"
FT   gene            153735..154763
FT                   /db_xref="GeneID:5770692"
FT                   /locus_tag="Bmul_5454"
FT   CDS_pept        153735..154763
FT                   /locus_tag="Bmul_5454"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bch:Bcen2424_6458 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522487"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770692"
FT                   /translation="MNCMLKPVGEQTIVITGATSGIGLVTARKAARRGAKLVLFARNAD
FT                   ALNTLCEEIRQHGGLAVPVAGDVANIEDLQRAAAQAVETYGGFDTWVNNAGVSIFGTAA
FT                   TVPLEDQRRLFDTNYWGVVHGSLVAADHFRRQNDLRGGAIINMGSEASDAPLPLQSAYV
FT                   ASKHAVKGFTDSLRLELESDRLPVSVTLIKPAAMDTMFVMHAKNYMNVEPKLPPPIYDP
FT                   ELVADAILFAAAHPRRTLFVGGAAKLTSASAYHAPRLFDRLAATLFSRGQRTVRPARPR
FT                   DDNALYESRHALHEREGMEGPVLRSCAYNTVVQRPKVASAVALTAAALLFAAVARSRRA
FT                   AA"
FT                   /protein_id="YP_001585416.1"
FT   misc_feature    153741..154685
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5454"
FT   misc_feature    153744..154622
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK06139"
FT                   /db_xref="CDD:168417"
FT                   /locus_tag="Bmul_5454"
FT   gene            154795..155094
FT                   /db_xref="GeneID:5770693"
FT                   /locus_tag="Bmul_5455"
FT   CDS_pept        154795..155094
FT                   /locus_tag="Bmul_5455"
FT                   /gene_family="HOG000266268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6459 hypothetical protein"
FT                   /db_xref="GI:161522488"
FT                   /db_xref="GeneID:5770693"
FT                   /translation="MTSRQHTGHEHSHSRAHEGERTQQDHDKGGHQTGHGKPPSPIDVQ
FT                   KALKGLDYPASKSDVVECAERSHADPDVLEMLKQIPDREYETPASVSKELGRLM"
FT                   /protein_id="YP_001585417.1"
FT   misc_feature    154936..155067
FT                   /note="Protein of unknown function (DUF2795); Region:
FT                   DUF2795; pfam11387"
FT                   /db_xref="CDD:151827"
FT                   /locus_tag="Bmul_5455"
FT   gene            155153..155719
FT                   /db_xref="GeneID:5770694"
FT                   /locus_tag="Bmul_5456"
FT   CDS_pept        155153..155719
FT                   /locus_tag="Bmul_5456"
FT                   /gene_family="HOG000187464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6460 hypothetical protein"
FT                   /db_xref="GI:161522489"
FT                   /db_xref="GeneID:5770694"
FT                   /translation="MAMIVAGRFTTFEEAEGGARRLYERAFGPDDVSIFFLNPGGQHAR
FT                   FPVGGDVYADTAAKPGGRGAVVGVMRGLAIGLVVGLIVYAIGLRYWFVPVAGALAGAYL
FT                   GAFGGALGRMRGQQAEGRGTLAKTESGVILAARVTPGSATTAEDVLRATGATSIERVEG
FT                   DWQNGEWRDFDPVRRPDEAGAAGPR"
FT                   /protein_id="YP_001585418.1"
FT   gene            155851..156708
FT                   /db_xref="GeneID:5770448"
FT                   /locus_tag="Bmul_5457"
FT   CDS_pept        155851..156708
FT                   /locus_tag="Bmul_5457"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bch:Bcen2424_6461 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522490"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770448"
FT                   /translation="MTTAQTPPPQKQTQQPGTEREMNPKPRDEAADYVGSGKLAGKVAL
FT                   VTGGDSGIGRAVAIGFAKEGADVAIVYLKESDDAAHTKRLIEQAGRRCEAIACDVGDRQ
FT                   QAFDAVARTVERLGRLDVLVNNAGEQHPQPSVEEVSEEQLERTFRTNVYGMFFCTQAAL
FT                   KHMQPGARIVNTASVTAYHGSPKLPDYSATKGAIVAFTRSLSIELAERDIRVNAVAPGP
FT                   IWTPLIPSTFTAEQVAKFGSNVPLKRPGQPDELIGCYVLLASEGASYMTGQTLHPNGGS
FT                   IVGG"
FT                   /protein_id="YP_001585419.1"
FT   misc_feature    155905..156705
FT                   /note="short chain dehydrogenase; Provisional; Region:
FT                   PRK06701"
FT                   /db_xref="CDD:180661"
FT                   /locus_tag="Bmul_5457"
FT   misc_feature    155956..156690
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5457"
FT   gene            156735..157349
FT                   /db_xref="GeneID:5770449"
FT                   /locus_tag="Bmul_5458"
FT   CDS_pept        156735..157349
FT                   /locus_tag="Bmul_5458"
FT                   /gene_family="HOG000187685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5634 hypothetical protein"
FT                   /db_xref="GI:161522491"
FT                   /db_xref="GeneID:5770449"
FT                   /translation="MRTQHWTIAALAAAGVLGLSTAAHAQMPSEPPASNSHVPGGVVNP
FT                   SSGAAAADSGIAKSPQGTDAEFVDKAALGGKTEVQASQLALKQAKSADVRTFAKRMVAD
FT                   HSKANAQLTKLAARKGIKPQAEQIADPDVEALRGKQGHDFDVAYVAAAGPDAHRKTIAL
FT                   FESEARDGKDADLRAFAKSTLPTLKHHLSMAEALQRKVGAQ"
FT                   /protein_id="YP_001585420.1"
FT   sig_peptide     156735..156812
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT                   /locus_tag="Bmul_5458"
FT                   /product="hypothetical protein"
FT   misc_feature    156918..157325
FT                   /note="Predicted outer membrane protein [Function unknown];
FT                   Region: COG3652"
FT                   /db_xref="CDD:33450"
FT                   /locus_tag="Bmul_5458"
FT   gene            157407..158015
FT                   /db_xref="GeneID:5770450"
FT                   /locus_tag="Bmul_5459"
FT   CDS_pept        157407..158015
FT                   /locus_tag="Bmul_5459"
FT                   /gene_family="HOG000268311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6463 hypothetical protein"
FT                   /db_xref="GI:161522492"
FT                   /db_xref="GeneID:5770450"
FT                   /translation="MAQRQAKHEGIQELLCQAYETELGGEKVYQAALQCAVDEDLHKEW
FT                   EKYHRETQHHQEVLRKVFDALGLDPDTQTPGRAAVAATGKSLVQVIEHAKKQADPAVAQ
FT                   VVAAECVVLAETKDHLNWELIGYAADQLSGDAAKVLKEAHDEVEPDEDHHLYHTRGWAR
FT                   EMWIQSMGFKAVLPPPEEVKKVESAAEAARAERSRGKMM"
FT                   /protein_id="YP_001585421.1"
FT   gene            158044..159219
FT                   /db_xref="GeneID:5770776"
FT                   /locus_tag="Bmul_5460"
FT   CDS_pept        158044..159219
FT                   /locus_tag="Bmul_5460"
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bpd:BURPS668_A3146 oxidoreductase, zinc-binding
FT                   dehydrogenase family"
FT                   /db_xref="GI:161522493"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:5770776"
FT                   /translation="MMALCWHGKRTVRYERVPDPAIEHPRDAIVKVRRCAIGGADLHLY
FT                   DAAMPGLKDGAILGREFVGEVVEVGRENRHLHVGDRVVVPFVVACGECEQCRRGNYSVC
FT                   EASNPNRAFVERVYGQGTGGLLGGGHLAGSYAGGHAEYVRVPFADVAPIRLPDELDDER
FT                   ALPLGDTLPAGWQAAAQCAIQPNDVVAVWGAGAVGLFAALAARLLGAREVIAIDCVPAR
FT                   LECARTLGATPLDFTKLSVADTLAKHTRGKGPDKCIDAVGLHAHAIDAVDAPLDRFKET
FT                   SAPGVDPPHVLREAVYACRPGGIVSIAGLYGGLVDNVPVGAIVNKGLTLRAAQTHVPRW
FT                   SDELLKRIADGQIDPSFVVTHRARLEDGPALYELSRTRSDGCIKAVMQPGE"
FT                   /protein_id="YP_001585422.1"
FT   misc_feature    158044..159210
FT                   /note="Glutathione-dependent formaldehyde dehydrogenase
FT                   related proteins, child 1; Region: FDH_like_1; cd08283"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5460"
FT   misc_feature    158044..159210
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="Bmul_5460"
FT   misc_feature    order(158155..158163,158170..158172,158299..158301,
FT                   158548..158550,158560..158562,158617..158622,
FT                   158626..158634,158689..158697,158707..158709,
FT                   158749..158751,158821..158829,158914..158916,
FT                   158965..158973,159040..159048,159166..159168)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5460"
FT   misc_feature    order(158155..158157,158161..158163,158221..158223,
FT                   158548..158550)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5460"
FT   misc_feature    order(158311..158316,158320..158322,158329..158331,
FT                   158353..158355)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176243"
FT                   /locus_tag="Bmul_5460"
FT   gene            complement(159295..160599)
FT                   /db_xref="GeneID:5770777"
FT                   /locus_tag="Bmul_5461"
FT   CDS_pept        complement(159295..160599)
FT                   /locus_tag="Bmul_5461"
FT                   /gene_family="HOG000267728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6464 natural
FT                   resistance-associated macrophage protein"
FT                   /db_xref="GI:161522494"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="GeneID:5770777"
FT                   /translation="MSSARRDAPPADDTARPARPPWYRRLGPGLLAGASDADPSNVAVY
FT                   AQAGSQVGFNMLWMIVVTLPMMVAVQIASACIGRSNREGLIAGIRQHYSARAAKALIAL
FT                   VVIVNVVNVGADLAAMGDATALVVGGRSYWFAPVYGIVSLALQVTMSYERYARWLKWLT
FT                   FALLAYVIELAFVHVDWLHALHALVLPQIAFSHAYATTAVAVLGTTLSPYLFVWQAALE
FT                   VEDAQAAQRNGASARDTALCDRQAQRIRVDTWAGMVVTNAVSFCIMVVGAAVFYARGEH
FT                   DIASTAQAAEALRPIAGEAAFLVFAFGIVGCGLLAIPAFAGSAAYGCAEAWRFREGLNE
FT                   PVRRAPAFYTVLTLCVVVGIAICFSPIDPIRALYWSAVLNGVAAVPMLVMVMLLSARRG
FT                   IDGRPGTGIVSKCFGWLAVALMAAAVVTMVVDMVA"
FT                   /protein_id="YP_001585423.1"
FT   misc_feature    complement(159457..160476)
FT                   /note="Natural resistance-associated macrophage protein;
FT                   Region: Nramp; cl00836"
FT                   /db_xref="CDD:186214"
FT                   /locus_tag="Bmul_5461"
FT   gene            complement(160596..161255)
FT                   /db_xref="GeneID:5770778"
FT                   /locus_tag="Bmul_5462"
FT   CDS_pept        complement(160596..161255)
FT                   /locus_tag="Bmul_5462"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   bam:Bamb_5631 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="GI:161522495"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:5770778"
FT                   /translation="MTRASSASGADDTPDDQRPATLDACRRCGLWEHATQPVPGTGPRH
FT                   ASIVLVGEQPGDQEDRTGVPFVGAAGHVLDRALDAAGIDRRSVYLTNAVKHFKWEPRGK
FT                   RRLHKTPAQREITACRYWLDRELESVHPRVIVALGGTALRAVLQDNDATLQRTPTPTRT
FT                   AQGYLVVATYHPSYVLRTRGADSREHAYQTLVDALRTASKLARDDGKPKAGRGDAE"
FT                   /protein_id="YP_001585424.1"
FT   misc_feature    complement(160716..161183)
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:186027"
FT                   /locus_tag="Bmul_5462"
FT   gene            161461..162009
FT                   /db_xref="GeneID:5770412"
FT                   /locus_tag="Bmul_5463"
FT   CDS_pept        161461..162009
FT                   /locus_tag="Bmul_5463"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bam:Bamb_5630 response regulator receiver protein"
FT                   /db_xref="GI:161522496"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:5770412"
FT                   /translation="MPIAPGDDPAADDVLLWRSPDSVPRRPRRVLVVDDYRDAADALQL
FT                   LLDARGFECRVVDDPFAVCDVARDWQPFAIVLDIAMPRLDGLQLARRLRGDPRTADMLL
FT                   VACSAFASPVDRERAREAGFDAHCAKPLTPHPLLRYLEAACGARAAQRADGAERVDGAG
FT                   RADGADGLDGADGAVTRGL"
FT                   /protein_id="YP_001585425.1"
FT   misc_feature    161608..161886
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5463"
FT   misc_feature    order(161692..161694,161716..161718,161782..161784,
FT                   161839..161841,161848..161853)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5463"
FT   misc_feature    161692..161694
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5463"
FT   misc_feature    order(161701..161706,161710..161718)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5463"
FT   misc_feature    161848..161856
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5463"
FT   gene            complement(162112..162597)
FT                   /db_xref="GeneID:5770413"
FT                   /locus_tag="Bmul_5464"
FT   CDS_pept        complement(162112..162597)
FT                   /locus_tag="Bmul_5464"
FT                   /gene_family="HOG000187796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PRC-barrel domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bam:Bamb_5622
FT                   PRC-barrel domain protein"
FT                   /db_xref="GI:161522497"
FT                   /db_xref="InterPro:IPR007903"
FT                   /db_xref="GeneID:5770413"
FT                   /translation="MQTPDQGQTRIVGKGAATADGPGPDVMAADTLEGNKVYTTDGDDV
FT                   GKIKDIMLDVRSGRVAYAVLSSGGLLGIGDKLLAIPWSALTLDTERKCFLLSVSSERIR
FT                   NAPGFDKDHWPAMADPQWAGPLHEYYGSTPYWSAGDELGLTDPTEDLNDPRARDGRL"
FT                   /protein_id="YP_001585426.1"
FT   misc_feature    complement(162322..162528)
FT                   /note="Photosynthetic reaction center (RC) complex, subunit
FT                   H;  RC is an integral membrane protein-pigment complex
FT                   which catalyzes light-induced reduction of ubiquinone to
FT                   ubiquinol, generating a transmembrane electrochemical
FT                   gradient of protons used to...; Region: PRCH; cl09959"
FT                   /db_xref="CDD:164180"
FT                   /locus_tag="Bmul_5464"
FT   gene            complement(162686..163117)
FT                   /db_xref="GeneID:5770414"
FT                   /locus_tag="Bmul_5465"
FT   CDS_pept        complement(162686..163117)
FT                   /locus_tag="Bmul_5465"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bvi:Bcep1808_5724 CBS domain containing protein"
FT                   /db_xref="GI:161522498"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:5770414"
FT                   /translation="MHRVNEIMSQDVVRIAPTDSIRHAAELMARYDIGALPVCDNNRLV
FT                   GMVTDRDLAVRAVSAGKPPDTRVHEVASGPIEWCFDDDSLDEIQHYMADAQLRRLPVVD
FT                   HDKRLVGMLSLADIATRTAGPSRDALANTLEGVSQPKQA"
FT                   /protein_id="YP_001585427.1"
FT   misc_feature    complement(162764..163108)
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="Bmul_5465"
FT   misc_feature    complement(162755..163090)
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_9; cd04622"
FT                   /db_xref="CDD:73121"
FT                   /locus_tag="Bmul_5465"
FT   gene            complement(163171..163431)
FT                   /db_xref="GeneID:5770487"
FT                   /locus_tag="Bmul_5466"
FT   CDS_pept        complement(163171..163431)
FT                   /locus_tag="Bmul_5466"
FT                   /gene_family="HOG000268322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6472 hypothetical protein"
FT                   /db_xref="GI:161522499"
FT                   /db_xref="GeneID:5770487"
FT                   /translation="MNDTTRSEERTPSSGQQPDPTPPLKDRDSARTRHSERHIDKSLED
FT                   TFPASDAPSTGGVTRIEPDTPPGTHDDGPWQEKREQDEGGR"
FT                   /protein_id="YP_001585428.1"
FT   gene            163583..163888
FT                   /db_xref="GeneID:5770488"
FT                   /locus_tag="Bmul_5467"
FT   CDS_pept        163583..163888
FT                   /locus_tag="Bmul_5467"
FT                   /gene_family="HOG000188022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6473 hypothetical protein"
FT                   /db_xref="GI:161522500"
FT                   /db_xref="GeneID:5770488"
FT                   /translation="MIPIKRQPRVRYEVNVCGGGFDSVKHHFTAWKQEPLIYRPERRMF
FT                   EGKADVRPLGDETFGATEPARFALQRACEPGDAYALAARVEDEGRNLWLVMAAYDT"
FT                   /protein_id="YP_001585429.1"
FT   gene            164256..164486
FT                   /db_xref="GeneID:5770489"
FT                   /locus_tag="Bmul_5468"
FT   CDS_pept        164256..164486
FT                   /locus_tag="Bmul_5468"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6474 hypothetical protein"
FT                   /db_xref="GI:161522501"
FT                   /db_xref="GeneID:5770489"
FT                   /translation="MNEDLAHSLHRPDPPMPDTEPEPVPPPAPELPPDVPQPYHDPEGD
FT                   PPEHRPPEREPPAPVPPAHAATPRARQECTR"
FT                   /protein_id="YP_001585430.1"
FT   gene            164483..164794
FT                   /db_xref="GeneID:5771077"
FT                   /locus_tag="Bmul_5469"
FT   CDS_pept        164483..164794
FT                   /locus_tag="Bmul_5469"
FT                   /gene_family="HOG000188133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6475 hypothetical protein"
FT                   /db_xref="GI:161522502"
FT                   /db_xref="GeneID:5771077"
FT                   /translation="MSILVKQGMLRDIAEMLGRHFEARAMPFHVEEQPAGALHIGFRVD
FT                   GHPASLTVTFDADAFAALEQADVARQRGALARMAAEFDAMMARRGPTAYAADFHFNRL"
FT                   /protein_id="YP_001585431.1"
FT   gene            164839..165150
FT                   /db_xref="GeneID:5771078"
FT                   /locus_tag="Bmul_5470"
FT   CDS_pept        164839..165150
FT                   /locus_tag="Bmul_5470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5617 hypothetical protein"
FT                   /db_xref="GI:161522503"
FT                   /db_xref="GeneID:5771078"
FT                   /translation="MKSIHSLSVAVCAAAAACAMSACTQPNTYGTTGAPPPPHQGGNAS
FT                   PPTETMPDANTRYDTRPSPGNTMPQRSTGTPTGVPDPNVGGAPTNTRPAPGTPPPMQY"
FT                   /protein_id="YP_001585432.1"
FT   sig_peptide     164839..164913
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT                   /locus_tag="Bmul_5470"
FT                   /product="hypothetical protein"
FT   gene            165171..165680
FT                   /db_xref="GeneID:5771079"
FT                   /locus_tag="Bmul_5471"
FT   CDS_pept        165171..165680
FT                   /locus_tag="Bmul_5471"
FT                   /gene_family="HOG000268354" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   bch:Bcen2424_6476 protein of unknown function DUF892"
FT                   /db_xref="GI:161522504"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="GeneID:5771079"
FT                   /translation="MATPHAHLEDWLRDAYAMEHHAQALLDAQARRVGHYPLLQDRLRR
FT                   HRDDTLGQQALVEACLQRLGTTPSTIKDLGARIGAYGQVATAMLSGDEVVKATMAAYAF
FT                   AQVEIAAYTALIAAARAAGEAEIHACCERLLQQERDMAAWLLRELPDVTTAFLDRSAVD
FT                   RIDAKR"
FT                   /protein_id="YP_001585433.1"
FT   misc_feature    165177..165644
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:185872"
FT                   /locus_tag="Bmul_5471"
FT   gene            165869..167296
FT                   /db_xref="GeneID:5771074"
FT                   /locus_tag="Bmul_5472"
FT   CDS_pept        165869..167296
FT                   /locus_tag="Bmul_5472"
FT                   /gene_family="HOG000071905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /transl_table="11"
FT                   /note="sigma factors are initiation factors that promote
FT                   the attachment of RNA polymerase to specific initiation
FT                   sites and are then released; sigma 54 factor is responsible
FT                   for the expression of enzymes involved in nitrogen
FT                   assimilation and metabolism; the rhizobia often have 2
FT                   copies of this sigma factor; in Rhizobium etli RpoN1 shown
FT                   to be involved in the assimilation of several nitrogen and
FT                   carbon sources during free-living aerobic growth and RpoN2
FT                   is involved in symbiotic nitrogen fixation; in
FT                   Bradyrhizobium both RpoN1 and N2 are functional in
FT                   free-living and symbiotic conditions, rpoN1 gene was
FT                   regulated in response to oxygen"
FT                   /db_xref="GI:161522505"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="GeneID:5771074"
FT                   /translation="MSVTLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDTNP
FT                   FLEDGQGDDEVAAPDPAAEAAAPEAAPERDEVRPVDGELSYTAAPAPRGGSRQGEDGGD
FT                   LSPGEWMAAEPSLHQHLHEALRLYPLNRRDREAARLVIDALDDDGYLRQEPGDLLGAAD
FT                   PALLLSERDLSVALRLVQMLDRPGIAARSLSECLLLQLDAIPAGTPALPEAKAIAREHL
FT                   ERLARRETAEIQRRIGCNQQTLQAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQVRD
FT                   EWVVTINPAVLPRARLHERYATLFAQSSGERDSPLGQQLQEARWLIRNVQKRFDTIQRV
FT                   GECIVARQRDFFRYGEIAMKPLVLRDIAEELDLHESTVSRATGNKYMATPHGTFEFKHF
FT                   FPRKLEAAGRGVCSASAAKVLIRDMIAAERHTDPLSDVALTQNLAGRGILLARRTVTKY
FT                   RQAMKIPPAELRRRDAA"
FT                   /protein_id="YP_001585434.1"
FT   misc_feature    165869..167287
FT                   /note="RNA polymerase factor sigma-54; Provisional; Region:
FT                   PRK12469"
FT                   /db_xref="CDD:183544"
FT                   /locus_tag="Bmul_5472"
FT   misc_feature    166202..166774
FT                   /note="Sigma-54 factor, core binding domain; Region:
FT                   Sigma54_CBD; pfam04963"
FT                   /db_xref="CDD:147239"
FT                   /locus_tag="Bmul_5472"
FT   misc_feature    166814..167284
FT                   /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
FT                   pfam04552"
FT                   /db_xref="CDD:113327"
FT                   /locus_tag="Bmul_5472"
FT   gene            167596..167757
FT                   /db_xref="GeneID:5771075"
FT                   /locus_tag="Bmul_5473"
FT   CDS_pept        167596..167757
FT                   /locus_tag="Bmul_5473"
FT                   /gene_family="HOG000237282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   bam:Bamb_5614 protein of unknown function DUF1328"
FT                   /db_xref="GI:161522506"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="GeneID:5771075"
FT                   /translation="MLRYALIFFVIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVT
FT                   LLLGVVRR"
FT                   /protein_id="YP_001585435.1"
FT   sig_peptide     167596..167679
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.754 at
FT                   residue 28"
FT                   /locus_tag="Bmul_5473"
FT                   /product="hypothetical protein"
FT   gene            167754..168140
FT                   /db_xref="GeneID:5771076"
FT                   /locus_tag="Bmul_5474"
FT   CDS_pept        167754..168140
FT                   /locus_tag="Bmul_5474"
FT                   /gene_family="HOG000268366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7022 hypothetical protein"
FT                   /db_xref="GI:161522507"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="GeneID:5771076"
FT                   /translation="MTAASDRSQRIAEIEHALANGFPSQSTVVVHADDASGRLTIQVSW
FT                   VRAPVEASAREWRCAVDLRFEPDVIAGYAALDAAERLRVRTYLCDLARRAIDENKPRVE
FT                   DAAIECSAALDVSAADIGDASRGP"
FT                   /protein_id="YP_001585436.1"
FT   misc_feature    167781..168125
FT                   /note="Protein of unknown function (DUF3022); Region:
FT                   DUF3022; pfam11226"
FT                   /db_xref="CDD:151668"
FT                   /locus_tag="Bmul_5474"
FT   gene            168316..169359
FT                   /db_xref="GeneID:5770841"
FT                   /locus_tag="Bmul_5475"
FT   CDS_pept        168316..169359
FT                   /locus_tag="Bmul_5475"
FT                   /gene_family="HOG000237248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ku protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   bvi:Bcep1808_5734 Ku domain protein"
FT                   /db_xref="GI:161522508"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="GeneID:5770841"
FT                   /translation="MAARMIWKGAISFGLVHVPVQLFPATRTVKPSFRLLDKRSMDPVG
FT                   YRQINKRTGKEVSRDDIVRGYEYEKERYVVLTDDEIRAANPESTQTVDILTFVDQEAVS
FT                   FLYLDTPYYLVPDRKGEKVYALLRDALKDSGKIGIALVVMRDKQHLGALIPVGPLLALD
FT                   TLRWQDELRGLDELSTPVEDAKRAGVSARELAMAKKLIDDMSGEWTPEQYHDTFRDDIL
FT                   ELVERKVRQGRIEEIEERPADRGHVPSNVVDLTELLKRSLRGGGRGSERAAANEDEHDE
FT                   DADTRPRGRRQPAAAKRGAKTAAKTSAKTATKTAAKRTSAAKPGDKRGDGAAAAKKTAA
FT                   RSKKRAA"
FT                   /protein_id="YP_001585437.1"
FT   misc_feature    168322..169080
FT                   /note="Ku protein, prokaryotic; Region: Ku_bact; TIGR02772"
FT                   /db_xref="CDD:163009"
FT                   /locus_tag="Bmul_5475"
FT   misc_feature    168325..169080
FT                   /note="Ku-core domain, Ku-like subfamily; composed of
FT                   prokaryotic homologs of the eukaryotic DNA binding protein
FT                   Ku. The alignment includes the core domain shared by the
FT                   prokaryotic YkoV-like proteins and the eukaryotic Ku70 and
FT                   Ku80. The prokaryotic Ku...; Region: KU_like; cd00789"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bmul_5475"
FT   misc_feature    order(168328..168330,168385..168387,168412..168414,
FT                   168457..168459,168748..168750)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bmul_5475"
FT   misc_feature    order(168364..168366,168385..168399,168412..168423,
FT                   168436..168438,168445..168456,168460..168468,
FT                   168484..168486,168496..168504,168508..168510,
FT                   168514..168519,168529..168534,168541..168543,
FT                   168598..168600,168604..168609,168637..168639,
FT                   168679..168681,168736..168738,168817..168825,
FT                   168829..168831,168925..168927,168937..168939,
FT                   168952..168960,168997..168999)
FT                   /note="putative homodimer interface; other site"
FT                   /db_xref="CDD:63881"
FT                   /locus_tag="Bmul_5475"
FT   gene            169384..172167
FT                   /db_xref="GeneID:5770842"
FT                   /locus_tag="Bmul_5476"
FT   CDS_pept        169384..172167
FT                   /locus_tag="Bmul_5476"
FT                   /gene_family="HOG000222509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA ligase D"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: bcn:Bcen_1346 ATP dependent DNA ligase"
FT                   /db_xref="GI:161522509"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="GeneID:5770842"
FT                   /translation="MAGKLDPYRRKRHFDATPEPEGTRRRRAPADAQPAERGRHPLRYV
FT                   IQEHHARRLHYDFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGEIPA
FT                   GHYGAGSVIVWDEGTWTPEGGLAKAREGYRAGKLKFRLDGEKLHGGWALVRSGRQEGRQ
FT                   EQWLLIKERDDDARSAEAYDVVAQQPGSVHDGATRGHATNGHARARRRGEKAAGKEPDA
FT                   EADADTDADAPRARATKAKRPPALSRVEGAVRAPLPERIAPQLATLVDAPPAHGDWRYE
FT                   LKFDGYRMLARIAGKGARRRVTLMTREGRDWTPKLRALRDALAALEVDDAWLDGEAVVL
FT                   GENGLPDFQLLQNALGSGQSDAVTLFVFDLPYLNGYDLRDAPLTARRAQLEPLFDAADP
FT                   ARLRFSPDLGSDAAGLIANACDTGLEGLIGKRADARYRAGRSPAWIKLKCRRRQEFVIG
FT                   GYTEPTGSRHGFGALLLGVHEPAPNGKRTRGASPLRYVGRVGTGFDTRMLDKLAPLLRE
FT                   HERASSPFDPPPQGWSRTRVHWVEPTLVAECEFAEWTGDGIVRQAAFVALREDKPASQI
FT                   VREVARHPTTENTMDERTSSSARRGRAAADTHDGGQDRAQHRAQERAPAARGKSAPDQV
FT                   GQVRITHPERVLDRESGTRKIDLAHYWERVAPWALPDLAGRPVSLVRAPQDIGGELFFQ
FT                   KHAERREIPFVTQHPGLDPGHGPLLSIDSVDALIGAAQMGTIELHTWNAHASNIERPDR
FT                   IVFDLDPDPALPWRTMIEAAQLVRGLLDELGLVSFCKTSGGKGLHVVVPITRHSGWDEM
FT                   KDFSRAVAQHIAGALPDRFTATMGPRHRRGKIFIDYLRNGRGASTIAAYSVRARPGMGV
FT                   SVPIDWDEVPATTGGAQWTIDTVHERLDALERDPWEAYADTRQRITAAMRTRLAAR"
FT                   /protein_id="YP_001585438.1"
FT   misc_feature    169384..172164
FT                   /note="ATP-dependent DNA ligase; Reviewed; Region: ligD;
FT                   PRK05972"
FT                   /db_xref="CDD:180331"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    169396..169905
FT                   /note="DNA ligase D, 3'-phosphoesterase domain; Region:
FT                   LigD_PE_dom; TIGR02777"
FT                   /db_xref="CDD:131824"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    170164..170733
FT                   /note="Adenylation domain of Mycobacterium tuberculosis
FT                   LigD and LigC-like ATP-dependent DNA ligases; Region:
FT                   Adenylation_DNA_ligase_LigD_LigC; cd07906"
FT                   /db_xref="CDD:185715"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    order(170224..170235,170239..170247,170302..170304,
FT                   170389..170391,170425..170427,170485..170487,
FT                   170656..170658,170665..170667,170671..170673,
FT                   170713..170715,170719..170721)
FT                   /note="active site"
FT                   /db_xref="CDD:185715"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    order(170230..170232,170239..170247,170299..170307,
FT                   170311..170313,170317..170319,170425..170430,
FT                   170437..170445,170656..170658,170719..170721,
FT                   170725..170727)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:185715"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    170734..171111
FT                   /note="The Oligonucleotide/oligosaccharide binding
FT                   (OB)-fold domain of ATP-dependent DNA ligase LigD is a
FT                   DNA-binding module that is part of the catalytic core unit;
FT                   Region: OBF_DNA_ligase_LigD; cd07971"
FT                   /db_xref="CDD:153440"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    order(170794..170796,170872..170877,170881..170898,
FT                   171055..171057,171061..171066,171070..171072)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153440"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    171346..172023
FT                   /note="PaeLigD_Pol_like: Polymerase (Pol) domain of
FT                   bacterial LigD proteins similar to Pseudomonas aeruginosa
FT                   (Pae) LigD. The LigD Pol domain belongs to the
FT                   archaeal/eukaryal primase (AEP) superfamily. In
FT                   prokaryotes, LigD along with Ku is required for non-...;
FT                   Region: PaeLigD_Pol_like; cd04862"
FT                   /db_xref="CDD:80312"
FT                   /locus_tag="Bmul_5476"
FT   misc_feature    order(171460..171462,171598..171600,171652..171654,
FT                   171658..171660,171757..171759,171766..171771,
FT                   171775..171777,171922..171924,171931..171933,
FT                   171949..171951,171973..171981)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:80312"
FT                   /locus_tag="Bmul_5476"
FT   gene            complement(172174..173493)
FT                   /db_xref="GeneID:5770843"
FT                   /locus_tag="Bmul_5477"
FT   CDS_pept        complement(172174..173493)
FT                   /locus_tag="Bmul_5477"
FT                   /gene_family="HOG000220350" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   bch:Bcen2424_6484 sodium/hydrogen exchanger"
FT                   /db_xref="GI:161522510"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="GeneID:5770843"
FT                   /translation="MHETLWYLITGAVLMGMGIATSALRHLPCSTAMIYLVLGIALGPA
FT                   GAGLLHVDIEHDAALLRMIVEIGLLVSLFAIGLRLRVPLSDPLWLVPCRLGLLAMIVTV
FT                   PLLAACAVFALGIGWAPALLLAAILAPTDPVLAHDVQVHDPGDRDLVRFALSGEGGMND
FT                   GIALPFALAALALCGAPEATHGRAPLSLSFALATAWGIVGAAAIGGGLGWITTKTIGWL
FT                   RMRYAQALGFEGFFALALIVLSYGAAEVAHAFGFIATFAAGVAMRRVEHRASGDRDPRE
FT                   VIGQVDSADVVATEKDPDKAHAFMAESVLGFTIELERIAEAVVMTMVGSVLATLPGPLI
FT                   TWRALALAALLFVVVRPLAVRLTLAGSRATIAQRRLMAWFGIRGIGSFYYLLFALEHGP
FT                   TDTVRPLSAPVLAVVSASVVAHGISATPLMNWYHRRQRRH"
FT                   /protein_id="YP_001585439.1"
FT   misc_feature    complement(<172672..>172809)
FT                   /note="potassium/proton antiporter; Reviewed; Region:
FT                   PRK05326"
FT                   /db_xref="CDD:180017"
FT                   /locus_tag="Bmul_5477"
FT   gene            complement(173533..173889)
FT                   /db_xref="GeneID:5770249"
FT                   /locus_tag="Bmul_5478"
FT   CDS_pept        complement(173533..173889)
FT                   /locus_tag="Bmul_5478"
FT                   /gene_family="HOG000268377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5737 hypothetical protein"
FT                   /db_xref="GI:161522511"
FT                   /db_xref="GeneID:5770249"
FT                   /translation="MPSSSPPHARGKRLTRRAGRARSTDRGHAKRWSADVTRDSDALDL
FT                   EPDIFKSDDPGEIAASLKRSAERSRRRKATPFQSAMSMLNFYVNRAGRNLPKTRRTTLE
FT                   RAKRKLREAFGRKP"
FT                   /protein_id="YP_001585440.1"
FT   misc_feature    complement(173542..173799)
FT                   /note="Protein of unknown function (DUF3175); Region:
FT                   DUF3175; pfam11373"
FT                   /db_xref="CDD:151813"
FT                   /locus_tag="Bmul_5478"
FT   gene            174044..174427
FT                   /db_xref="GeneID:5770250"
FT                   /locus_tag="Bmul_5479"
FT   CDS_pept        174044..174427
FT                   /locus_tag="Bmul_5479"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6486 hypothetical protein"
FT                   /db_xref="GI:161522512"
FT                   /db_xref="GeneID:5770250"
FT                   /translation="MTSALSTTKSPACRVLGCAAAAMLAAAAAASPALAQNSQQSDHGS
FT                   GAPLSAGTSSSYTGNGDTAAPPPPNMQQSDGGRGAMSSHSGASGHAKPGAKGAGAGNGR
FT                   SPGATGSGGGGAGGQGSADSSGY"
FT                   /protein_id="YP_001585441.1"
FT   sig_peptide     174044..174151
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 36"
FT                   /locus_tag="Bmul_5479"
FT                   /product="hypothetical protein"
FT   gene            174430..174876
FT                   /db_xref="GeneID:5770251"
FT                   /locus_tag="Bmul_5480"
FT   CDS_pept        174430..174876
FT                   /locus_tag="Bmul_5480"
FT                   /gene_family="HOG000268388" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5606 hypothetical protein"
FT                   /db_xref="GI:161522513"
FT                   /db_xref="GeneID:5770251"
FT                   /translation="MSRRLAAGAARWPTPAAAAGAATTQEDIMQSNPRIGIEPYDIDDD
FT                   PDADDLNTTVHLDVATGRITFHAAWAIAPDAPPHAVRHSVVLALDCDTMERYADLDDGA
FT                   RMRVHAMLHDSVQAMLERLHDLDEDQTLTVELTDAMLDVATRLQ"
FT                   /protein_id="YP_001585442.1"
FT   sig_peptide     174430..174486
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.444 at
FT                   residue 19"
FT                   /locus_tag="Bmul_5480"
FT                   /product="hypothetical protein"
FT   misc_feature    174580..174861
FT                   /note="Protein of unknown function (DUF3022); Region:
FT                   DUF3022; pfam11226"
FT                   /db_xref="CDD:151668"
FT                   /locus_tag="Bmul_5480"
FT   gene            175197..175766
FT                   /db_xref="GeneID:5770824"
FT                   /locus_tag="Bmul_5481"
FT   CDS_pept        175197..175766
FT                   /locus_tag="Bmul_5481"
FT                   /gene_family="HOG000063195" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PfpI family intracellular peptidase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bam:Bamb_5605 intracellular
FT                   protease, PfpI family"
FT                   /db_xref="GI:161522514"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="GeneID:5770824"
FT                   /translation="MSGKLANCKVAILAVDGFEEAELVEPQRALSAEGAQVDVISQQPG
FT                   EIQGFRHVDKGARVKVDHTFDDAKQGDYDAIVLPGGVVNGDAMRMIPAAREFVTAAIGA
FT                   DKPVAVICHGGWLLVSAGLVDGRTMTSWPSLQDDIRNAGGKWVDERVVRDGNLITSRKP
FT                   DDLDAFNGALIECLAADRAHAPRERP"
FT                   /protein_id="YP_001585443.1"
FT   misc_feature    175221..175721
FT                   /note="A type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in PfpI from Pyrococcus furiosus; Region:
FT                   GATase1_PfpI_like; cd03134"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bmul_5481"
FT   misc_feature    175530..175535
FT                   /note="proposed catalytic triad; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bmul_5481"
FT   misc_feature    175530..175532
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Bmul_5481"
FT   gene            175763..176095
FT                   /db_xref="GeneID:5770825"
FT                   /locus_tag="Bmul_5482"
FT   CDS_pept        175763..176095
FT                   /locus_tag="Bmul_5482"
FT                   /gene_family="HOG000186128" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5604 hypothetical protein"
FT                   /db_xref="GI:161522515"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="GeneID:5770825"
FT                   /translation="MSTRATIPADPPPVFDGATLQLQFVVEIDGVQAECAITAEALEDH
FT                   FGARSALEADLREAFERGRQRIAEACADVVADGHGGAVLHSGYFRVQRRAAAALARQAT
FT                   SHAPRS"
FT                   /protein_id="YP_001585444.1"
FT   misc_feature    175793..176014
FT                   /note="Protein of unknown function (DUF1488); Region:
FT                   DUF1488; pfam07369"
FT                   /db_xref="CDD:148784"
FT                   /locus_tag="Bmul_5482"
FT   gene            176350..176574
FT                   /db_xref="GeneID:5770826"
FT                   /locus_tag="Bmul_5483"
FT   CDS_pept        176350..176574
FT                   /locus_tag="Bmul_5483"
FT                   /gene_family="HOG000264187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5741 hypothetical protein"
FT                   /db_xref="GI:161522516"
FT                   /db_xref="GeneID:5770826"
FT                   /translation="MLTAHEFAALFLVQRAPEQIQLDRDDIVALVERQLVVMQSDASGA
FT                   RRPELTPDGLSILRSVQRGSGGYTNDNSL"
FT                   /protein_id="YP_001585445.1"
FT   gene            complement(176629..177870)
FT                   /db_xref="GeneID:5770737"
FT                   /locus_tag="Bmul_5484"
FT   CDS_pept        complement(176629..177870)
FT                   /locus_tag="Bmul_5484"
FT                   /gene_family="HOG000268409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylserine decarboxylase-related"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: bch:Bcen2424_6491 phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="GI:161522517"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="GeneID:5770737"
FT                   /translation="MPNDNDTQAGRRRLGGWLAGEEKHMAAFRTRIAADARARAGERLR
FT                   TPAVQELARLFDDHAVLHMGLSRAIDEALATGHDLGYRSIGELMTVIDYLMTYTPPFSE
FT                   SSLIVCPLNAFLDWPMCMPSGRAVFRDATVNAHLKRVLNVWCDFLGGPHSRDHLVTTAP
FT                   DGWLCEEARKRIGMSQFQYREDQPHWGFDSWNDFFTRRFRAGARPVASPDDSHVIVSAC
FT                   EAAPYHTATNLRLRDRFWIKGQPYSLRDIFTPARLPLAEHFVGGDLYQAYLAAYNYHRW
FT                   HAPIRGTVTHAYRIDGTYYSIADVEGEDPSGLNDSQGYMTAVATRAIVAIASDDPGLGT
FT                   VAAVFVGMGDVSSCVIEVVPGQRVEKGDEIGYFQFGGSTYCLLFEPGVIDRFLHAPSDD
FT                   APPVQVNAAVALAR"
FT                   /protein_id="YP_001585446.1"
FT   misc_feature    complement(177340..177732)
FT                   /note="Phophatidylserine decarboxylase; Region: PSDC;
FT                   pfam12588"
FT                   /db_xref="CDD:153022"
FT                   /locus_tag="Bmul_5484"
FT   misc_feature    complement(176692..177291)
FT                   /note="Phosphatidylserine decarboxylase; Region:
FT                   PS_Dcarbxylase; cl03656"
FT                   /db_xref="CDD:186598"
FT                   /locus_tag="Bmul_5484"
FT   gene            complement(178324..181086)
FT                   /db_xref="GeneID:5770738"
FT                   /locus_tag="Bmul_5485"
FT   CDS_pept        complement(178324..181086)
FT                   /locus_tag="Bmul_5485"
FT                   /gene_family="HOG000248560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6493 malto-oligosyltrehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="GI:161522518"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="GeneID:5770738"
FT                   /translation="MTPRATLRLQLHAGFTFDDAAAHADYFARLGISHLYLSPITTAEP
FT                   GSRHGYDTVDYGAISAELGGEAGFVRLVEALRARGLRVIVDIVPNHMGVGGSSNGWWND
FT                   VLEWGPASPYARYFDIDWHPPDPTLDGKVLLPCLGSPYGDALAAGDIALGIDAAAGRFT
FT                   IACAGRQLPVAVATYAEILRVANRADLNALAERFDTAATRGSARVAAAHAALRAHAAAH
FT                   GPHAFDAVLHGTDARRARSRACLHHVLERQHYRLAWWRTAADELNWRRFFDIATLAGVR
FT                   VEDDAVFDAVHALPLRLHAAGLVDGVRVDHVDGLADPRAYCRRLHARLAAQRDTPPTIY
FT                   VEKILAPGETLRADWPIDGTTGYDFMNDVAALLHDPAGAEPLGAHWAAVSRSTRTFAQE
FT                   AVDGKRRVLLRQLAGEHARVARKLHDIARASPATRDISRIAIHRVLGELAVHLSVYRMY
FT                   PADDELAPDDRRVLAQAYACARAAVDPTDRIALERVAQWLGLPGTRAPRADAARRHAAR
FT                   VAFAQLTAPLAAKGVEDTANYRYGRLLSRNEVGADAGDFSLSRGAFHARNRRRARHSPH
FT                   ALVATATHDHKRGEDARVRLAVLSEIPDAWRAVSLDWSALNQPHRGRAHRDLDWSPGPA
FT                   AEAMLYQTLVGCWPPSLAPDDAAGLAALADRVVQWQTKALREAKQQTDWLAPEPDYEQD
FT                   SEAFVRAILTPHGAGDFVHRLHAFVMRIAPAGVVNSLTQTTLRITSPGVPDLYQGTERW
FT                   DHSLVDPDNRRDVPFAALAAERVDGPVSAYLPTWPDARVKRALIERLLALRAQRPSTFA
FT                   NGSYVPLRVRGPLARHVVAFARCDDAATIVVVTTRLACRLLGDAPALPRVEPAQWDDTA
FT                   VVLPPGATGPWADWLDASEAGDTPDGLLRVAHCLRALPVAVWVGPPPRA"
FT                   /protein_id="YP_001585447.1"
FT   misc_feature    complement(178345..181086)
FT                   /note="maltooligosyl trehalose synthase; Provisional;
FT                   Region: PRK14511"
FT                   /db_xref="CDD:184719"
FT                   /locus_tag="Bmul_5485"
FT   misc_feature    complement(<180772..180999)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5485"
FT   gene            complement(181083..183293)
FT                   /db_xref="GeneID:5770739"
FT                   /locus_tag="Bmul_5486"
FT   CDS_pept        complement(181083..183293)
FT                   /locus_tag="Bmul_5486"
FT                   /gene_family="HOG000245168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: bch:Bcen2424_6494 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="GI:161522519"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="GeneID:5770739"
FT                   /translation="MTTDIPIASLARAAGLQTDWTDAVGVPRRVADDALFALVDALGWP
FT                   CGTPVERVDSLAALVDADAAPPRMITADAGMPIALPATVAGPGARYRVTFETGGHVDGR
FT                   VGGTSGDPLLPPIVRPGYHALDVGEQRIAIAIAPRRVRAAERLRGTPDAGNRWGIAAQL
FT                   YGLRRAGDDGAGDYTALAQLATQAARHGAHAVAISPTHAGYPALPAHDSPYSPSSRRWH
FT                   NVAYLDCHAVPGVGRVAGDEADGAADARLVDWPRVLPQKLRRLRARFDALRAGGGTALD
FT                   GFERFRAAGGAALDAHARFDALQAFCVARGLGADWRQWPAPWRMPTSVEVDAFAQAHAD
FT                   TVAFHAFLQWCAAHALTDAQQAARRAGMAIGLIADLAVGSDRAGSDAWAHGTTLLRGLS
FT                   LGAPPDAFNAAGQAWGVTTWTPAALRANGFAPFIELLRAAFAHAGGIRIDHVLGFARMW
FT                   VVPDGASARDGAYLHYPCDDLLRLVALEAARHRAIAVGEDLGTVPDGFRDRLGAQGVAG
FT                   MRVLWFEREPDGAFRPPSSWDRDALAMTSTHDLPTVAGWWRGIDLGWRRIAAEHEQARA
FT                   RPANAEPEDRHVVSEASDTADTNDVNAADTAERTYVDPDAAAARAATPDDLAERDAARA
FT                   ALWRALQQAGCAPSDAPPPPADAPPVGAVLAFVARGASPLAIVPLEDLLALDAQPNLPG
FT                   PPCGHPNWRRRLPRTVDALFDADTRARIAAIADARGTPERRA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585448.1"
FT   misc_feature    complement(181584..182729)
FT                   /note="4-alpha-glucanotransferase; Region: Glyco_hydro_77;
FT                   cl00711"
FT                   /db_xref="CDD:186157"
FT                   /locus_tag="Bmul_5486"
FT   misc_feature    complement(181152..>181295)
FT                   /note="4-alpha-glucanotransferase; Region: Glyco_hydro_77;
FT                   cl00711"
FT                   /db_xref="CDD:186157"
FT                   /locus_tag="Bmul_5486"
FT   gene            complement(183290..185149)
FT                   /db_xref="GeneID:5770625"
FT                   /locus_tag="Bmul_5487"
FT   CDS_pept        complement(183290..185149)
FT                   /locus_tag="Bmul_5487"
FT                   /gene_family="HOG000155668" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5594 malto-oligosyltrehalose
FT                   trehalohydrolase; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="GI:161522520"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="GeneID:5770625"
FT                   /translation="MTSHSAASSSTHAFELSFGATCLDAGHTRFRLWAPASRRAQVELH
FT                   GAQTLEMTAAGDGWFELVAPVGAGALYRYRLDDELVVPDPASRFQPSDVHGPSQVVDPA
FT                   AYRWRHGAWRGRPWHETVLYELHVGACGGYVNVERRLPDIASVGVTAIELMPINAFPGT
FT                   RNWGYDGVLPFAPDASYGRPEELKSLIDAAHGLGLQVFLDVVYNHFGPDGNLLPRYAPA
FT                   FFRDDRHTAWGPAIDFSRAQTSAFFIENALYWIDEYRFDGLRIDAAHAIDDDAWLRELA
FT                   RRVRAAAGGRHVHLVLENERNTASLLGPDRFDAQWNDDFHNSAHVLLTGERDGYYRAYA
FT                   DAPLRHFARTLGEGFAYQGEPSPLHDGAPRGEPSAQLPPTAFVSFLQNHDQIGNRAFGE
FT                   RLRALANDDALRAVTALLLLSPQIPLLFMGEEDGSTQPFQFFTDYRGALADAVREGRRR
FT                   EFAAFPAFADPAHRDAIPDPNDPATFARSALHERPDTWPDADAWRRFYRSALTVRAALV
FT                   TPHLPGARALGVDVLADDETARALVARWRLGDGSTLTLALNLGPRATALPELPVGKIVF
FT                   ETPPRARDALVDARLPARACIAWRDGAVNHDALNHRANGHARP"
FT                   /protein_id="YP_001585449.1"
FT   misc_feature    complement(184841..185095)
FT                   /note="Maltooligosyl trehalose synthase (MTSase) N-terminus
FT                   domain. MTSase and maltooligosyl trehalose trehalohydrolase
FT                   (MTHase) work together to produce trehalose. MTSase is
FT                   responsible for converting the alpha-1,4-glucosidic linkage
FT                   to an alpha,alpha-1,1-...; Region: MTHase_N_term; cd02853"
FT                   /db_xref="CDD:30340"
FT                   /locus_tag="Bmul_5487"
FT   misc_feature    complement(183449..185068)
FT                   /note="malto-oligosyltrehalose trehalohydrolase; Region:
FT                   trehalose_TreZ; TIGR02402"
FT                   /db_xref="CDD:162842"
FT                   /locus_tag="Bmul_5487"
FT   misc_feature    complement(<184511..184756)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5487"
FT   misc_feature    complement(183341..183697)
FT                   /note="Domain of unknown function (DUF3459); Region:
FT                   DUF3459; pfam11941"
FT                   /db_xref="CDD:152376"
FT                   /locus_tag="Bmul_5487"
FT   gene            complement(185146..187272)
FT                   /db_xref="GeneID:5770626"
FT                   /locus_tag="Bmul_5488"
FT   CDS_pept        complement(185146..187272)
FT                   /locus_tag="Bmul_5488"
FT                   /gene_family="HOG000239197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5811 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="GI:161522521"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="GeneID:5770626"
FT                   /translation="MPTALPPRLEPGRSYPLGATWDGLGTNFAVFSAHAHRIQLCIFDS
FT                   TGRKELARLDLPECTDEVWHGYLPGAHPGTVYGFRADGPYQPQAGHRFNPTKLLIDPYA
FT                   RKLLGHFRWSDALFGYRVHSNRGDLSMDRRDSAPAMPKCIVVDEAFDWSNDRRPCVPWR
FT                   STVIYETHVRGASMRRPGLRAPERGTFAALAHPAFVDHLLALGVTTVELLPVHAFLQQR
FT                   ELLNRGLRNYWGYDTAAFFAPEPSYLSTRRLDEMRIAIRQLHAAGIEVVLDVVYNHTCE
FT                   GNQLGPTLSWRGLDNASYYRLVPDDRRYHVDETGCGNTLNLSHPRVLQMVMDSLRYWAT
FT                   AFNIDGFRFDLGVTLGREDHGFDPGAGFFDALRQDPVLAQRKLITEPWDVGPGGYQLGR
FT                   HPPGFAEWNDRFRDTVRRYWRGDAGQRPELAARLAGSADLFNHQRRRTWASINFVTAHD
FT                   GFTLADVVSYAGKHNEANGEGNRDGRDDNCSANWGVEGPTDDPAIRDVRGRVARSMLAT
FT                   LFTALGTPMLVAGDEFGRTQHGNNNAYCQDNELSWLDWEAAQQPEAVQMTRFVSRLAAL
FT                   RRMYPVMSTPRFPSGDRDGAPGMREIAWFDEHGDEVSVPAWQDRERRALTMRRVGTGRT
FT                   GRTEALLVMLNASAETITFKPPPPALAYRVLVDTATPDGGPRDWPADGLEVAAHAAVIA
FT                   VAPVPTDLSSKETP"
FT                   /protein_id="YP_001585450.1"
FT   misc_feature    complement(185257..187242)
FT                   /note="glycogen debranching enzyme GlgX; Region:
FT                   glgX_debranch; TIGR02100"
FT                   /db_xref="CDD:131155"
FT                   /locus_tag="Bmul_5488"
FT   misc_feature    complement(186913..187227)
FT                   /note="Glycogen_debranching_enzyme N-terminal domain.
FT                   Glycogen debranching enzymes have both
FT                   4-alpha-glucanotransferase and amylo-1,6-glucosidase
FT                   activities. As a transferase it transfers a segment of a
FT                   1,4-alpha-D-glucan to a new 4-position in an acceptor...;
FT                   Region: Glycogen_debranching_enzyme_N_term; cd02856"
FT                   /db_xref="CDD:30343"
FT                   /locus_tag="Bmul_5488"
FT   misc_feature    complement(<186223..186675)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5488"
FT   gene            complement(187305..189503)
FT                   /db_xref="GeneID:5770627"
FT                   /locus_tag="Bmul_5489"
FT   CDS_pept        complement(187305..189503)
FT                   /locus_tag="Bmul_5489"
FT                   /gene_family="HOG000283037" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen branching enzyme"
FT                   /transl_table="11"
FT                   /note="catalyzes the transfer of a segment of a
FT                   1,4-alpha-D-glucan chain to a primary hydroxy group in a
FT                   similar glucan chain"
FT                   /db_xref="GI:161522522"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:5770627"
FT                   /translation="MTDALFDRADIDALLGARHPDPFACLGPHAHDGRTIVRALLPGAE
FT                   HVRVLAPDGAELGTLARVDDAGCFAGALAHDGRYRLAVEWPGARHVIDDPYAFGLLLDD
FT                   AALARFAAGNPFAVLDCLGAVPTCIDSVDGVRFAVWAPNAQRVSVVGDFNAWDGRRHPM
FT                   RLRLPWGVWELFVPGIGAGERYKYELRAADGRVLPHKADPCARATEAPPRTASIVADTG
FT                   AVDGFAWHDHAWLQARAHGDRYRRPWSIYEVHPESWQRYPEQMDRNATWDELAERLIPY
FT                   VRGMGFTHVEFMPIAEYPFGGSWGYQPLAQFAPSARFGPPDGFARFVDRAHAAGIGVLV
FT                   DWVPAHFPDDPHGLAQFDGSALYEHADPREGMHPDWHTCVFNVGRNEVGAFLIASALAW
FT                   ARRYHVDGIRVDAVASMLYRDYSRAAGEWVPNIYGGRENLESVAFLRALNDTLHGDDAP
FT                   PGVVSVAEESTAWPGVTAPTRDGGLGFDFKWNMGWMHDTLAYLHEDPVHRRYHHDRMTF
FT                   GLVYAFSERFVLPLSHDEVVHGKGSLASKMPGDAWQRLATLRAYFGFMWAHPGKKLLFM
FT                   GSELAQWAEFAHDGTPHWDLLDAPAHRGVQRLVRDLNRTYAAQPALHALDCDAAGFAWL
FT                   IGDDRDNSVFAFARRDDAGHTVVAVCNFTPVPRTGYRVGLPAPGAWRELMNTDAAVYGG
FT                   TNAGNDGAVWAEDVPAHGEAWSATLRLPPLATLWLSPA"
FT                   /protein_id="YP_001585451.1"
FT   misc_feature    complement(187308..189485)
FT                   /note="glycogen branching enzyme; Provisional; Region:
FT                   PRK05402"
FT                   /db_xref="CDD:180057"
FT                   /locus_tag="Bmul_5489"
FT   misc_feature    complement(188847..189164)
FT                   /note="Glycogen branching enzyme N-terminus domain.
FT                   Glycogen branching enzyme (AKA 1,4 alpha glucan branching
FT                   enzyme) catalyzes the formation of alpha-1,6 branch points
FT                   in either glycogen or starch by cleavage of the alpha-1,4
FT                   glucosidic linkage yielding a...; Region:
FT                   Glycogen_branching_enzyme_N_term; cd02855"
FT                   /db_xref="CDD:30342"
FT                   /locus_tag="Bmul_5489"
FT   misc_feature    complement(<188466..188696)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5489"
FT   misc_feature    complement(187311..187592)
FT                   /note="Alpha amylase, C-terminal all-beta domain; Region:
FT                   Alpha-amylase_C; cl02706"
FT                   /db_xref="CDD:155067"
FT                   /locus_tag="Bmul_5489"
FT   gene            complement(189500..192910)
FT                   /db_xref="GeneID:5770343"
FT                   /locus_tag="Bmul_5490"
FT   CDS_pept        complement(189500..192910)
FT                   /locus_tag="Bmul_5490"
FT                   /gene_family="HOG000268420" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trehalose synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6498 trehalose synthase; TIGRFAM:
FT                   trehalose synthase; trehalose synthase-fused possible
FT                   maltokinase; PFAM: alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="GI:161522523"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="GeneID:5770343"
FT                   /translation="MKREDSLDDVRRAQFASHPHAGSPRQRRVRRPAPALCADDPLWYK
FT                   DAIIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIAELGVDAIWLLPFYPSPRRDDGYDIS
FT                   DYRDVHPDYGTLADVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMYRN
FT                   YYVWSDTDTKYAGTRIIFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVL
FT                   QVMRFWLDLGIDGLRLDAVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAE
FT                   ANQWPEDVQEYFGNEDECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWA
FT                   VFLRNHDELTLEMVTDSERDLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSL
FT                   LLSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMG
FT                   SLYGYDAINVEAQTRDPHSLLNWTRRILATRRATQVFGRGSIRFLRPENRKVLAYLREL
FT                   EGHDPVLCVANLSRASQAVELDLSEFAGRVPIEMTSDSPFPPVGQLPYLLTFPPYGFLW
FT                   FVLSAHGREPAWRQPHAEPLPEYVTLVMRRGDTRPDVAQLHTLAHDALASWLTRRRWFA
FT                   SKDRTIADARLNVVTPIPGESFQYAEACVTVRGDSHAERYVVPLAVAWGGETSGPLFAQ
FT                   LALARVRRGHTVGYLTDAFALPAFAHGMLRKLRAGATVPTSDGGHLAFLPEAALASLDP
FT                   GDEAEVRWLAAEQSNSSLVIGEAIVLKLVRKVAHGVHPEAEMSRHLTRIGYQNTAALAG
FT                   EVVHVDPDGRPHTVAILQRFVDNQGDAWTRSFDFLKRAVDELALPAADDVDTVEPDAET
FT                   DALLGYAAFAGVVGKRLGELHVALAQPSDDPAFAPERATPEHVDGWCADAIASFEQALD
FT                   CLGTRLDALDADTRAAAERLLASRDAAVRALGELVPRTLDAHCTRIHGDFHLGQVLDVQ
FT                   GDALLIDFEGEPARALERRRAKSHPLRDVAGFLRSLSYVSATGQFAIEKAPPQAADRKR
FT                   ALFERFGRAAADAFVDCYRAAAEHAPVRFVDPRYTDRLLALFLIDKASYELCYEAANRP
FT                   DWLCVPVGGLAALVERLLEHRGAEDGDES"
FT                   /protein_id="YP_001585452.1"
FT   misc_feature    complement(191174..192787)
FT                   /note="trehalose synthase; Region: treS_nterm; TIGR02456"
FT                   /db_xref="CDD:162863"
FT                   /locus_tag="Bmul_5490"
FT   misc_feature    complement(191660..192715)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5490"
FT   misc_feature    complement(189548..191128)
FT                   /note="Uncharacterized protein, probably involved in
FT                   trehalose biosynthesis [Carbohydrate transport and
FT                   metabolism]; Region: Ble; cl01286"
FT                   /db_xref="CDD:163965"
FT                   /locus_tag="Bmul_5490"
FT   gene            complement(192907..196302)
FT                   /db_xref="GeneID:5770344"
FT                   /locus_tag="Bmul_5491"
FT   CDS_pept        complement(192907..196302)
FT                   /locus_tag="Bmul_5491"
FT                   /gene_family="HOG000239230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha amylase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: bch:Bcen2424_6499 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="GI:161522524"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:5770344"
FT                   /translation="MEPVPTFAPHLYFCDARLVGPLDAWSATFAHVAAMGFDHVLVGAF
FT                   WASSPAGFPRHVADFDRPADVFGTRDSALDIFARLAQLAHGHGLRVLLEVVPERVARDN
FT                   PLRAAHPHWYVERAHDDALIDPRSAAHAQDIAHANLTDDEARDALSAWWRAHLTAYAQA
FT                   GAAGFLVDAPQHLPAAWWAQWRAALQRVRPSLALIAGVPGHARDALAPLESAGFDAVFS
FT                   SARWWDLRAPWFVDEHRFLRRIGAPIAFPDAFDGPRLADDWRDAPDERVARAYRRALWT
FT                   AAAVGTGWLVPMGFERGVALPLMARDASAARYRAAFEAARFDLSSTLADANAWRRATPV
FT                   AAARGELLQLSAPDAPATVLLRGTSASLEYDDDALLIALNPDLDAEARVDPATILPGVP
FT                   GGFTHVATPNDAPSHAPAALDAFTLAPGACALRDARRAPPATLPADPERDQDALSAALV
FT                   ADRIAIERVEPAVDGGRFAVKRVVGDTLVVRASIFSDGHAHLAAVLAWRAAGESDWREV
FT                   PFVAEPNDRWRAQVTLDRLGRHEFRVIAWRDDWASLVDDVAKKRAAGQDVSLELREAQL
FT                   LLATAAKLADPVDPQARARIEQLTKEFRRASPEDRLALLGAPALADAVAALRYRPFVTH
FT                   DDTVYPVDVDRRAACFSSWYEMFPRSASNDPDRHGTFDDVIAHLPRIRDMGFDVLYFPP
FT                   IHPIGTTARKGRNNSLQAAPDDVGSPYAIGSPDGGHTAVHPQLGTLDSFRRLIDAARDH
FT                   GLEIALDFAIQCSPDHPWLKAHPGWFAWRPDGSLRYAENPPKRYQDIVNPDFYAPDALP
FT                   GLWLALRDVVQFWIDAGVRIFRVDNPHTKPLPFWAWMIADIRGRHPDVVFLSEAFTRPG
FT                   MMGRLAKLGFSQSYTYFTWRESKREFIEYLTELTQGPAREYFRPNFFVNTPDINPRHLQ
FT                   NAPRTQFVIRAALAATLSGAWGMYSGFELGESAPLPNSEEYADAEKYELRARDWSKAAH
FT                   IGAEIARLNRARRDNRALQTHLGITFVDADNDAVLVFMKATPAFDSVVVVAISLDPWHP
FT                   QAANFTLDGALWRGLGLVEGEPLDAHEHDAAHPTTWRGHRQYVSLDPHVRPYTIWRLAP
FT                   AAGAARAHRPATDDDRRSSGGHGR"
FT                   /protein_id="YP_001585453.1"
FT   misc_feature    complement(194362..194922)
FT                   /note="Domain of unknown function (DUF3416); Region:
FT                   DUF3416; pfam11896"
FT                   /db_xref="CDD:152332"
FT                   /locus_tag="Bmul_5491"
FT   misc_feature    complement(<193702..194295)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Bmul_5491"
FT   gene            complement(196481..196969)
FT                   /db_xref="GeneID:5770345"
FT                   /locus_tag="Bmul_5492"
FT   CDS_pept        complement(196481..196969)
FT                   /locus_tag="Bmul_5492"
FT                   /gene_family="HOG000268421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5589 hypothetical protein"
FT                   /db_xref="GI:161522525"
FT                   /db_xref="GeneID:5770345"
FT                   /translation="MQIDELDGTALDYWCVRGLCADHEDTLRFTAVTPTVVVTAACDAL
FT                   RRLDAHFTPSRSWADAGAVLDRVTDLRIVRRGGEVECDASFADGPSTCAARGPNARVAL
FT                   LRAYVRACFGDTVDAPPDLPHRIERGAIVRYDPGAPLPEADDASALGDSTDIRSVPRM"
FT                   /protein_id="YP_001585454.1"
FT   gene            complement(196984..197820)
FT                   /db_xref="GeneID:5770915"
FT                   /locus_tag="Bmul_5493"
FT   CDS_pept        complement(196984..197820)
FT                   /locus_tag="Bmul_5493"
FT                   /gene_family="HOG000261041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bch:Bcen2424_6501 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="GI:161522526"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="GeneID:5770915"
FT                   /translation="MALIRHAAAPPEVVTAPAPPAAAPGGRDLRIATYNIHGGHGPWHA
FT                   RAVDRIAAVIDELDADVIALQEVPLGGTRAPDVLAPLRDATGMHVAAGPTIDTAERRYG
FT                   NAVLSRYPIRAARTLDLSFHQREPRGALDADIDCRTGPLRVVATHLGLSARERSAQVQR
FT                   LLAAFDTGAMPVILLGDINEWFVRGRALQALVTRFRRAPAPRTFPTVCPLFSLDRIWVH
FT                   PGELLVDVVVHRSARARHASDHYPLVARMRAPQPAPEPAAAPFDRPGTPLARKDAP"
FT                   /protein_id="YP_001585455.1"
FT   misc_feature    complement(197080..197736)
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:186031"
FT                   /locus_tag="Bmul_5493"
FT   gene            complement(197811..200051)
FT                   /db_xref="GeneID:5770916"
FT                   /locus_tag="Bmul_5494"
FT   CDS_pept        complement(197811..200051)
FT                   /locus_tag="Bmul_5494"
FT                   /gene_family="HOG000268442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNARE associated Golgi protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SNARE
FT                   associated Golgi protein; KEGG: bch:Bcen2424_6502
FT                   phospholipase D/transphosphatidylase"
FT                   /db_xref="GI:161522527"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="GeneID:5770916"
FT                   /translation="MIVPARGSRTGFATAGPARADDAQNGAAQRDAIVRHGLLEVGRNC
FT                   DTIRHADRFATLIDGDAYFSTLRAALLRARHTVFILGWDVDSRMRLMPGGADDGFPDTL
FT                   AAFLHALASRRHNLRIYVLAWDFAMIYALERDWPPVYRASWRAHRGIVFRLDDAHPRGA
FT                   SHHQKLVVIDDRLAFVGGLDLTRARWDTPAHAADDPRRRDEQGMPYGPFHDVHTMFDGD
FT                   AAAAIGEQARARWLLACGRPIAIRAHKHLERDDDPDPWPPGAQVDVRDVQLGIAYTAPR
FT                   HRDAAPVSQVRELVADTIRTARRHLYLENQYFTAAVVRETLSARLADDDGPDVTVVAPR
FT                   VQSGWLQEATMGVLRARLHATLVAADRFGRYRLLYPHVDGLGDGCVNVHSKVAIVDDEC
FT                   LMIGSANLNNRSMLLDTECCVALVAAGDARVRAAIAGTRDRLLAEHLGTTPAAVADAFA
FT                   DALARGQRPNDALDRLRKDRGRSLRTLDPSVAPQLDALVPVSAWLDPEQPIEPDRLIRE
FT                   FVPREQHRTLSARFLVLGAIVLLIAALALTWRFSPLGERLNVASLAHAAAGMSRLPAAP
FT                   VLLLLGYVIAATLAVPITLLIAATGLVFGAWPGFAYAGAGTLMAAVATYGLGRWLGRDA
FT                   VRRLAGARANRLSEHLGKRGVVAMTVLRLLPIAPFTVVNLVAGASHIGLRDFVIGTAIG
FT                   MLPGIVLTVIFANQLLAAFSHPGPTAFAWLAAIGIALVGVSALLVRMLRRWR"
FT                   /protein_id="YP_001585456.1"
FT   sig_peptide     complement(199989..200051)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.701 at
FT                   residue 21"
FT                   /locus_tag="Bmul_5494"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<199479..199892)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(<199104..>199562)
FT                   /note="Phospholipase D delta; Region: PLN03008"
FT                   /db_xref="CDD:178585"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(order(199503..199505,199509..199514,
FT                   199533..199535,199548..199550,199554..199556))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(order(199503..199505,199509..199511,
FT                   199548..199550,199554..199556))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(198795..199244)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(order(198801..198803,198834..198836,
FT                   198840..198842,198879..198881,198885..198887))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(order(198834..198836,198840..198845,
FT                   198864..198866,198879..198881,198885..198887))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bmul_5494"
FT   misc_feature    complement(197823..198344)
FT                   /note="SNARE associated Golgi protein; Region: SNARE_assoc;
FT                   cl00429"
FT                   /db_xref="CDD:185992"
FT                   /locus_tag="Bmul_5494"
FT   gene            complement(200048..200386)
FT                   /db_xref="GeneID:5770917"
FT                   /locus_tag="Bmul_5495"
FT   CDS_pept        complement(200048..200386)
FT                   /locus_tag="Bmul_5495"
FT                   /gene_family="HOG000268443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5586 hypothetical protein"
FT                   /db_xref="GI:161522528"
FT                   /db_xref="GeneID:5770917"
FT                   /translation="MTQTDLLSYLVTSQLAARMRSGAWLTISQVVGALRAWLAYHHAEC
FT                   DWLDRIRIVEAASAIAEGIYEVATAHGQPADGERVRLDAHSPEMQALRARCDVLLQRID
FT                   GDRDVDAR"
FT                   /protein_id="YP_001585457.1"
FT   gene            complement(200383..201078)
FT                   /db_xref="GeneID:5770764"
FT                   /locus_tag="Bmul_5496"
FT   CDS_pept        complement(200383..201078)
FT                   /locus_tag="Bmul_5496"
FT                   /gene_family="HOG000080250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MgtC/SapB transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bam:Bamb_5585
FT                   MgtC/SapB transporter"
FT                   /db_xref="GI:161522529"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="GeneID:5770764"
FT                   /translation="MIGHVELLGRLLLAALLGSVIGLERERLNWAAGLRTHMLVCVGSA
FT                   LTMLVSTYGFEDVAGRNGVVLDPSRVAAQVVSGIGFLGAGSILLRGEVVRGLTTAASLW
FT                   AVAGVGLAVGGGMIVASVGATVIVLVILAGVKPLERRFIAQRQQRTLRLVVERGGLTLR
FT                   TLHDALGTRHVRVKRFIVQQSDDDPDTDDISVSFSRTSPVEFAAICRTLQNLAGVRICR
FT                   PDTSSRSLV"
FT                   /protein_id="YP_001585458.1"
FT   misc_feature    complement(200656..201024)
FT                   /note="MgtC family; Region: MgtC; cl12207"
FT                   /db_xref="CDD:187193"
FT                   /locus_tag="Bmul_5496"
FT   gene            201260..201502
FT                   /db_xref="GeneID:5770765"
FT                   /locus_tag="Bmul_5497"
FT   CDS_pept        201260..201502
FT                   /locus_tag="Bmul_5497"
FT                   /gene_family="HOG000268222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5584 hypothetical protein"
FT                   /db_xref="GI:161522530"
FT                   /db_xref="GeneID:5770765"
FT                   /translation="MQHQQDAQVRDPYRGHEIRVWARRNERGAWRDEVQLYVDGARIEL
FT                   IVPEPAGPEWLTEDEALRAGVERGRYLVDKRVDDD"
FT                   /protein_id="YP_001585459.1"
FT   gene            201568..202278
FT                   /db_xref="GeneID:5770766"
FT                   /locus_tag="Bmul_5498"
FT   CDS_pept        201568..202278
FT                   /locus_tag="Bmul_5498"
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="part of four member succinate dehydrogenase enzyme
FT                   complex that forms a trimeric complex (trimer of
FT                   tetramers); SdhA/B are the catalytic subcomplex and can
FT                   exhibit succinate dehydrogenase activity in the absence of
FT                   SdhC/D which are the membrane components and form
FT                   cytochrome b556; SdhC binds ubiquinone; oxidizes succinate
FT                   to fumarate while reducing ubiquinone to ubiquinol; the
FT                   catalytic subunits are similar to fumarate reductase"
FT                   /db_xref="GI:161522531"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="GeneID:5770766"
FT                   /translation="MDDDTRILHIYRYDPDRDAAPYMQRYEITVQPDDRMLLDVLGRLK
FT                   REDETLSYRRSCREGICGSDAMNINGSNGLACLTNMKTLPREITLRPLPGLPVVRDLIV
FT                   DMTDFFNQYHSIKPYLINDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPTFWWN
FT                   PDKFVGPAGLLQAYRFIADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPAR
FT                   AISNIRAMLVRRAV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585460.1"
FT   misc_feature    201571..202275
FT                   /note="succinate dehydrogenase iron-sulfur subunit;
FT                   Provisional; Region: PRK12575"
FT                   /db_xref="CDD:171592"
FT                   /locus_tag="Bmul_5498"
FT   gene            complement(202697..204310)
FT                   /db_xref="GeneID:5770313"
FT                   /locus_tag="Bmul_5499"
FT   CDS_pept        complement(202697..204310)
FT                   /locus_tag="Bmul_5499"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bch:Bcen2424_6536
FT                   cytochrome c, class I"
FT                   /db_xref="GI:161522532"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR003219"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:5770313"
FT                   /translation="MALISSARFPFRLRRRGVCRSAAVALALGVALAGCDPLDDGSAPR
FT                   DTADAASAASAPEPASGWRFTRIRAPADAAMSARAERDARLSARHGSAAAGGAASDAQA
FT                   SASAASGAGAAVPDASAHDDTRRPLVAAAAADADAALIERGRYLAHAGDCSACHDAADH
FT                   TPYAGGQPVNSPFGPIYAPNITPDPVHGIGRYTLRQFDDALRRGVRADGSNLYPAMPYA
FT                   SFARLHPDDVRALYAYFMHGVAPSPQAGKRTALPFPFNQRWALGLWRMVFANDERFVPS
FT                   PSRSASWNRGAYLVQGLGHCGACHTPRGPAYNERGYDERSAKFLTGGVTDHWFAPNLTG
FT                   ADRDGLGRWSVDDIAAFLRDGHTRHGAVFGAMAPVVGESTALLSDADRHAIAIYLKSLP
FT                   AQPTAATNPLGVGMPRLTVAGPRPEGGQQAPGAGVYASFCARCHGADGAGVPDHGPPLA
FT                   GNPVVVAADPTSAIRIVVEGARPAPGEDRSGVRRMPAMRGALTSSEIAAVVSYVRGAWG
FT                   NRAAPVSTQDVRRLRAAIHR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585461.1"
FT   sig_peptide     complement(204209..204310)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.680 at
FT                   residue 34"
FT                   /locus_tag="Bmul_5499"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(203117..203575)
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="Bmul_5499"
FT   misc_feature    complement(202772..203026)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="Bmul_5499"
FT   gene            complement(204301..204702)
FT                   /db_xref="GeneID:5770314"
FT                   /locus_tag="Bmul_5500"
FT   CDS_pept        complement(204301..204702)
FT                   /locus_tag="Bmul_5500"
FT                   /gene_family="HOG000268554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6537 hypothetical protein"
FT                   /db_xref="GI:161522533"
FT                   /db_xref="GeneID:5770314"
FT                   /translation="MTRARRSLMPLFAIAAGLVGAPALWFAQMAASETLASTACYPLGV
FT                   AQLAPRWAHVGVWLALIAGGAFALAAACAAWIARVWRRPDDPDIRAATRDDSTRFLVRC
FT                   AMLAALGFVVGLVFTGIVTGFVGPCSPWR"
FT                   /protein_id="YP_001585462.1"
FT   sig_peptide     complement(204610..204702)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.598 at
FT                   residue 31"
FT                   /locus_tag="Bmul_5500"
FT                   /product="hypothetical protein"
FT   gene            complement(204699..207329)
FT                   /db_xref="GeneID:5770315"
FT                   /locus_tag="Bmul_5501"
FT   CDS_pept        complement(204699..207329)
FT                   /locus_tag="Bmul_5501"
FT                   /gene_family="HOG000085274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit III; cytochrome c oxidase
FT                   subunit I; KEGG: bam:Bamb_6573 cytochrome c oxidase,
FT                   subunit I"
FT                   /db_xref="GI:161522534"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="GeneID:5770315"
FT                   /translation="MAVTHDSRPVLERVPDLGDAPPGSPEERALAALWESEPGWRGWLG
FT                   TVDHKRIGLRYIVTAFAFLLLGGVEALVMRIQLARPNATLLTPAQYDALFTMHGVTMIF
FT                   LYALPVLSGFANYLWPLMLGSRDMAFPRLNAFSYWVFLFAGLFLYASFPLGAVPDGGWF
FT                   NYVPLTSLDYSAGANIDIYALGMILLGISTTGGAANFVVTLLRMRAHGMSIDRLPIIVW
FT                   GTLTASVANLVAVPSVSLAFFLLWLDRNAGTHFFDVAHDGRPLLWQHLFWMFAHPWVYV
FT                   VVLPAMGIVSDALPTFCRRPLVAYEAVAVSTVATMLIGFEVWVHHMFATGIAPLALAFF
FT                   GAASMLISIPSAVAVFAWIATIWTGRPVFRTPFLYFAGFVLMFVIGGVSGVMTAAVPLD
FT                   WQLTDTYFVVAHLHYVLLGINVFPVLGGITYWFPKFTGRMMNERVGRWTFWVVLIGFNV
FT                   GFFPMHVSGLLGMPRRIYTYPSGMGWDTSNLLTTIGSFVFGIGIVMFVINALVSARRGA
FT                   RAGDNPWGAPGLEWSVASPTPAYNFAVLPLIASRHPLWETRGEPHRSSLRVGYRLADGR
FT                   EALAVSPLAATPSAILKMPEDTCVPFVLSLLATAVFAAMLVRSPTLVAISTLGCAIALG
FT                   AWLWPRRSLGERAAAPERDGVPPPAPFTMHEPAAAAAPPAAPAPYNAPLPVGSCGKRAG
FT                   GWWGVLTLVVTEAGLFGYLLFSYFYLQSQSAAPWPPEGMPKLGLAGVNTAVLLSSSVFV
FT                   WLAERAVRAGRRPRAVAALAVALVLGVAFALVQLHEWRDHPYGPTAHLYGSLYFTITGF
FT                   HLAHVVAGLAVLALLAGWTAAGFFDRERRVALSVGALYWHFVDFVWLFIFTALYVTPYW
FT                   LRRPG"
FT                   /protein_id="YP_001585463.1"
FT   misc_feature    complement(205632..207224)
FT                   /note="Heme/copper-type cytochrome/quinol oxidases, subunit
FT                   1 [Energy production and conversion]; Region: CyoB;
FT                   COG0843"
FT                   /db_xref="CDD:31185"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(205704..207203)
FT                   /note="Ubiquinol oxidase subunit I.  Ubiquinol oxidase, the
FT                   terminal oxidase in the respiratory chains of aerobic
FT                   bacteria, is a multi-chain transmembrane protein located in
FT                   the cell membrane.  It catalyzes the reduction of O2 and
FT                   simultaneously pumps protons...; Region:
FT                   Ubiquinol_Oxidase_I; cd01662"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(206721..206723,206733..206735,
FT                   206751..206756,206919..206921,206928..206930,
FT                   206949..206951,206979..206981,207162..207164))
FT                   /note="D-pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(207045..207053,207060..207062,
FT                   207108..207113,207120..207122,207132..207134))
FT                   /note="Putative ubiquinol binding site; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(205836..205838,205953..205955,
FT                   206079..206081,206091..206093,207036..207038))
FT                   /note="Low-spin heme (heme b) binding site; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(205911..205913,206118..206123,
FT                   206133..206135,206523..206528,206541..206543))
FT                   /note="Putative water exit pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(206097..206099,206352..206357,
FT                   206502..206504))
FT                   /note="Binuclear center (heme o3/CuB); other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(206268..206270,206277..206279,
FT                   206352..206357,206457..206459,206490..206492,
FT                   206502..206504))
FT                   /note="K-pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(205908..205913,206118..206123,
FT                   206352..206354))
FT                   /note="Putative proton exit pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(204729..205268)
FT                   /note="Heme-copper oxidase subunit III.  Heme-copper
FT                   oxidases are transmembrane protein complexes in the
FT                   respiratory chains of prokaryotes and mitochondria which
FT                   couple the reduction of molecular oxygen to water to,
FT                   proton pumping across the membrane. The...; Region:
FT                   Heme_Cu_Oxidase_III_like; cd00386"
FT                   /db_xref="CDD:29484"
FT                   /locus_tag="Bmul_5501"
FT   misc_feature    complement(order(204906..204908,204918..204920,
FT                   204927..204932,205191..205196,205206..205208,
FT                   205248..205253))
FT                   /note="Subunit I/III interface; other site"
FT                   /db_xref="CDD:29484"
FT                   /locus_tag="Bmul_5501"
FT   gene            complement(207343..208455)
FT                   /db_xref="GeneID:5770394"
FT                   /locus_tag="Bmul_5502"
FT   CDS_pept        complement(207343..208455)
FT                   /locus_tag="Bmul_5502"
FT                   /gene_family="HOG000268576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   KEGG: bam:Bamb_6572 cytochrome c, monohaem"
FT                   /db_xref="GI:161522535"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="GeneID:5770394"
FT                   /translation="MRRASHSPRARTEIAARPVAVVIRRIRQGVALPVPLFPNARRVAC
FT                   AAACIVASAASSRAQAAAEPLPLAYVAHAAGPAARPVFVLGWALLALCTFVCIAIATLL
FT                   ALALFRRRKREARGGDGVRFVAIGSAVSAVLLFGALVYMLRVLGAVAYPPRPPALTITV
FT                   IAHDWWWAVRYPGEPALVTANEIHIPVGEPIAIELKSADVIHAFWVPQLAGKTETIPGQ
FT                   TNRQWLQADEPGVYRGQCSQYCGAQHAHMAFDVVAQPPDAFRAWLDAQRQPAAAPRAGA
FT                   AAHGARVFAARCAGCHTVRGTDAAGDAGPDLTHLASRRSLAAGTLDNTPDNLRRWIAHA
FT                   QQIKPQTLMPSFALAPRDADDLAAYLATLH"
FT                   /protein_id="YP_001585464.1"
FT   sig_peptide     complement(208270..208455)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.935 at
FT                   residue 62"
FT                   /locus_tag="Bmul_5502"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(207655..208236)
FT                   /note="cytochrome c oxidase, subunit II; Region: CoxB;
FT                   TIGR02866"
FT                   /db_xref="CDD:163049"
FT                   /locus_tag="Bmul_5502"
FT   misc_feature    complement(207703..207981)
FT                   /note="Cytochrome C oxidase subunit II, periplasmic domain;
FT                   Region: COX2; cl10078"
FT                   /db_xref="CDD:186899"
FT                   /locus_tag="Bmul_5502"
FT   misc_feature    complement(<207400..>207570)
FT                   /note="Cytochrome c1 [Energy production and conversion];
FT                   Region: CYT1; COG2857"
FT                   /db_xref="CDD:32685"
FT                   /locus_tag="Bmul_5502"
FT   gene            208644..209627
FT                   /db_xref="GeneID:5770395"
FT                   /locus_tag="Bmul_5503"
FT   CDS_pept        208644..209627
FT                   /locus_tag="Bmul_5503"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_6571 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522536"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770395"
FT                   /translation="MKTVAITGASAGVGRATAHAFARRGANVALLARDPRALEDAAAEV
FT                   RAYGVQALPIAVDVSDAAALDAAAERIERELGPLDVWVNNAMVTVFAPFDAIAPEDFAR
FT                   VTDVTYLGCVNGTRAALARMRTRDRGTIVQVGSALAYRSIPLQAPYCGAKHAIRGFTDA
FT                   LRCELLHDGSRIRVTMVQLPAIDTPQFDWAESELPNKPRPVAPVYAPEVAADAIVRAAH
FT                   RPCRERWVGWSSLAAILANGVAPGCFDRYLAYTAVRGQQRAEPAGVRASNLWETVPEGH
FT                   ATRGAFTDEAHRTGADGALGSARALAFGAAFVLVAAGVAAARKLNR"
FT                   /protein_id="YP_001585465.1"
FT   misc_feature    208644..209534
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5503"
FT   misc_feature    208644..209429
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="Bmul_5503"
FT   sig_peptide     208644..208706
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.586 at
FT                   residue 21"
FT                   /locus_tag="Bmul_5503"
FT                   /product="hypothetical protein"
FT   gene            209624..211414
FT                   /db_xref="GeneID:5770396"
FT                   /locus_tag="Bmul_5504"
FT   CDS_pept        209624..211414
FT                   /locus_tag="Bmul_5504"
FT                   /gene_family="HOG000243980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase 15-related"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   bvi:Bcep1808_5835 glycoside hydrolase 15-related"
FT                   /db_xref="GI:161522537"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="GeneID:5770396"
FT                   /translation="MSATPIEDYAPIGDGRSAALVARDGSIDWLCWPDFDSPPCFAALI
FT                   GTPENGRFRLAPRDPDARATRRYLPGTAILETTFDTSSGRIVVIDWMSWAADDPCLIRS
FT                   VRGEHGRVALDVELGVRFDYGYALPWCRRFGRRWRMMTGGDAMWVDADARLEVQDDRLV
FT                   GTPTIAAGERIDICISYARSYDRAPVVPDAYASLRDTHAFWRAWSRCNAAQGSYGDAIE
FT                   RALITIKLLTSRRTGGIVAAPTSSLPERFGGARNWDYRFCWLRDASFTLRALARCGYRD
FT                   EAAGWRDWLVRAIADHPSQLQVLYAADGSRRADEWHAEHLAGYGGARPVRFGNAAAQQQ
FT                   QLDVYGEVLGALYQARRHGLPPDDDAWLLERRLIDHLATIWREPDEGIWEVRSGRHQFT
FT                   SSKAMVWAAVESAYRSARAFGHHAPLDEWRRWADTVRDEVLARGYHAKLGRFVDRFDGD
FT                   GLDVSLLLIPLSGMLDARDPRVAATVAAIERELLEDGLPFRYRPERFADGCEGDEGAFV
FT                   AAGFWLVQVYRLQRRDDDAHALFERLLALRNDVGLLSEEYDVHTRRMCGNFPFTLAHVA
FT                   LVNAALALQCDVQQDDVGVA"
FT                   /protein_id="YP_001585466.1"
FT   misc_feature    209633..211330
FT                   /note="Glucoamylase and related glycosyl hydrolases
FT                   [Carbohydrate transport and metabolism]; Region: SGA1;
FT                   COG3387"
FT                   /db_xref="CDD:33194"
FT                   /locus_tag="Bmul_5504"
FT   misc_feature    210266..211336
FT                   /note="Glycosyl hydrolases family 15; Region:
FT                   Glyco_hydro_15; pfam00723"
FT                   /db_xref="CDD:144356"
FT                   /locus_tag="Bmul_5504"
FT   gene            complement(211460..213280)
FT                   /db_xref="GeneID:5770640"
FT                   /locus_tag="Bmul_5505"
FT   CDS_pept        complement(211460..213280)
FT                   /locus_tag="Bmul_5505"
FT                   /gene_family="HOG000258444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of acetate from pyruvate"
FT                   /db_xref="GI:161522538"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="GeneID:5770640"
FT                   /translation="MATVADFIVERLYDWGVRRVYGYPGDGINGFFGALNRAEGKIEFV
FT                   QARHEEMAAFMASAHAKFTGELGVCVATSGPGAAHLVTGLYDARLDHMPVLAIVGQQAR
FT                   AALGGHYQQEVDLPALFKDVAGAFVQLATVPGQVRHLVDRAVRTALGARAVTALVLPND
FT                   LQELDYAAPKRAHGTVHSGIGYTRPKVVPYADDLQRAADVLNAGSKVAMLVGAGALDAT
FT                   DEVIAVADRLGAGAAKALLGKAALPDDLPWVTGSIGLLGTKPSYSLMSECDTLLMVGSG
FT                   FPYSEFLPKEGQARGVQIDLKADMLSLRFPMEVNLVGDSAETLRALLPLLNARHDTAWR
FT                   DRIAQWNDEWRDTLAARAAASASPGRGVNPQRAFTELSPRLPDDVILTSDSGSCANWYA
FT                   RDLMMRRGMMGSLSGGLASMGAAVPYAIAAKFAHPVRPVIALVGDGAMQMNNMAELITV
FT                   SKYWRTWADPRWICMVLNNEDLNQVTWEQRVMEGDPKFDASQQIPNVPYSRFATLLGLK
FT                   GIYVDDPAQLGAAWDEALASDRPVVLEVKSDPEVPPLPPHVTLQQAKHFAETLLKGDSR
FT                   EHNVIVETARQVLSAVLPGNGERGGGKKET"
FT                   /protein_id="YP_001585467.1"
FT   misc_feature    complement(211484..213280)
FT                   /note="thiamine pyrophosphate protein; Provisional; Region:
FT                   PRK08273"
FT                   /db_xref="CDD:181344"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(212777..213274)
FT                   /note="Pyrimidine (PYR) binding domain of POX; Region:
FT                   TPP_PYR_POX; cd07039"
FT                   /db_xref="CDD:132922"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(order(212783..212785,213008..213013,
FT                   213020..213025,213032..213034,213044..213046,
FT                   213053..213055,213092..213097,213101..213106,
FT                   213113..213115,213125..213127,213134..213145,
FT                   213182..213187,213194..213196,213203..213205,
FT                   213209..213211,213224..213226))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132922"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(order(212783..212785,212840..212842,
FT                   212849..212851,212894..212896,212921..212923,
FT                   212927..212929,212933..212935,213023..213025,
FT                   213032..213034,213041..213046,213053..213055,
FT                   213128..213130,213134..213145,213182..213187,
FT                   213194..213196,213203..213205,213209..213211))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:132922"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(order(212783..212785,212921..212923,
FT                   213023..213025,213032..213034,213041..213046,
FT                   213053..213055,213128..213130,213134..213145,
FT                   213182..213187,213194..213196,213203..213205,
FT                   213209..213211))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132922"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(order(213041..213043,213062..213064,
FT                   213131..213133,213209..213211))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132922"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(212300..212692)
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(211622..212179)
FT                   /note="Thiamine pyrophosphate (TPP) enzyme family,
FT                   TPP-binding module; found in many key metabolic enzymes
FT                   which use TPP (also known as thiamine diphosphate) as a
FT                   cofactor. These enzymes include, among others, the E1
FT                   components of the pyruvate, the acetoin...; Region:
FT                   TPP_enzymes; cl01629"
FT                   /db_xref="CDD:186460"
FT                   /locus_tag="Bmul_5505"
FT   misc_feature    complement(order(211844..211846,211850..211852,
FT                   211943..211954,212024..212026))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48162"
FT                   /locus_tag="Bmul_5505"
FT   gene            213426..214526
FT                   /db_xref="GeneID:5770641"
FT                   /locus_tag="Bmul_5506"
FT   CDS_pept        213426..214526
FT                   /locus_tag="Bmul_5506"
FT                   /gene_family="HOG000113759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mandelate racemase/muconate lactonizing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bam:Bamb_6568 mandelate racemase/muconate
FT                   lactonizing enzyme, C-terminal domain protein"
FT                   /db_xref="GI:161522539"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="GeneID:5770641"
FT                   /translation="MSLSDAPALGDVRARAYRVPTDRPEADGTYAWTATTIVVVEIDAG
FT                   PVTGLGYTYTDASAAALATSLLADVLRGRPLADVPAAVDALWRAVRNVGRAGVAATAIS
FT                   ALDVALWDAKAKLAGVPLATLLGRRRERVPVYGSGGFTTYDAATLAAQLGGWRDEGIRA
FT                   CKIKIGVQDACDPARLQTARDALGADVALFVDANGAYSARTALAFADRAARYDVRWFEE
FT                   PVSSDDVAGLRFVREHVGARVDVAAGEYAYTPDDFRRLLEAGAVDVLQADATRCGGVSG
FT                   FLAAGALADAYHVDLSAHCAPALHRHVGCVAPRMRHVEWFHDHVRIERMLFDGAPPLSD
FT                   GALEIDAGRPGLGLELRTADAQRYAI"
FT                   /protein_id="YP_001585468.1"
FT   misc_feature    213447..214502
FT                   /note="Mandelate racemase (MR)-like subfamily of the
FT                   enolase superfamily, subgroup 3. Enzymes of this subgroup
FT                   share three conserved carboxylate ligands for the essential
FT                   divalent metal ion (usually Mg2+), two aspartates and a
FT                   glutamate, and conserved...; Region: MR_like_3; cd03328"
FT                   /db_xref="CDD:48203"
FT                   /locus_tag="Bmul_5506"
FT   misc_feature    order(213831..213833,213918..213920,213924..213926,
FT                   214008..214010,214080..214082,214086..214088,
FT                   214170..214172,214239..214241,214320..214322,
FT                   214380..214382)
FT                   /note="putative active site pocket; other site"
FT                   /db_xref="CDD:48203"
FT                   /locus_tag="Bmul_5506"
FT   misc_feature    order(214008..214010,214086..214088,214170..214172)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:48203"
FT                   /locus_tag="Bmul_5506"
FT   gene            214561..215415
FT                   /db_xref="GeneID:5770642"
FT                   /locus_tag="Bmul_5507"
FT   CDS_pept        214561..215415
FT                   /locus_tag="Bmul_5507"
FT                   /gene_family="HOG000249758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5838 hypothetical protein"
FT                   /db_xref="GI:161522540"
FT                   /db_xref="GeneID:5770642"
FT                   /translation="MRVFRPPATARDEQLLRDAARLLNRSALLLAGSVLADSGVEHYRG
FT                   TFHNRAMVAPLVMSTLSVIASVHGHADDTPARHRLRDAVHVASAATGLAGSAFHLYNVT
FT                   KRVGRFSWHNLFYGAPLGAPVALLLSGALGAAGERMRDSPAAAPHIGGRPAGRVLAGLV
FT                   AAGLVGTLGEVGLLHFRGAFQHRAMFAPLIAPPVAALAAAHVALSRPRAARPFCRFWMR
FT                   TTALLGLVGVAFHARGVARQMGGWRNWSQNVLSGPPLPAPPAFTALAIAGLAATALAER
FT                   EGR"
FT                   /protein_id="YP_001585469.1"
FT   gene            215412..216062
FT                   /db_xref="GeneID:5770927"
FT                   /locus_tag="Bmul_5508"
FT   CDS_pept        215412..216062
FT                   /locus_tag="Bmul_5508"
FT                   /gene_family="HOG000249759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6566 hypothetical protein"
FT                   /db_xref="GI:161522541"
FT                   /db_xref="GeneID:5770927"
FT                   /translation="MKRDNERAAMLPRYPDYDVLAKRDTPSWNDATRRAIDARLKVAAT
FT                   APRALDAERFATLRALCARIAPQPAGSDAIPTAALIDARLANDEGDGFRDARLPPLRDA
FT                   WQIGLAALDAMAHRAHRASFASLDGDTADALLRTVQRGEIDAADRAAWAGMDARTFFAK
FT                   RVLMDICGAYYSHPYAWNEIGFGGPASPRGYVRMDFNRRDPWEARVGGDDDGR"
FT                   /protein_id="YP_001585470.1"
FT   gene            216052..217722
FT                   /db_xref="GeneID:5770928"
FT                   /locus_tag="Bmul_5509"
FT   CDS_pept        216052..217722
FT                   /locus_tag="Bmul_5509"
FT                   /gene_family="HOG000178853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bvi:Bcep1808_5840
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="GI:161522542"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:5770928"
FT                   /translation="MAADAPLSATTPRGCDGRAPDPLRVGGWMPMRMFRDDDPVDFVIV
FT                   GTGAGGGTLACKLAEYGYSVVALDAGAWWRPLEEFASDESHQRKLFWTDERICDGADPL
FT                   TLGTNNSGRAIGGSTVHFAMVSLRFRPEWFRSRSALGYGVDWPLDWREMWHYYREVEQA
FT                   LKISGPVRYPWGPPRPRYPYRAHELNAAALVLARGAEALGMDWTPTPLATLSAPRGRAH
FT                   PCVYRGFCIAGCATNAKQSALVTWIPRAVAAGAEVRDLAMALRIEAEGDRVTGVHYRRD
FT                   GRTRFQRARNVVVAGYAIESPRLLLLSANGRHPHGLANSSGLVGRYLMAQLNQASWGTM
FT                   DDEVRWYKGPPSLSLTEHWNYVDEGKDFFGGYCWMSQGPLPIEWARKLASRGLWGDALK
FT                   REMARYNFQAGLKIVGETLPRADNRVTLADERDAYGLPVARVTYAYDDNDRRMIRHALA
FT                   QMSRALEAAGARDIWHEEDDTCHLAGTVRMGDDPATSVVDADCRSWDIPNLWVCDGSVF
FT                   PTVGGVNPSLTIQAIACRTADRIRTLVARGEGHARARRR"
FT                   /protein_id="YP_001585471.1"
FT   misc_feature    216172..217674
FT                   /note="Choline dehydrogenase and related flavoproteins
FT                   [Amino acid transport and metabolism]; Region: BetA;
FT                   COG2303"
FT                   /db_xref="CDD:32458"
FT                   /locus_tag="Bmul_5509"
FT   misc_feature    216382..217002
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_N; pfam00732"
FT                   /db_xref="CDD:109776"
FT                   /locus_tag="Bmul_5509"
FT   misc_feature    217306..217656
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
FT                   /db_xref="CDD:147408"
FT                   /locus_tag="Bmul_5509"
FT   gene            217828..218220
FT                   /db_xref="GeneID:5770929"
FT                   /locus_tag="Bmul_5510"
FT   CDS_pept        217828..218220
FT                   /locus_tag="Bmul_5510"
FT                   /gene_family="HOG000098555" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   bch:Bcen2424_6541 protein of unknown function DUF305"
FT                   /db_xref="GI:161522543"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="GeneID:5770929"
FT                   /translation="MPIHTHRFVRPLRCAAACAALAAGAAAMPAAAQLRPTDPTVVPDS
FT                   STQAFQRADHRMMEAMDAARYTGDADRDFVSHMAPHHQGAIDMAQVELKYGKDPTLRQL
FT                   ASRIVAAQRDEIALMERWQKAHGATP"
FT                   /protein_id="YP_001585472.1"
FT   sig_peptide     217828..217926
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 33"
FT                   /locus_tag="Bmul_5510"
FT                   /product="hypothetical protein"
FT   misc_feature    218038..218193
FT                   /note="Domain of unknown function (DUF305); Region: DUF305;
FT                   pfam03713"
FT                   /db_xref="CDD:146378"
FT                   /locus_tag="Bmul_5510"
FT   gene            218263..219690
FT                   /db_xref="GeneID:5770364"
FT                   /locus_tag="Bmul_5511"
FT   CDS_pept        218263..219690
FT                   /locus_tag="Bmul_5511"
FT                   /gene_family="HOG000084937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bvi:Bcep1808_5842 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="GI:161522544"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="GeneID:5770364"
FT                   /translation="MDIDALLLSRFQFAWVIAFHILLPAFTVGLSCFIATLEVLHWATR
FT                   RAVYLRLSTFWLRIFAVSFGMGVVSGIVMPFQFGTNWSRFVAATSNVVGGFMAYEVLTA
FT                   FFLESAFLGVLLFGRRRVPPWAHATSAVLVALGTLLSSFWILAVNSWMQTPTGYRIVDG
FT                   RFYPDSVLSVLLSPSFPFRLAHTVTAFLVTTAFVVLAVGAHYLLQRRAPDESRVMVRMG
FT                   LWFLTIAVPVQIALGDAHGLNTLAHQPVKLAAMEGLWDTGRGVRATLFAWPDQARETNR
FT                   FELSIPRLGSLYLTHDWNGLVHGLKDWPRDQRPSVPVVFFAFHLMVGLGIVMLAIVVRG
FT                   LTLWRGRKLYAARGWLHACRFAMPIGFVAVLAGWTTTEAGRQPWTVYGLMRTADSVTPS
FT                   LTTGDVALSFALYAIGYLAIFGAGFVLLRRLVRLGPDTAPAHAGTPAAAVSERPARPLS
FT                   AVSDSGAQPPGANDDRA"
FT                   /protein_id="YP_001585473.1"
FT   misc_feature    218284..219534
FT                   /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
FT                   Bac_Ubq_Cox; cl00562"
FT                   /db_xref="CDD:186082"
FT                   /locus_tag="Bmul_5511"
FT   gene            219677..220690
FT                   /db_xref="GeneID:5770365"
FT                   /locus_tag="Bmul_5512"
FT   CDS_pept        219677..220690
FT                   /locus_tag="Bmul_5512"
FT                   /gene_family="HOG000084825" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   bvi:Bcep1808_5843 cytochrome d ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="GI:161522545"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="GeneID:5770365"
FT                   /translation="MTGLDLVPLWAGVLALSVLMYVLLDGFDLGVGMLFFWRRDEAERD
FT                   RMIASVSPVWDFNETWLVLGSTLLLAAFPGAFSVVVPGVYFPVLLMLLGLLFRGVAFEF
FT                   RGVVGARKRLWSGAFACGSLVATAAQGAVLGMFVQGFRVVDGRFAGTSWDWVAPFPLLT
FT                   AAGLVVGYLLLGATWLVMKTEGPLQLAARRAARHALLGVIVFIVAVSIWTPFADPAIAA
FT                   RWFAWPNLLFFSPVPVLTALLAWLAWRALNGRGEVLPFVASIGLFFLGFSGLTISLWPH
FT                   VAPPSVTLWSAASAQMSQEFLMIGTAFMLPVLLMYVGWSYWVFRGKVRGDAGYEHM"
FT                   /protein_id="YP_001585474.1"
FT   misc_feature    219689..220651
FT                   /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
FT                   pfam02322"
FT                   /db_xref="CDD:145462"
FT                   /locus_tag="Bmul_5512"
FT   misc_feature    219701..220660
FT                   /note="cytochrome bd-II oxidase subunit 2; Provisional;
FT                   Region: PRK15028; cl12219"
FT                   /db_xref="CDD:187194"
FT                   /locus_tag="Bmul_5512"
FT   gene            220731..221474
FT                   /db_xref="GeneID:5770366"
FT                   /locus_tag="Bmul_5513"
FT   CDS_pept        220731..221474
FT                   /locus_tag="Bmul_5513"
FT                   /gene_family="HOG000218423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FRG domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FRG domain protein; KEGG: bam:Bamb_6563
FT                   hypothetical protein"
FT                   /db_xref="GI:161522546"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="GeneID:5770366"
FT                   /translation="MGRERARDAGETIDSVADYMARIGAQDDGRAARLFRGQCNAGWAL
FT                   APSIARGRSTPDIEARMLDEFMRSALPHLEPAPNLDACDWLAIAQQHGMRTRLLDWSGS
FT                   ALAALWFAVRSASEAGVDGVVWCLRHDADDIATIAERRAPLSVTRTKVFRPRHVMPRIT
FT                   AQDGWFTIHSYDADAQCFAPLDEQPDFAGRLTRIVVPGKRFAAIRHELARVGVSVATIF
FT                   PDLDGIAQWTDTRYFPDDEDTHAPR"
FT                   /protein_id="YP_001585475.1"
FT   misc_feature    220830..221108
FT                   /note="FRG domain; Region: FRG; pfam08867"
FT                   /db_xref="CDD:149812"
FT                   /locus_tag="Bmul_5513"
FT   gene            221877..222389
FT                   /db_xref="GeneID:5770325"
FT                   /locus_tag="Bmul_5514"
FT   CDS_pept        221877..222389
FT                   /locus_tag="Bmul_5514"
FT                   /gene_family="HOG000268587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1452; KEGG:
FT                   bur:Bcep18194_C6797 protein of unknown function DUF1452"
FT                   /db_xref="GI:161522547"
FT                   /db_xref="InterPro:IPR010842"
FT                   /db_xref="GeneID:5770325"
FT                   /translation="MREANDSSRVRPDAADRHETDRASGPHPVTRAFERFASGVTAWAG
FT                   SPIAFGSAVAVTLLWLVSGPLFHYSDAWQLVINTGTTIITFLMVFLLQRNQNRDSVALH
FT                   LKLDELVAATRSASDRLIGIEDASEEELNQLAQAYMKLAKRAGTREGLEEDCARVRDMA
FT                   DAPRDAS"
FT                   /protein_id="YP_001585476.1"
FT   misc_feature    221973..222326
FT                   /note="Low affinity iron permease; Region: Iron_permease;
FT                   cl12096"
FT                   /db_xref="CDD:159756"
FT                   /locus_tag="Bmul_5514"
FT   gene            222490..223038
FT                   /db_xref="GeneID:5770326"
FT                   /locus_tag="Bmul_5515"
FT   CDS_pept        222490..223038
FT                   /locus_tag="Bmul_5515"
FT                   /gene_family="HOG000072497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nmu:Nmul_A2305 hypothetical protein"
FT                   /db_xref="GI:161522548"
FT                   /db_xref="GeneID:5770326"
FT                   /translation="MSATELADGYLRFFVLPLWIAAGFVDWLCHRRSQIASTSGLRESL
FT                   LHVAQLVEVGIPLLVALLFEIDLTVLALMAAGFVLHEFTALADVRYAVSRRDVSPFEQH
FT                   VHSFLEMMPLVALSLIAWIVLPARLRDGVQATDFALRWRPTEPLYIVVLLAAVLVFAVI
FT                   PYAEECLRGWRCARRAASR"
FT                   /protein_id="YP_001585477.1"
FT   gene            223205..223684
FT                   /db_xref="GeneID:5770327"
FT                   /locus_tag="Bmul_5516"
FT   CDS_pept        223205..223684
FT                   /locus_tag="Bmul_5516"
FT                   /gene_family="HOG000268588" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport-associated protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transport-associated; KEGG: bam:Bamb_6562
FT                   transport-associated"
FT                   /db_xref="GI:161522549"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:5770327"
FT                   /translation="MESQTRLKPLMNLAAAVACGALAMYFLDPASGRRRRAYVCDKAAA
FT                   GGHGVVDYASSCAKQATERARSAITGLRQHWQPEQVDDALIAARVRAELARLTGRPHDI
FT                   DVSVEDGHVRLSGAIDEAERQAIVDGVSAVDGVRTVDDGLGTRSEYRADAGDGAS"
FT                   /protein_id="YP_001585478.1"
FT   sig_peptide     223205..223276
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.554 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5516"
FT                   /product="hypothetical protein"
FT   misc_feature    223304..>223651
FT                   /note="Predicted periplasmic or secreted lipoprotein
FT                   [General function prediction only]; Region: OsmY; COG2823"
FT                   /db_xref="CDD:32651"
FT                   /locus_tag="Bmul_5516"
FT   misc_feature    223463..223636
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="Bmul_5516"
FT   gene            223937..224428
FT                   /db_xref="GeneID:5770589"
FT                   /locus_tag="Bmul_5517"
FT   CDS_pept        223937..224428
FT                   /locus_tag="Bmul_5517"
FT                   /gene_family="HOG000268599" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7053 hypothetical protein"
FT                   /db_xref="GI:161522550"
FT                   /db_xref="GeneID:5770589"
FT                   /translation="MAERLPDDTTPPPSEPNAHDALERLLGSLHRHGFLRFANDVVSAN
FT                   AKIAEVLVGALDKPGTQTGVQNLAMLVMALSRVPPEQFGKTMFAAADALRHIGTWQPAE
FT                   HEHVAPGVRGVYRLLNDDALWEAITPLLEGLKVFAQGLAREPEQSVTALTAKAGGTDRA
FT                   "
FT                   /protein_id="YP_001585479.1"
FT   misc_feature    <224060..224356
FT                   /note="Protein of unknown function (DUF1641); Region:
FT                   DUF1641; cl01025"
FT                   /db_xref="CDD:154153"
FT                   /locus_tag="Bmul_5517"
FT   gene            complement(224385..224936)
FT                   /db_xref="GeneID:5770590"
FT                   /locus_tag="Bmul_5518"
FT   CDS_pept        complement(224385..224936)
FT                   /locus_tag="Bmul_5518"
FT                   /gene_family="HOG000261967" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bch:Bcen2424_6546 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:161522551"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:5770590"
FT                   /translation="MRLARCSAMNTFAACPLPDMKLPDPADFPVRAVPLAPLAKERATV
FT                   LCHRNGRVLLVARRPSSRWTLPGGVIRRGESALDAAHRELHEETGLTGLDLAYFFYVDG
FT                   NVKRHHVFVVDLPPGMHACPGREIALCRWVPIDAVTRWPASAPTQRIVHQLAQLRGIAS
FT                   AHAPAALTRGPCRPPLQSAP"
FT                   /protein_id="YP_001585480.1"
FT   misc_feature    complement(224481..224816)
FT                   /note="Members of the Nudix hydrolase superfamily catalyze
FT                   the hydrolysis of NUcleoside DIphosphates linked to other
FT                   moieties, X. Enzymes belonging to this superfamily require
FT                   a divalent cation, such as Mg2+ or Mn2+, for their activity
FT                   and contain a highly...; Region: Nudix_Hydrolase_10;
FT                   cd04667"
FT                   /db_xref="CDD:72904"
FT                   /locus_tag="Bmul_5518"
FT   misc_feature    complement(224664..224732)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72904"
FT                   /locus_tag="Bmul_5518"
FT   gene            complement(225014..225535)
FT                   /db_xref="GeneID:5770591"
FT                   /locus_tag="Bmul_5519"
FT   CDS_pept        complement(225014..225535)
FT                   /locus_tag="Bmul_5519"
FT                   /gene_family="HOG000268354" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   bvi:Bcep1808_5182 protein of unknown function DUF892"
FT                   /db_xref="GI:161522552"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="GeneID:5770591"
FT                   /translation="MASEANVVDERLMEWLRDAHAMEEQAETMLSSMAGRIEHYPDIKR
FT                   RIEQHIEETREQARLIRSCIERRGGSVSTMKDLGAKTMAWVQGMSGMFVSDEIVKGGMA
FT                   SYMFEHFEIAAYRNLIEAARVAGDIETQTICERILPEEQAMAAWLEHNMAGVVRTYLAR
FT                   EMRPNTTAKR"
FT                   /protein_id="YP_001585481.1"
FT   misc_feature    complement(225086..225496)
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cd00657"
FT                   /db_xref="CDD:153097"
FT                   /locus_tag="Bmul_5519"
FT   misc_feature    complement(order(225101..225103,225110..225112,
FT                   225209..225211,225365..225367,225374..225376,
FT                   225467..225469))
FT                   /note="dinuclear metal binding motif; other site"
FT                   /db_xref="CDD:153097"
FT                   /locus_tag="Bmul_5519"
FT   gene            complement(225598..226524)
FT                   /db_xref="GeneID:5770457"
FT                   /locus_tag="Bmul_5520"
FT   CDS_pept        complement(225598..226524)
FT                   /locus_tag="Bmul_5520"
FT                   /gene_family="HOG000267704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   bvi:Bcep1808_5870 catalase"
FT                   /db_xref="GI:161522553"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="GeneID:5770457"
FT                   /translation="MFIHNTRLQYTVRVDAPNPGLANLLLEQFGGPQGELAAAMRYFTQ
FT                   AITEEDPGRKDMLFDIATEELSHLEVIGSLVAMLNRGAKGELAEAVDEQAELYRKLNGA
FT                   GNDSHVTQLLYGAGSPLTNSGAVPWSAAYIDTIGEPTADLRSNIAAEARAKIIYERLIN
FT                   VSDDPSVREALGFLMTREVSHQKSFEKALYAITANFPPGKLPPMEPYDRVYFRMQEGAE
FT                   PMPGPWNRGDALSVRRGEPAVDGGDGLATGAVDPTQSQALEAMARRLASDPNCDPTTGA
FT                   ELGAGAPHDSTTSPVPPVSGTPGTPGV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585482.1"
FT   misc_feature    complement(225937..226524)
FT                   /note="Manganese catalase, ferritin-like diiron-binding
FT                   domain; Region: Mn_catalase; cd01051"
FT                   /db_xref="CDD:153110"
FT                   /locus_tag="Bmul_5520"
FT   misc_feature    complement(order(225973..225975,226072..226074,
FT                   226321..226323,226330..226332,226420..226422))
FT                   /note="dimanganese center; other site"
FT                   /db_xref="CDD:153110"
FT                   /locus_tag="Bmul_5520"
FT   gene            227129..228535
FT                   /db_xref="GeneID:5770458"
FT                   /locus_tag="Bmul_5521"
FT   CDS_pept        227129..228535
FT                   /locus_tag="Bmul_5521"
FT                   /gene_family="HOG000112071" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bch:Bcen2424_6548 secretion protein HlyD family protein"
FT                   /db_xref="GI:161522554"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:5770458"
FT                   /translation="MSEVTVSPLPDRLRDRVAPTRASPLARRQARTRIARGGVRRRASA
FT                   RTADAPLDREPGGAPVRVARAGDDAADRGSGTGSGHGEPRGERDADAPGGGGGDGHPHD
FT                   DRGGRTGSDGDGAGDGGERKRPGRKPLIILGAIALLLVVGGLVWWFATRNQESTDDAYT
FT                   DGNAIAVAPHVSGYVTRLAVDDNVYVHRGDVLVEIDPRDYRAQVDAAHAQLGLAEAQLD
FT                   AARVQLDIARVQYPAQYRQARAQIESAEAAYRQALAAQARQRAVDVRATSQQAIDAADA
FT                   QRASADANVAMAQAQARTASLVPQQIRQAETVVEERRQQVLQARAQLEQAELNLAYCTM
FT                   RAPSDGWVTRRNVQLGSFLQPGTSIFSIVTPRVWITANFKESQLKRMRVGDRVDVSVDA
FT                   YPDLDLHGHVDSIQLGSGSRFSAFPAENATGNFVKIVQRVPVKIVLDGPLPRNPPLGLG
FT                   LSVEPTVHLK"
FT                   /protein_id="YP_001585483.1"
FT   misc_feature    227570..>227815
FT                   /note="Multidrug resistance efflux pump [Defense
FT                   mechanisms]; Region: EmrA; COG1566"
FT                   /db_xref="CDD:31754"
FT                   /locus_tag="Bmul_5521"
FT   misc_feature    <228143..228466
FT                   /note="efflux pump membrane protein (multidrug resistance
FT                   protein A); Region: 8a0101; TIGR00998"
FT                   /db_xref="CDD:162152"
FT                   /locus_tag="Bmul_5521"
FT   gene            228623..230215
FT                   /db_xref="GeneID:5770459"
FT                   /locus_tag="Bmul_5522"
FT   CDS_pept        228623..230215
FT                   /locus_tag="Bmul_5522"
FT                   /gene_family="HOG000112191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="EmrB/QacA family drug resistance transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_6559 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="GI:161522555"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:5770459"
FT                   /translation="MNRPADQAAAPGGDWRPAANPWLVAVVVTLAAFMEVLDTTIVNVA
FT                   LPHIAGTMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFVLCIAAFTACSFL
FT                   CGIATNLGELIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSVSAIAIVVAPVLG
FT                   PTLGGWITDHFSWRWVFLLNVPIGVLTVLAVMQLVEDPPWRRGAVRGLSVDYVGIGLIA
FT                   IGLGCLQVMLDRGEDEDWFGSTFIRIFAVLSALGLVGATLWLLRTKKPVVDLSCLRDRN
FT                   FALGCVTIATFAAVLYGSAVIVPQLAQQHLGYTATLAGLVLSPGALLITLEIPLVSRLM
FT                   PHVQTRYLVGFGFVLLAFALAYSRMLVPDIDYRHLVMIRCAQSLAIGFMFVPITTLAYL
FT                   TVPQRLNDDASALFTMFRNVAGSIGISVSTALIRERTQARMAHLSAHTSPLSQNFQDAL
FT                   HANARAIAELSGGTPAAALQTANGRLYETFVSQATILAYIDVFALLAVFCAACIPLTFL
FT                   FSPVKAARAGGGH"
FT                   /protein_id="YP_001585484.1"
FT   misc_feature    228689..230173
FT                   /note="drug resistance transporter, EmrB/QacA subfamily;
FT                   Region: efflux_EmrB; TIGR00711"
FT                   /db_xref="CDD:129794"
FT                   /locus_tag="Bmul_5522"
FT   misc_feature    228698..>229216
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5522"
FT   misc_feature    order(228737..228739,228746..228754,228758..228763,
FT                   228812..228814,228821..228826,228833..228835,
FT                   228845..228850,228854..228859,228995..229000,
FT                   229007..229012,229019..229024,229031..229033,
FT                   229067..229072,229079..229084,229100..229102)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5522"
FT   misc_feature    <229460..229918
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bmul_5522"
FT   gene            230217..231947
FT                   /db_xref="GeneID:5770677"
FT                   /locus_tag="Bmul_5523"
FT   CDS_pept        230217..231947
FT                   /locus_tag="Bmul_5523"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bcn:Bcen_1281 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="GI:161522556"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:5770677"
FT                   /translation="MTTCDVARRSRRPRALRRATAVAVAAAALAAGTLLGACTVGPDFT
FT                   PPRADLPAGWHALQRADAAAPASGASAPASTPTTDADPDPRWWRAFGDPLLDRLVERAA
FT                   RDNLDVQAAVLRIAQARAQVRAAAAQGLPDVRASASYQREQLGLKGFVEDQGLDRQIDR
FT                   LGAPGSPLDRLGPGTGAAVQQRARGALDALESPVNLWQAGFDASWELDLFGRVRRTVEA
FT                   ADAQAGAAVASRDDALLSLEAEVAQTYLQLRGAQTQRALADELVDAQRELRDLTREQAA
FT                   HGLASDLDVRSADARLAQLRAQLPQFDQQIVLLKNGLAYLVGGAPGALDDWLDTPRALP
FT                   GVPPAVPVGLPSTLARRRPDIRRAEADLHAATADVGVAVAQFYPDVSLTGQVGLRATHV
FT                   RELAHWSHLFYAFGPAVSLPIFSGGALVSNLRLTQARQAEAALAYRQTVLVALRDVDNA
FT                   LAVCRTDQTRAAALDDAVRAEQGALELARDRYRKGLSPFLDVLDAERQWSEGRQQAVQG
FT                   ALQTTTDLVALYKALGGGWREGEGGRDGGARADARRVDAARADASRTDAARDAQAPAQP
FT                   "
FT                   /protein_id="YP_001585485.1"
FT   sig_peptide     230217..230330
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.386 at
FT                   residue 38"
FT                   /locus_tag="Bmul_5523"
FT                   /product="hypothetical protein"
FT   misc_feature    230340..231806
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="Bmul_5523"
FT   misc_feature    <230766..231185
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bmul_5523"
FT   misc_feature    231270..231803
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bmul_5523"
FT   gene            232830..233726
FT                   /db_xref="GeneID:5770678"
FT                   /locus_tag="Bmul_5524"
FT   CDS_pept        232830..233726
FT                   /locus_tag="Bmul_5524"
FT                   /gene_family="HOG000253120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_A1445 putative 10 TMS
FT                   drug/metabolite exporter, DME family, DMT super family"
FT                   /db_xref="GI:161522557"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:5770678"
FT                   /translation="MNATNFAFLLTLAALWGASFLFIRVGAPEFGPVPLMAVRILIAAV
FT                   FLAIVLGSKRGFHRMSGKIVPLFAIGVLNQALPFCLFAYAELTLPAGVTSVINATTPLW
FT                   AAIVAFVWIGDRLSRTRVAGLFIGFAGVLILVWKDLSGLRSFSESAIAPIAVLCATLLY
FT                   GISANATKRFLAGVDSLAIATGSMIGAAIVLAPFAVVYWPSTPISTTAWVSVIALGVAC
FT                   TGIAYIIYFYLIATAGPARAVSVTFLVPIFGLLWGTLFLDESISPMMIAGCGVVILGTM
FT                   LASGVLKPSVLVGKRPV"
FT                   /protein_id="YP_001585486.1"
FT   sig_peptide     232830..232910
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.669 at
FT                   residue 27"
FT                   /locus_tag="Bmul_5524"
FT                   /product="hypothetical protein"
FT   misc_feature    232875..233666
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Region:
FT                   2A78; TIGR00950"
FT                   /db_xref="CDD:162128"
FT                   /locus_tag="Bmul_5524"
FT   misc_feature    232875..233240
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Bmul_5524"
FT   misc_feature    233310..233681
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Bmul_5524"
FT   gene            complement(233769..234689)
FT                   /db_xref="GeneID:5770679"
FT                   /locus_tag="Bmul_5525"
FT   CDS_pept        complement(233769..234689)
FT                   /locus_tag="Bmul_5525"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: atc:AGR_C_3765 hypothetical
FT                   protein"
FT                   /db_xref="GI:161522558"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5770679"
FT                   /translation="MKPPKSHSSLPSLRALRYFVSVGKHRSIKAAAAELHVTASAISQQ
FT                   ILKLEDELGVSLLHRSARGIDITPHGMRYMQELNQVFDRILRATDRLRSNANHTEIVTV
FT                   SCAHSFAMQWLVPRLAQLAIAEPTVDLRISTTNRYAAFAEDQIDFAVRHGTGRYHGLHS
FT                   ELLLDDPLSPVCNPRLIKQIGPFSSFSDLVRTTLLHDERHNEWLAWLEKYRADGIRGNK
FT                   GAIFTDSNVAIHAAMACHGVALARKSLVRSELDDGRLTILFDAPLTPEYAYYLVYPNET
FT                   LDNPSAILFRKWIMKNVMQSLASSG"
FT                   /protein_id="YP_001585487.1"
FT   misc_feature    complement(234477..234650)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5525"
FT   misc_feature    complement(233790..234647)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:182990"
FT                   /locus_tag="Bmul_5525"
FT   misc_feature    complement(233808..234389)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5525"
FT   misc_feature    complement(order(234285..234305,234309..234362,
FT                   234366..234389))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5525"
FT   misc_feature    complement(order(233943..233945,234003..234011,
FT                   234360..234362,234366..234371))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bmul_5525"
FT   gene            complement(235027..235155)
FT                   /db_xref="GeneID:5770649"
FT                   /locus_tag="Bmul_5526"
FT   CDS_pept        complement(235027..235155)
FT                   /locus_tag="Bmul_5526"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ter:Tery_0481 TPR repeat"
FT                   /db_xref="GI:161522559"
FT                   /db_xref="GeneID:5770649"
FT                   /translation="MAMESTSASETIDRLDLVITVDTPVAHLAGAIGKPVWILLST"
FT                   /protein_id="YP_001585488.1"
FT   misc_feature    complement(<235048..>235122)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bmul_5526"
FT   gene            235940..236071
FT                   /db_xref="GeneID:5770650"
FT                   /locus_tag="Bmul_5527"
FT   CDS_pept        235940..236071
FT                   /locus_tag="Bmul_5527"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polypeptide-transport-associated
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_3782 polypeptide-transport-associated
FT                   domain protein, ShlB-type"
FT                   /db_xref="GI:161522560"
FT                   /db_xref="GeneID:5770650"
FT                   /translation="MKGSVATRFGAYGYDLFAGTPVYKPSGFPTARVTVGFQVTAQL"
FT                   /protein_id="YP_001585489.1"
FT   gene            236409..236711
FT                   /db_xref="GeneID:5770651"
FT                   /locus_tag="Bmul_5528"
FT   CDS_pept        236409..236711
FT                   /locus_tag="Bmul_5528"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6046 hypothetical protein"
FT                   /db_xref="GI:161522561"
FT                   /db_xref="GeneID:5770651"
FT                   /translation="MDMRIGTTPVELGSPTVDVPAGGYYDRFRMNPELDEMARDPAAGN
FT                   VDFFRRMPKRIVESSVGAIRAPNFYYRSGSVQLLFVAPLAALSARYPIVSPRNHR"
FT                   /protein_id="YP_001585490.1"
FT   gene            236708..237949
FT                   /db_xref="GeneID:5770505"
FT                   /locus_tag="Bmul_5529"
FT   CDS_pept        236708..237949
FT                   /locus_tag="Bmul_5529"
FT                   /gene_family="HOG000251397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="saccharopine dehydrogenase (NAD(+),
FT                   L-glutamate-forming)"
FT                   /EC_number="1.5.1.9"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   bch:Bcen2424_6045 saccharopine dehydrogenase"
FT                   /db_xref="GI:161522562"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="GeneID:5770505"
FT                   /translation="MTQASYDLVVFGATSFVGQILTRHLAEHLSSGADTLRWAIAGRSE
FT                   AKLAQLRDSLGDAARTLPILVADASDDAQLQALCAQTRVVVSTVGPYALYGEPLVRACA
FT                   QSGTDYCDLTGETQWIKRMIDRYEAAATQSGARIVHCCGFDSIPSDLGVYVLQQRARHE
FT                   WGAPAEHVTMRVKTLKGGASGGTVASMINVVREAAADPALRRMLLDPYALCPRDHRFTV
FT                   RQHAVRSAEFDRDCDAWIAPFVMAAVNERVVHRSNALAGDAYGSGFRYDEAIVTGRGIR
FT                   GSVVARATVVALGAFMAGVLVKPVRSAMERFLLPKPGEGPSLAAQRAGCFDLRFFGHAP
FT                   DGRIVRLKVTGDRDPGYGSTGKMLGQAAICLALDCRAGNDGTRGGGFWTPATMFGERLV
FT                   DRLVRHAGLRFDAI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585491.1"
FT   misc_feature    236723..237940
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3268"
FT                   /db_xref="CDD:33079"
FT                   /locus_tag="Bmul_5529"
FT   gene            complement(238090..238773)
FT                   /db_xref="GeneID:5770506"
FT                   /locus_tag="Bmul_5530"
FT   CDS_pept        complement(238090..238773)
FT                   /locus_tag="Bmul_5530"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_C7474 ThiJ/PfpI family protein"
FT                   /db_xref="GI:161522563"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:5770506"
FT                   /translation="MTRRILHVVTNIAHYADPSQPTGLWLAELTHAYDIFAARGYTQQL
FT                   VSPKGGVSPLEPRSLKWPHADAAAKAWRADPAHQTLLANTARPDDIDAAAFDAIYFTGG
FT                   HGVMWDFPDDAGLQRLTREIYERGGIVAAVCHGYCGLLNTRLSDGSLLVTGRRLTGYAW
FT                   IEEVLAGVANKVPYNVEEEMKRRGARYEKALLPFTSNVVVDGRLVTGQNPQSAKATAEQ
FT                   VAALL"
FT                   /protein_id="YP_001585492.1"
FT   misc_feature    complement(238093..238761)
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in proteins similar to Escherichia coli Hsp31
FT                   protein; Region: GATase1_Hsp31_like; cd03141"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Bmul_5530"
FT   misc_feature    complement(order(238276..238278,238366..238371))
FT                   /note="potential catalytic triad; other site"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Bmul_5530"
FT   misc_feature    complement(238369..238371)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Bmul_5530"
FT   gene            complement(239250..240461)
FT                   /db_xref="GeneID:5770507"
FT                   /locus_tag="Bmul_5531"
FT   CDS_pept        complement(239250..240461)
FT                   /locus_tag="Bmul_5531"
FT                   /gene_family="HOG000238921" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitric oxide dioxygenase"
FT                   /transl_table="11"
FT                   /note="flavohemoprotein; catalyzes the formation of nitrate
FT                   from nitric oxide; can also catalyze the reduction of
FT                   dihydropteridine"
FT                   /db_xref="GI:161522564"
FT                   /db_xref="InterPro:IPR000778"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="GeneID:5770507"
FT                   /translation="MLTQQTKDIVKATAPVLAQHGYDIIQCFYRRLFDAHPELKNVFNM
FT                   THQEQGQQQQALARAVYAYAENIEDPGSLAAVLKNIANKHASLGVRPEHYPIVGEHLLG
FT                   AIKETLGDAATDEIISAWAQAYGNLADLLAGMESGLYEQSATRVGGWTGWRTFIVRDKR
FT                   PESSVITSFVLEPADGQPVANFEPGQYVSVAVDVPTLGLQQIRQYSLSDMPNGRTYRIS
FT                   VKREGGGPYPPGHVSCLLHDHVNVGDEMRLAAPYGCFHIDVDASTPIVLISGGVGLTPM
FT                   ISMLKRAIQDPKRQVVFVHGARNSGVHAMRDRLRETARTHTNFSLIVFYDDPLPQDLPG
FT                   RDYDHAGLVDVNAIKDAILLPDADYYICGPVPFMRLQHDALKQLDIPEARIHYEVFGPD
FT                   LFAE"
FT                   /protein_id="YP_001585493.1"
FT   misc_feature    complement(239253..240461)
FT                   /note="bifunctional nitric oxide
FT                   dioxygenase/dihydropteridine reductase 2; Provisional;
FT                   Region: PRK13289"
FT                   /db_xref="CDD:183952"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(240063..240455)
FT                   /note="Globins are heme proteins, which bind and transport
FT                   oxygen. This family summarizes a diverse set of homologous
FT                   protein domains, including: (1) tetrameric vertebrate
FT                   hemoglobins, which are the major protein component of
FT                   erythrocytes and transport oxygen...; Region: globin;
FT                   cd01040"
FT                   /db_xref="CDD:29979"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(240075..240077,240168..240170,
FT                   240177..240179,240207..240212,240294..240296,
FT                   240303..240305,240333..240338,240345..240347,
FT                   240375..240377))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:29979"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(239262..240017)
FT                   /note="FAD_NAD(P)H binding domain of flavohemoglobin.
FT                   Flavohemoglobins have a globin domain containing a B-type
FT                   heme fused with a ferredoxin reductase-like FAD/NAD-binding
FT                   domain. Flavohemoglobins detoxify nitric oxide (NO) via an
FT                   NO dioxygenase reaction. The...; Region:
FT                   flavohem_like_fad_nad_binding; cd06184"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(239274..239276,239625..239627,
FT                   239751..239762,239790..239792,239796..239798,
FT                   239835..239846,239892..239894))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(239835..239840,239844..239846))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(239691..239693,239697..239699,
FT                   239721..239723,239742..239744,239751..239753,
FT                   239760..239762))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(239622..239624,239628..239639,
FT                   239649..239651))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(order(239352..239357,239553..239561,
FT                   239631..239636))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   misc_feature    complement(239265..239267)
FT                   /note="Heme binding  pocket; other site"
FT                   /db_xref="CDD:99781"
FT                   /locus_tag="Bmul_5531"
FT   gene            complement(240513..241592)
FT                   /db_xref="GeneID:5770767"
FT                   /locus_tag="Bmul_5532"
FT   CDS_pept        complement(240513..241592)
FT                   /locus_tag="Bmul_5532"
FT                   /gene_family="HOG000237543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   tbd:Tbd_0737 glycosyl transferase probable ADP-heptose:LPS
FT                   heptosyltransferase"
FT                   /db_xref="GI:161522565"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:5770767"
FT                   /translation="MRSVDGHIGDVRSIAVVGPDALGDTMMTLPALRALRVAYRDACIV
FT                   YVGLDWHASFFRDRPGPIDVVRVRPAAVDPGRPLPPDAPPIDRTFRVRADDPPFDVAVQ
FT                   LFGGGAQANPFTRALGARIAVGACAPGAPPLDRWTPYGRWQNRRLLALEIVSLAGATLW
FT                   PAGPDLAVIERDRHAMRAALPPDIAEQLHELVVVQPSARDPRRRWSPRHFAAVADRLAA
FT                   RGLRIAVVGTAQERPIVRAVLDAMHAPALDLAGALDIGGLAALLEHAALMLSNDTGPLH
FT                   LAAALGTPCVGIFWFTNALQALPLAQGRCRAAVSPRIVCPVCGEPNLTSRCAHDDSFVD
FT                   DVTVDEVATLADEVLAERT"
FT                   /protein_id="YP_001585494.1"
FT   misc_feature    complement(240522..241562)
FT                   /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]; Region: RfaF; COG0859"
FT                   /db_xref="CDD:31200"
FT                   /locus_tag="Bmul_5532"
FT   misc_feature    complement(<241395..241556)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:186885"
FT                   /locus_tag="Bmul_5532"
FT   misc_feature    complement(240567..>241013)
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5532"
FT   misc_feature    complement(order(240747..240749,240756..240761,
FT                   240768..240770,240804..240809,240903..240905,
FT                   240999..241004))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5532"
FT   gene            complement(241579..243357)
FT                   /db_xref="GeneID:5770768"
FT                   /locus_tag="Bmul_5533"
FT   CDS_pept        complement(241579..243357)
FT                   /locus_tag="Bmul_5533"
FT                   /gene_family="HOG000219867" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   eba:ebA7025 hypothetical protein"
FT                   /db_xref="GI:161522566"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:5770768"
FT                   /translation="MQPIHAADITYFHDAALLARVDDDCGATVDDVGPAWRQIHRNHDC
FT                   NASLWRHEDEARRRDVADRAIVENKRAIDRLNQQRNDAVEALDEVLLAALPPAHADARL
FT                   NSETAGSIIDRLSILALKIHHMGLHVARDDVDAAHRASCRAKLERLREQRTDLAACLDA
FT                   LLADAAAGTARFKVYRQFKMYNDPALNPYLGGQVANDTAAANAGPVASAAAPTAAPAEP
FT                   TRDDAPEPAAPDDPPPTRPTDDPPPTRPTDVPPDMPPTPPMDVPPDAPPTPPGPPPGVP
FT                   RGSAADAHAAASRHAAHGADDMHDTIARPSPTQPASHAVDVLIPTCDRPHALALTLTTV
FT                   ALQTHRPLRVVVSDQSALAAADDALLRAAVRFAGAQGVDVQLERHMPAMGLAEQRAFLL
FT                   AHARAPRCLFVDDDVILEADLVARLVHALDTHRCGFVGSALHGLSHIGDVRAHHQHVEF
FT                   WDGRVRPEVLAPGGPEWARHHLHSAANLYHAQCRLRVPRNASRVYRVAWVGGCVLFDTA
FT                   KLRACGGFEFWRALPARHCGEDVLAQLRVMARFGGCGLFPSGAYHAELPTTVRERDVDA
FT                   PFVLAHLIDEAAHAIR"
FT                   /protein_id="YP_001585495.1"
FT   misc_feature    complement(<242041..242394)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Bmul_5533"
FT   misc_feature    complement(order(242119..242121,242125..242127,
FT                   242299..242301,242377..242379,242383..242385))
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Bmul_5533"
FT   gene            complement(243391..244500)
FT                   /db_xref="GeneID:5770769"
FT                   /locus_tag="Bmul_5534"
FT   CDS_pept        complement(243391..244500)
FT                   /locus_tag="Bmul_5534"
FT                   /gene_family="HOG000237543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   azo:azo1721 heptosyltransferase"
FT                   /db_xref="GI:161522567"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="GeneID:5770769"
FT                   /translation="MSVIPFAASMQQRIADTPPLARPLRSIVVFRALRLGDMLCAVPAL
FT                   RALRDAQPAAAIRLVTLPSAAQWMRRYDRYVDDIAVFPGDARLPERTVDEAARADFGAT
FT                   LARWQPDLAIQMHGDGRVTNAIVGRFGARAVAGFTRTDAVPTTRAWLPYPDRGPEPLRL
FT                   LQLVRALGASTPSADASHLEFPLTPADHAELRDSGLLARLGDRPLLCVHPGASAAHKCW
FT                   PPDAFAHVARHLAACHGLTIVLTGSAAEQPLARHVAARTGGDTIDATCGLSIGAMAALI
FT                   ARARLLLCNDTGVSHLAAALRVPSVVVLGRADPERWAPLDRNRHVCVRDPDATRVNDVL
FT                   EAGCMLLSRDARAHAAAALSPPRDDVSAR"
FT                   /protein_id="YP_001585496.1"
FT   misc_feature    complement(243502..244425)
FT                   /note="Lipopolysaccharide heptosyltransferase is involved
FT                   in the biosynthesis of lipooligosaccharide (LOS).
FT                   Lipopolysaccharide (LPS) is a major component of the outer
FT                   membrane of gram-negative bacteria. LPS heptosyltransferase
FT                   transfers heptose molecules from...; Region:
FT                   GT1_LPS_heptosyltransferase; cd03789"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5534"
FT   misc_feature    complement(243520..244209)
FT                   /note="Glycosyltransferase family 9 (heptosyltransferase);
FT                   Region: Glyco_transf_9; pfam01075"
FT                   /db_xref="CDD:110100"
FT                   /locus_tag="Bmul_5534"
FT   misc_feature    complement(order(243610..243612,243619..243624,
FT                   243631..243633,243667..243672,243766..243768,
FT                   243865..243870))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99964"
FT                   /locus_tag="Bmul_5534"
FT   gene            244949..245659
FT                   /db_xref="GeneID:5770559"
FT                   /locus_tag="Bmul_5535"
FT   CDS_pept        244949..245659
FT                   /locus_tag="Bmul_5535"
FT                   /gene_family="HOG000263163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MgtC/SapB transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bam:Bamb_6538
FT                   MgtC/SapB transporter"
FT                   /db_xref="GI:161522568"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="GeneID:5770559"
FT                   /translation="MDTMPIVLQWGDILARVALSLIAGALIGFDRSEAGKTAGLRTAML
FT                   VCAAACLAMLQVNALLGQSGKTPQSFAQLDLMRLPLGILTGMGFIGGGAILHRDGLVTG
FT                   VTTAATLWFVTVIGLCIGGGQLQLGALGLAVGLVVIWPLRHVEQRLRRTRTALVTVEYE
FT                   IASTSRDRLLALMREAGFKCRVRGFHEAATQSLREETFVVQWRETPDNDAMVHRLTGMA
FT                   GPAGLKSIRCSAEN"
FT                   /protein_id="YP_001585497.1"
FT   misc_feature    244958..>245284
FT                   /note="Uncharacterized membrane protein [Function unknown];
FT                   Region: SapB; COG1285"
FT                   /db_xref="CDD:31476"
FT                   /locus_tag="Bmul_5535"
FT   gene            245752..246177
FT                   /db_xref="GeneID:5770560"
FT                   /locus_tag="Bmul_5536"
FT   CDS_pept        245752..246177
FT                   /locus_tag="Bmul_5536"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bch:Bcen2424_6583 CBS domain containing protein"
FT                   /db_xref="GI:161522569"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:5770560"
FT                   /translation="MTIVADVMTRDAATIGPTQTLRDAAKLMDDLNVGALPVCDGTRLI
FT                   GMLTDRDIVVRAVSMGVPPDESIEGVVSGPANWCYEDDDIAEVQKKMEDAQIRRVPVVD
FT                   REKRLVGIVALGDLATSADGGMSSTLGAVSSPSRPER"
FT                   /protein_id="YP_001585498.1"
FT   misc_feature    245761..246105
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="Bmul_5536"
FT   misc_feature    245779..246114
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_9; cd04622"
FT                   /db_xref="CDD:73121"
FT                   /locus_tag="Bmul_5536"
FT   gene            246177..246512
FT                   /db_xref="GeneID:5770561"
FT                   /locus_tag="Bmul_5537"
FT   CDS_pept        246177..246512
FT                   /locus_tag="Bmul_5537"
FT                   /gene_family="HOG000268737" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6584 hypothetical protein"
FT                   /db_xref="GI:161522570"
FT                   /db_xref="GeneID:5770561"
FT                   /translation="MAAPRKARRTGSKRIDHRENVMDDQQNVKNGDREAQIRERAYRLW
FT                   QDAGSPDGNAEAYWLMAERQLDAEGGATAATEPPLEQSAKRRIPGEPLQEDDTALSDEL
FT                   AHDRRRI"
FT                   /protein_id="YP_001585499.1"
FT   misc_feature    246264..246383
FT                   /note="Protein of unknown function (DUF2934); Region:
FT                   DUF2934; pfam11154"
FT                   /db_xref="CDD:151597"
FT                   /locus_tag="Bmul_5537"
FT   gene            complement(247124..249406)
FT                   /db_xref="GeneID:5770556"
FT                   /locus_tag="Bmul_5538"
FT   CDS_pept        complement(247124..249406)
FT                   /locus_tag="Bmul_5538"
FT                   /gene_family="HOG000263164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; KEGG: bam:Bamb_6537
FT                   histidine kinase"
FT                   /db_xref="GI:161522571"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="GeneID:5770556"
FT                   /translation="MVSPLEPAPSGADHFVQFYDSVEQLLPEVVAFAGDALRSGGSAIV
FT                   IVRADRLADVVERLGALVAAIGEPARRRVFVSDAEALLARFMDGDMPDRDRFLRSVGAI
FT                   VEAAIAAGRPVHAFGEMVAVLCARGQPDAALRLEALWNELIERHRFSLYCGYPHDAFPG
FT                   AEQSTLFRHVCALHRRVLPAASLRNDERELHLTLALSQQRSRALGAEIRRREDAERQRN
FT                   GVLMHAPLPIALLAGPEHRIVLANHRFSAMCGRTDIVGRPLASVMPGADSPAVTRALDD
FT                   ARAHGVSTTIGEHRDRATPEGARVYRLHFNPQPQADGIGVIVSAVEVTEHVAAREKLQA
FT                   ANAERDRLLAELRDANHAKDQFLAVLGHELRNPLTPISLALELVRSREGHATPNEIAII
FT                   QRQLDHMVRLIDDLLDVSRITRGKIELKKEAVRIGDIVDRAVEVASPLLEQRRHRLHVD
FT                   IDADVRCHGDPVRLSQVVANLLTNAAKYTAPGGDIGLHVARSDGDTIVIEVRDSGAGIP
FT                   PDRLDSIFEPFFRLGGEPGRMDGGLGIGLALVKSFVMLHGGTVRADSAGPGLGSTFTVT
FT                   LPEYRPTALDADAREPEHRPAAVPVGTRRRVLLVDDNEDAAATLAQWLRDAGHDVAVVH
FT                   DPLSALGAFRSHEPDVAILDIGLPVMDGYELIRRLKAIETDKPCTFLALTGYGRIADRE
FT                   RCLEAGFRHHLVKPVDPAALHRAIDDSDPVHAPAPLAPAAPIAAVAPVPAASPVPPLPQ
FT                   VDGQPQL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585500.1"
FT   misc_feature    complement(247673..>248812)
FT                   /note="Osmosensitive K+ channel histidine kinase [Signal
FT                   transduction mechanisms]; Region: KdpD; COG2205"
FT                   /db_xref="CDD:32387"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(248153..248341)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(order(248168..248170,248180..248182,
FT                   248189..248191,248201..248203,248210..248212,
FT                   248267..248269,248276..248278,248288..248290,
FT                   248297..248299,248309..248311,248321..248323))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(248303..248305)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(247676..247993)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(order(247688..247690,247694..247699,
FT                   247715..247717,247721..247723,247769..247780,
FT                   247859..247864,247868..247870,247874..247876,
FT                   247880..247882,247952..247954,247961..247963,
FT                   247973..247975))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(247961..247963)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(order(247772..247774,247778..247780,
FT                   247862..247864,247868..247870))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(247253..247585)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(order(247283..247288,247295..247297,
FT                   247352..247354,247418..247420,247442..247444,
FT                   247571..247576))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(247442..247444)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(order(247418..247426,247430..247435))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5538"
FT   misc_feature    complement(247280..247288)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bmul_5538"
FT   gene            249815..250222
FT                   /db_xref="GeneID:5770557"
FT                   /locus_tag="Bmul_5539"
FT   CDS_pept        249815..250222
FT                   /locus_tag="Bmul_5539"
FT                   /gene_family="HOG000268748" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5891 hypothetical protein"
FT                   /db_xref="GI:161522572"
FT                   /db_xref="GeneID:5770557"
FT                   /translation="MVARHRCARVGMALACGHAAGRRRSGGDVPLQPHLPERTMTQSKQ
FT                   QQDHDTRGTRPGTQDEQPLQPAEPPHRPEAGRPPGHAPGGGELDEIPDADVGKVAPDDP
FT                   RETEVRDPANDKPWPEEHDGPDDAGDRPRPL"
FT                   /protein_id="YP_001585501.1"
FT   gene            250345..251346
FT                   /db_xref="GeneID:5770558"
FT                   /locus_tag="Bmul_5540"
FT   CDS_pept        250345..251346
FT                   /locus_tag="Bmul_5540"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bvi:Bcep1808_5892 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522573"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770558"
FT                   /translation="MSSDEISESRRKWMQGTTAGLVAGVAMPAVAQTGAPSAGDTAPRD
FT                   PRPLYPHAPFPAQHQPWPGLAGRMTPRPDHGERSYRGSGRLAGRKALITGGDSGIGRAV
FT                   AIAFAREGADVAIVYLPEEEPDAREVVQLIRSAGRTAVPLPVDIRSEAACNRLVEQAAT
FT                   ALGGLDILVNNAARQQSHPSILDISTEQFDWTLRTNLYAMFWITRAAIPRMPAGAAIVN
FT                   TTSVNAYDPSANLLDYAMTKAAIANFTKGLAKQMIERGIRVNGVAPGPFWTPLQVTGGQ
FT                   TEQNVEKFGEQVPMGRPGQPAEIASIYVELASAQASYVTGQIYGASGGAGQP"
FT                   /protein_id="YP_001585502.1"
FT   sig_peptide     250345..250440
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.963 at
FT                   residue 32"
FT                   /locus_tag="Bmul_5540"
FT                   /product="hypothetical protein"
FT   misc_feature    250465..251343
FT                   /note="oxidoreductase; Provisional; Region: PRK06128"
FT                   /db_xref="CDD:180413"
FT                   /locus_tag="Bmul_5540"
FT   misc_feature    250591..251337
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5540"
FT   gene            251518..257442
FT                   /db_xref="GeneID:5770334"
FT                   /locus_tag="Bmul_5541"
FT   CDS_pept        251518..257442
FT                   /locus_tag="Bmul_5541"
FT                   /gene_family="HOG000266604" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ABC, A subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_5972 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="GI:161522574"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="GeneID:5770334"
FT                   /translation="MSSSHLIRIRGARQHNLKNLDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVDRVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRKTARPVRHDTPETIHADLLARTAEHDPRLAITFPVELPD
FT                   SVTDEEVEQWLSASGYTRVQAQREVASPTGPRKVLDVVADRFRLHQVEKARAVEAIEAS
FT                   LKRGGGRVNVYVLAQAPEGDGAVAREPEVWRFSTGLHDPESDLRYAEPQAALFSFNSAY
FT                   GACETCRGFGRVIGVDLGLVIPDARKTLRGGAIKPMQTPAWKECQDDLMRYAAKAGIRR
FT                   DVPWSELTPAEQDWVINGSPDWTGSWQSQWYGVRRFFGYLESKAYKMHIRVLLSKYRSY
FT                   TPCETCGGARLKTESLLWRLGSKENADAVLAPADRFMPHGVDWSRAQLEALSGLTVHDL
FT                   MLLPIDRIRRFFDTLTLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSG
FT                   GEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLNRIVEAMQRLRDAGNTLVVVEHDP
FT                   SVMLAADRLIDMGPGPGERGGTIVYDGTPADVRGAATLTGEYLGGRRQVAHASHWARRP
FT                   VDAQTPRIVLEGAREHNLRDVTVEIPLQRLVCVTGVSGSGKSTLIQDVLYPAIARQLGR
FT                   PTESPGAYRALSGAEQIGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQR
FT                   GYGAGTFSFNSGDGRCPTCGGSGFEHVEMQFLSDVYLRCPDCDGRRYRAEVLEVRIARD
FT                   GRALNIADVLDLTVSEAAAFFAGDADVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRL
FT                   KLAGFLAESAAAGNGRRVVTQEARVARSRLFMFDEPTTGLHFDDIAKLMQAFGKLLAAG
FT                   HSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAGSHTGAALRDYER
FT                   AMDASAAERADEGVPLQAALNAARARRAIEGEDVVRIVNAREHNLKALDVDIPHGKFNV
FT                   ITGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQ
FT                   RLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCVHDGTPVASQSVESIAAQLLREHRGQ
FT                   HVGLLAPLVVNRKGLYTDLAKWAKARGHTHLRVDGEFVPVDPWPKLDRFREHTIELPVA
FT                   DLVVSPDDEAELRQRLDETLEIGKGVMHLLVPLDDLHHAIANGHSTARVGDVKVLSVKR
FT                   ACPVCGTSYPELDPRLFSYNSKHGWCTTCVGTGLALTREQRAAYDDTVFAEDGRGREQT
FT                   LPSDEQEPEGVGEEPCADCGGTRLNPTARAVTFDGHPIVEVAQWTVSDTRRWIDGLRLV
FT                   GRDAQIARDIVSEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQGV
FT                   CYVLDEPTIGLHPRDNQILLNALRQLGDKGNTLVVVEHDEDTIRRADHIIDIGPGAGKR
FT                   GGTLVAQGKVADLAAQSSSLTGRLLAQPMVHPLQPRRRVVAPGRRNAEAVPGHWLTVHR
FT                   ANLHNLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPAVRRAR
FT                   KSAAQDAPAANRRASVLARSAPRPALNVAHVWQGCESIDGWQHIDRVLEVDQTPIGKTP
FT                   RSCPATYIGVWDAIRRLFADTLEARARGYTASRFSFNTGDGRCPACEGQGVRTIGMSFL
FT                   PDVKVPCDVCHGQRFNPETLAVTWRGRNIGEVLTMEIDEAVEFFASITTIAHPLQLMKD
FT                   VGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDITRRGQKAPHTLYVLDEPTVGLHM
FT                   ADVAKLIRVLHRLVDGGHSVVVIEHDLDVIAEADWIIDLGPEGGVGGGTIVAAAPPEAL
FT                   VEVAASHTGRALAPVLAREHGQGQRHDESREVERADEAGGD"
FT                   /protein_id="YP_001585503.1"
FT   misc_feature    251521..254487
FT                   /note="Excinuclease ATPase subunit [DNA replication,
FT                   recombination, and repair]; Region: UvrA; COG0178"
FT                   /db_xref="CDD:30527"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    251536..>251871
FT                   /note="The excision repair protein UvrA domain I;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_I; cd03270"
FT                   /db_xref="CDD:73029"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    <252988..253326
FT                   /note="The excision repair protein UvrA domain I;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_I; cd03270"
FT                   /db_xref="CDD:73029"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    253444..254370
FT                   /note="The excision repair protein UvrA domain II;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_II; cd03271"
FT                   /db_xref="CDD:73030"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    254587..>255468
FT                   /note="excinuclease ABC, A subunit; Region: uvra;
FT                   TIGR00630"
FT                   /db_xref="CDD:161968"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    254587..>254928
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    254668..254691
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    order(254677..254682,254686..254694,254836..254838)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    254827..254838
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    255505..256101
FT                   /note="The excision repair protein UvrA domain I;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_I; cd03270"
FT                   /db_xref="CDD:73029"
FT                   /locus_tag="Bmul_5541"
FT   misc_feature    256240..257256
FT                   /note="The excision repair protein UvrA domain II;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_II; cd03271"
FT                   /db_xref="CDD:73030"
FT                   /locus_tag="Bmul_5541"
FT   gene            complement(258560..258712)
FT                   /db_xref="GeneID:5770335"
FT                   /locus_tag="Bmul_5542"
FT   CDS_pept        complement(258560..258712)
FT                   /locus_tag="Bmul_5542"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522575"
FT                   /db_xref="GeneID:5770335"
FT                   /translation="MRARRRPGLLTDLAEIEWQVALPGDRLTARETEVCAIVAATVVPL
FT                   IPRSA"
FT                   /protein_id="YP_001585504.1"
FT   gene            258900..259034
FT                   /db_xref="GeneID:5770336"
FT                   /locus_tag="Bmul_5543"
FT   CDS_pept        258900..259034
FT                   /locus_tag="Bmul_5543"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5676 hypothetical protein"
FT                   /db_xref="GI:161522576"
FT                   /db_xref="GeneID:5770336"
FT                   /translation="MYAASSKADFADCLIERSGYAANCEYTDTFDVAAALVAGMQLIK"
FT                   /protein_id="YP_001585505.1"
FT   gene            complement(259222..259860)
FT                   /db_xref="GeneID:5770668"
FT                   /locus_tag="Bmul_5544"
FT   CDS_pept        complement(259222..259860)
FT                   /locus_tag="Bmul_5544"
FT                   /gene_family="HOG000263265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7055 hypothetical protein"
FT                   /db_xref="GI:161522577"
FT                   /db_xref="GeneID:5770668"
FT                   /translation="MTHFDSCNGSAIEASDICRDRLAAIERHEDLRRAGSPPIVLGEFY
FT                   RKQLDRELWPSQAKLAADLNMSKPLVTRSIQASLLPPEVVAAFGGPYHISYRTAGLAMR
FT                   LINSVGRAVVVQRALTVPNTTPSAKKVISILATGVVQTDDAAKLRISLGANGKHLIIDG
FT                   PHIDRVIPHLALVQRLLNVMLPSVLPPCADGILLAGDRGLTGKRLRRER"
FT                   /protein_id="YP_001585506.1"
FT   gene            260262..260978
FT                   /db_xref="GeneID:5770669"
FT                   /locus_tag="Bmul_5545"
FT   CDS_pept        260262..260978
FT                   /locus_tag="Bmul_5545"
FT                   /gene_family="HOG000263266" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7056 hypothetical protein"
FT                   /db_xref="GI:161522578"
FT                   /db_xref="GeneID:5770669"
FT                   /translation="MRFPRLFPRSKKQVALSAAPGHYSNDDPEKIIFDQGTRLRVEANH
FT                   WKTFCFILAIIAGGAVYTRQPPPSVVRSYGVSSDAGGNPLVKQLAAYNPDDQAKRTAIK
FT                   QDVEHWFTIEPVLTDDIRTSRLAKNINAVKAKMIGNAKNQFASWISDDKPFDQITTNPK
FT                   LVREPKVTNVSLLEDSTVVVEFTTSTRQSPADKPVEVRFALTMRYQIIPPTAEDVLGTN
FT                   PYGLYYPFFTLQKTGA"
FT                   /protein_id="YP_001585507.1"
FT   misc_feature    260358..260966
FT                   /note="VirB8 protein; Region: VirB8; cl01500"
FT                   /db_xref="CDD:186438"
FT                   /locus_tag="Bmul_5545"
FT   gene            260975..261850
FT                   /db_xref="GeneID:5770670"
FT                   /locus_tag="Bmul_5546"
FT   CDS_pept        260975..261850
FT                   /locus_tag="Bmul_5546"
FT                   /gene_family="HOG000263267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbG/VirB9/CagX"
FT                   /transl_table="11"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: bvi:Bcep1808_7057 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="GI:161522579"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="GeneID:5770670"
FT                   /translation="MKRTRSLLGWGALAVIAASANAFAAKSAANPIAPVPNFDVGSIIG
FT                   DAMSPVNPYNSGADPITMPGDARMAVFTYSRDKIFRVMTAPLKLTTIELERGETLVSEP
FT                   AMGDSVQWVLDTDGANHVYVKPTKPGLVNTLHLSTNRREYELTLVSSPLGGLFYQNVRF
FT                   SYANSLMAKVRARGNATGEEHDTDQGAPSDSGPIGVSPDKLNFEYTVSGTNSLKPETVF
FT                   DDGTFIWIRMPPRTPFAVPTIKDGGDVVSPNFIRRGPYIVIQRLADEVKLTRPGEEVTI
FT                   TRGRRGLFGF"
FT                   /protein_id="YP_001585508.1"
FT   sig_peptide     260975..261049
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 25"
FT                   /locus_tag="Bmul_5546"
FT                   /product="hypothetical protein"
FT   misc_feature    <261218..>261673
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cl11423"
FT                   /db_xref="CDD:187032"
FT                   /locus_tag="Bmul_5546"
FT   misc_feature    261575..261829
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cd06911"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bmul_5546"
FT   misc_feature    order(261590..261610,261623..261640,261785..261787,
FT                   261800..261820)
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bmul_5546"
FT   gene            261858..263132
FT                   /db_xref="GeneID:5770592"
FT                   /locus_tag="Bmul_5547"
FT   CDS_pept        261858..263132
FT                   /locus_tag="Bmul_5547"
FT                   /gene_family="HOG000263269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugation TrbI family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   bvi:Bcep1808_7058 conjugation TrbI family protein"
FT                   /db_xref="GI:161522580"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="GeneID:5770592"
FT                   /translation="MAKNTDPTSSEEKALFKGKVPRNVMIAVGAIAAVAIGALGFYTQT
FT                   QQANKAEEEALKAKRERAAEAVDKSNGNKADVDKIIEEQQAQARRRAAEAAAAASAAAA
FT                   ANVKKPALSADAVLPTGNTTEIKASNDQDSIFVSPIFRAGIKIKEGQAQQPEGPPGIVT
FT                   PQQMLLQQAAARDAAMKDSIAQAAMAARGAQGTSPMTSQQRDSAFMHDVAQLSEGDKDF
FT                   ARAGFVGQSHGCTLSPPAKIPVLSNEALNSDRPGTASLTVETDVYANNGDGRCLVIPWG
FT                   TTIVAPYSADIQPGQESILVAGAEMRLPNGKHVPLYGAQGADGNGAAGFSGHVNNHFLR
FT                   IYSTSFLTAILVRAFSNSDQSTTTGPLGVTQAGSTAGQIAAQTAQSVLDRYKNIPPTIT
FT                   SSPGERHFMLKVNRDMVLEEYRGAR"
FT                   /protein_id="YP_001585509.1"
FT   misc_feature    262557..263108
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Bmul_5547"
FT   gene            263129..263935
FT                   /db_xref="GeneID:5770593"
FT                   /locus_tag="Bmul_5548"
FT   CDS_pept        263129..263935
FT                   /locus_tag="Bmul_5548"
FT                   /gene_family="HOG000263270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bvi:Bcep1808_7059 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:161522581"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:5770593"
FT                   /translation="MIARAAFALAFALAASYAQSAVIAQVISPVSVVIQDGQSRRVAML
FT                   PGKPVYYCGLDAFIEWASPLVGQPVRSSRETGITVSIDGRDVALDDLFIDRGWLQPPVL
FT                   DDGAQAALVERRGGWACSRAVVPFELLHTNVDPKILAGIALNESNYRGRAWPWTLNVAG
FT                   QGYFFKSREEAYKAIESLLARDRCDFDVGLMQVNWCYHGKRFRSAWDALAPATNVAVAE
FT                   AILTENFARTDSVAKAVAYYHSANPNPGRAYLARFVQHLSMIEAGL"
FT                   /protein_id="YP_001585510.1"
FT   sig_peptide     263129..263191
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 21"
FT                   /locus_tag="Bmul_5548"
FT                   /product="hypothetical protein"
FT   misc_feature    263531..>263884
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:185840"
FT                   /locus_tag="Bmul_5548"
FT   gene            263932..265200
FT                   /db_xref="GeneID:5770594"
FT                   /locus_tag="Bmul_5549"
FT   CDS_pept        263932..265200
FT                   /locus_tag="Bmul_5549"
FT                   /gene_family="HOG000263271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7060 hypothetical protein"
FT                   /db_xref="GI:161522582"
FT                   /db_xref="GeneID:5770594"
FT                   /translation="MKHTIKFLACATSAIVCATASAANTDPFDFDYDILGGISERPALI
FT                   FNDGEKTYIQPRAGQVIVAEGGNTEGPYVVVEGTPSSITYKVGAHSATARWKKANTFIG
FT                   AAAGGTAAMKDDQPAGFDGFTNRLVMIGTRPALEPVRRLHASMTVGGFVKALVPQGWTG
FT                   SAQKDVDLTTPENFATRDGENWMQALDRLMTQAGLYADVDFTARHVRLHRDAPKSAALN
FT                   YASTSRDADEAGLNRVVARVTAEAPPVSRLAERFGAQAIRDSDDSHMQIRFTSKPAKTV
FT                   TFKTPDGKELRTSWDESKSVMTIDRAERFIVADATNRVEVTRDAKTVYDFDQPNAAKLE
FT                   AVFDRDGRTYFKFAGSVVRVGVTDTRNLGIGEQKGRYFMFEGTSDMFTVTADGNTIHVK
FT                   RRKEVVYREVPDAPLQASGGPTP"
FT                   /protein_id="YP_001585511.1"
FT   sig_peptide     263932..264000
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 23"
FT                   /locus_tag="Bmul_5549"
FT                   /product="hypothetical protein"
FT   misc_feature    264004..264195
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cl11423"
FT                   /db_xref="CDD:187032"
FT                   /locus_tag="Bmul_5549"
FT   misc_feature    order(264019..264039,264052..264069,264181..264183)
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bmul_5549"
FT   gene            265197..265622
FT                   /db_xref="GeneID:5770583"
FT                   /locus_tag="Bmul_5550"
FT   CDS_pept        265197..265622
FT                   /locus_tag="Bmul_5550"
FT                   /gene_family="HOG000222008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bvi:Bcep1808_7061 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:161522583"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:5770583"
FT                   /translation="MIRIAPIVAAVLAFIALPSRADCLDDAAAFHRVNPRLLRVIAQHE
FT                   SGMRPNAVNRNSNGSEDIGLMQINTSWLPTLARYGIRREHLFNGCVSAYVGAWILASNV
FT                   RRFGPNWKAVGAYNAVTPSKQLVYASAIYRRFMQQGR"
FT                   /protein_id="YP_001585512.1"
FT   sig_peptide     265197..265262
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.982 at
FT                   residue 22"
FT                   /locus_tag="Bmul_5550"
FT                   /product="hypothetical protein"
FT   misc_feature    265299..>265553
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bmul_5550"
FT   misc_feature    order(265329..265331,265401..265403,265491..265493,
FT                   265545..265547)
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bmul_5550"
FT   misc_feature    265329..265331
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bmul_5550"
FT   gene            265625..266176
FT                   /db_xref="GeneID:5770584"
FT                   /locus_tag="Bmul_5551"
FT   CDS_pept        265625..266176
FT                   /locus_tag="Bmul_5551"
FT                   /gene_family="HOG000263272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7062 hypothetical protein"
FT                   /db_xref="GI:161522584"
FT                   /db_xref="GeneID:5770584"
FT                   /translation="MHKIHSNQARIRALVAGGLAVLHLAAHAAVDPVTNSIDADGWQVL
FT                   ASAPKAQPATAESPKPNQALLPPAPTSATAAPSADVAAVVLPGAGAAAASGTLTFSVTP
FT                   ADVNLRDALDRWLQQQGWQLAWKIDDDLPLEFNASFTGDFTSVLQQVMKATNHMRTPTR
FT                   ACRHTNNVIRVIARAGNCQD"
FT                   /protein_id="YP_001585513.1"
FT   sig_peptide     265625..265711
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT                   /locus_tag="Bmul_5551"
FT                   /product="hypothetical protein"
FT   gene            266182..267786
FT                   /db_xref="GeneID:5770585"
FT                   /locus_tag="Bmul_5552"
FT   CDS_pept        266182..267786
FT                   /locus_tag="Bmul_5552"
FT                   /gene_family="HOG000263273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretory pathway component PulD-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7063 type II secretory pathway
FT                   component PulD-like protein"
FT                   /db_xref="GI:161522585"
FT                   /db_xref="GeneID:5770585"
FT                   /translation="MRVHLLKSGVAIAAALMAAGCAVTQQDVNDSYDAAHRTISDALGK
FT                   GPAPMALVEDVPTAFLGDRLVPLAYEATLPAVFRDKTVTLPANLGIKQIATLISTATGY
FT                   PVHLSPDVFVPRDSLVPGQTESKGQINAARTEEPVYRQAFSGKAGMYMRNMTTDLGLDW
FT                   SFDGSTINVNRFVTRMYQIAAIPGKVSIKSTMSKGMDTSTGNQSGNGGGGSSGGNTGSF
FT                   SAQTSTGREGDFDQIAAITAEIEKLKSPMGRVSVNPQSRLVMVYDTKEAADNIGKLLKH
FT                   ENAISTRQVAITVRTLQIALNKGSQAGVNADVVFNAMHAGLARYAISFTSPTSLATGGG
FT                   AVGVSVLRPDAPFSGTNAVVNALNQYGRTVQDNTMTKMTLNGLPVSVASFKSDDYLRST
FT                   TPSSGSLTATSGGVPGLTPGTITTGDFVNVLPAVNDHNQIVLAYWADSSKLNGPFTSAG
FT                   AGSGQTQQQIQLAHTVGTKDDQTIALSDGQTVVLYGAITDQADSTTNTGIAGLTGSWNK
FT                   SKTFQVIMLKATVVPSM"
FT                   /protein_id="YP_001585514.1"
FT   sig_peptide     266182..266256
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.540 at
FT                   residue 25"
FT                   /locus_tag="Bmul_5552"
FT                   /product="hypothetical protein"
FT   misc_feature    266371..267774
FT                   /note="type IVB pilus formation outer membrane protein, R64
FT                   PilN family; Region: pilus_B_mal_scr; TIGR02520"
FT                   /db_xref="CDD:162902"
FT                   /locus_tag="Bmul_5552"
FT   misc_feature    266941..267774
FT                   /note="Bacterial type II and III secretion system protein;
FT                   Region: Secretin; cl02829"
FT                   /db_xref="CDD:164025"
FT                   /locus_tag="Bmul_5552"
FT   gene            267791..269119
FT                   /db_xref="GeneID:5771024"
FT                   /locus_tag="Bmul_5553"
FT   CDS_pept        267791..269119
FT                   /locus_tag="Bmul_5553"
FT                   /gene_family="HOG000263274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7064 hypothetical protein"
FT                   /db_xref="GI:161522586"
FT                   /db_xref="GeneID:5771024"
FT                   /translation="MMHITEPLPTDKRARLVFGIDWRAYPVKGGSAERRRYTDAFNATH
FT                   FVEFKVGTELIGGFAEPDMSEIKGARLFSGAARVAQHERIKNRSAALVLLQDGPRVYFV
FT                   FVVRGAVRSDEVLTLEQAQSRRLEIEQACLKSNLSLDTLGTGDRIGGVDEAFQASELLA
FT                   NRKVGLLRRPPISLPTAIPVLAIVVGAFFGVPKIADMLSPPPPPARPPTFAEQYAVAVR
FT                   DVFARMQPRASELAPALLTAVGAKESVRKGWLFQEANCPSSGFCTMTFRRNGGTFAAFD
FT                   EAATADMRPLSFARDGRTLTSRGPAVPKAAPLMESESKSWPSEQAFIDMLQTPPQRMSV
FT                   QPLELRAYGYTVNLGEARPLVTTPGAVDGAQVGRMLKQGDWTIEGFRWQSPLLAKLPPN
FT                   MALESLKVELRLNEGAPANADKETGDSPYGVHFTAKGKYYVFN"
FT                   /protein_id="YP_001585515.1"
FT   gene            269106..269687
FT                   /db_xref="GeneID:5771025"
FT                   /locus_tag="Bmul_5554"
FT   CDS_pept        269106..269687
FT                   /locus_tag="Bmul_5554"
FT                   /gene_family="HOG000263275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7065 hypothetical protein"
FT                   /db_xref="GI:161522587"
FT                   /db_xref="GeneID:5771025"
FT                   /translation="MSSIKHALIAAGVGFAVSAHAEPVGAKLSIDDIDQLARASVVRSL
FT                   GGAATAPGMLPPGAMTQPQPGIAASGVTAEVPPKPVEKPIRPPRAHAESVAFLGAFNDE
FT                   AGAHVLYSYRDAIYPARVGSTLLNGWNVKGVDGYAVTVAEGKRIWKEPIRGVAPIQMSP
FT                   ATAAVRSLVDLNSPLPSGVPLPGISLGGTQ"
FT                   /protein_id="YP_001585516.1"
FT   sig_peptide     269106..269171
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT                   /locus_tag="Bmul_5554"
FT                   /product="hypothetical protein"
FT   gene            269684..271996
FT                   /db_xref="GeneID:5771026"
FT                   /locus_tag="Bmul_5555"
FT   CDS_pept        269684..271996
FT                   /locus_tag="Bmul_5555"
FT                   /gene_family="HOG000263276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bvi:Bcep1808_7066 type II secretion system protein E"
FT                   /db_xref="GI:161522588"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:5771026"
FT                   /translation="MSFFAELETPEPAKRGLLGRLKAFTAGFTDSASSAMPIVGREPTD
FT                   TGDPAVSAEPNGGREPRFKSASKPVNPRQGDHGQPMTMGMRLRRAQEEAEDVAIIGEAR
FT                   NGEWPAKAEIDVAVALAQQEPDDGRASAKSSAAVPMAAVGENISATPAHVADVPADPAT
FT                   ESPQERAGVAEPPAPAQATTTPSVDAASQWTSGYDVPPTVRRIGMDVTETSEIAIEGGR
FT                   PRLVHADSLSFKRVLCQRDEHAALAVTEAARREFIAVELQAGISIVVATQRFHESQLYA
FT                   TYLKDLARADISVHEEMVADEEVIASLYGKEKQRAASVVPESSRAIGLFRDVIEAAHAY
FT                   DASDVHWEYRDFSDNVALRLRVDGEMYSYRELPKPMVRKALSASYQDLVQRNTNSGESF
FT                   QMTAPQSAMIPLVAHTDIINIRWQSAPLVGGFDVALRLLDGNFSRVRVLMPHEMGLEKS
FT                   QIEILESLGKVTGGATFLTGETGSAKTTLLRAMSYLVPNRDRIKQFAVNEPSEVPAPWL
FT                   SDISIQRRTNESEEDANRKIVEVVRTLMRMDPDDLTIGEVRDSVLAGLVAELALTGHPV
FT                   RTTLHGNSILGAVMRLVGGRLKLPMDEVASGSFLNAVGNQKLIPKLCPHCKRPARDVLS
FT                   ATQVATLERKFALDTSMMACRDENGCAHCRRPGLFTRDGKVAAGIKGQTLAMELYRPTP
FT                   EFLACVAARDWRGAEHVWRTSRKTDFANADMTGKTVYEHALYKASQGLIDPRFIDESMC
FT                   AFEAYRLFPDAHGGSPS"
FT                   /protein_id="YP_001585517.1"
FT   misc_feature    270392..271909
FT                   /note="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB [Cell motility and secretion
FT                   / Intracellular trafficking and secretion]; Region: PulE;
FT                   COG2804"
FT                   /db_xref="CDD:32635"
FT                   /locus_tag="Bmul_5555"
FT   misc_feature    270893..271699
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5555"
FT   misc_feature    order(271115..271120,271130..271138)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bmul_5555"
FT   misc_feature    order(271118..271120,271130..271138,271196..271198,
FT                   271202..271207,271346..271351)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bmul_5555"
FT   misc_feature    271334..271348
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bmul_5555"
FT   gene            271993..273126
FT                   /db_xref="GeneID:5770665"
FT                   /locus_tag="Bmul_5556"
FT   CDS_pept        271993..273126
FT                   /locus_tag="Bmul_5556"
FT                   /gene_family="HOG000263277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bvi:Bcep1808_7067 hypothetical protein"
FT                   /db_xref="GI:161522589"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:5770665"
FT                   /translation="MIKSIVYTLFRVLPLKERLRVSTWRFKAMREMFYRETRLDVAKKG
FT                   LRNSETLLERLDTLAERHRKRKNMSWLAFQKIAQRMRAGDDFATAMKPFIPNDEFVLLE
FT                   LASESPRDDAAIRGLELAEMAAHAKGVLSATTSMQMAYPAFLIVYLYAFCVLFGSEILP
FT                   ATLDVQPLEKWSAFGRFVYAFDTFCADYWWLTSSVVAGLILGYFQTLKRWTGKFRNKVD
FT                   AMPLMWRNRRDLRAALLIVSLAGLFDSGLTLRAALDRLMKMSDPWMRWHLRRMSTRLTA
FT                   NPDKPMQALDTGIFSETTIDIMTDAAGRDQFVESIKELGQHSLSRVVDAVKRNAKITHY
FT                   VLLGGAVLLFLVFGLGSYFATGAVAFDGVSTSLNQKF"
FT                   /protein_id="YP_001585518.1"
FT   misc_feature    272143..>272766
FT                   /note="Type II secretory pathway, component PulF [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: PulF; COG1459"
FT                   /db_xref="CDD:31648"
FT                   /locus_tag="Bmul_5556"
FT   gene            273138..273731
FT                   /db_xref="GeneID:5770666"
FT                   /locus_tag="Bmul_5557"
FT   CDS_pept        273138..273731
FT                   /locus_tag="Bmul_5557"
FT                   /gene_family="HOG000263278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7068 hypothetical protein"
FT                   /db_xref="GI:161522590"
FT                   /db_xref="GeneID:5770666"
FT                   /translation="MKKFNQMNKTKRLYVGKGRRRQKGELSLVEAAGVMAAAALIALVV
FT                   YMGRGYVMDRIHAMQFKSEAQYFVSGIQDATAGEIDFSSVTMLSLTQNRAFDTAGRRLN
FT                   KSTGALTGIFGGAVTAAPATVTATNDAIAVTYPIPAKVCALSADSISQAYTQVKVNNTT
FT                   ISGPSTTFDSGTAAAACASAGGTASVIMYATKGN"
FT                   /protein_id="YP_001585519.1"
FT   gene            273741..274943
FT                   /db_xref="GeneID:5770667"
FT                   /locus_tag="Bmul_5558"
FT   CDS_pept        273741..274943
FT                   /locus_tag="Bmul_5558"
FT                   /gene_family="HOG000263279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7069 hypothetical protein"
FT                   /db_xref="GI:161522591"
FT                   /db_xref="GeneID:5770667"
FT                   /translation="MLSIIEAVIVLVATALMTLQGIQHDVETRRRDVLSVEGKNQAVIN
FT                   AALSKWVTDKYALLVAQMVGSKATAVTPPTLADLRAGGYLKADYATGPIWGGTYMIQMS
FT                   VGPDNCSTGSGSCQVSYVFYSSQPVTRLGKPDVSGAGVVAQAAGNDFGFSTSQNPVTIK
FT                   GLSGRWQAVNPVPGAPAAVVMATNGPSSDGNSVFIRRDGSLKWTGSQDVNGVDLHNVGN
FT                   IDATGTIGAPTLAASNVAVSNAVRSPGTLLVQNAAGTAPAPISTGDSTVNGQLQVTQTI
FT                   TPGAIATPRAWCPVNGAMAQNSDGRGQLLSCQDHAWLPIGGPALRQGYFMVQNGWGVPA
FT                   PNCATGGTPQIVFSPVTFYVNPTATVNVSASGSGPWTVFITDGNGNGITGTAVVETYCS
FT                   Y"
FT                   /protein_id="YP_001585520.1"
FT   gene            275093..275746
FT                   /db_xref="GeneID:5770577"
FT                   /locus_tag="Bmul_5559"
FT   CDS_pept        275093..275746
FT                   /locus_tag="Bmul_5559"
FT                   /gene_family="HOG000023999" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7070 hypothetical protein"
FT                   /db_xref="GI:161522592"
FT                   /db_xref="GeneID:5770577"
FT                   /translation="MRQACAPIPCTSGYQDSTCAAPLRNGAIPQPQCQTGAGWVTVSSA
FT                   VWQGSRWSDPQCSYSAQPQCPAGFDTSVPSSWTGSGWTQPECVKFTPPPPVVIDPDVAC
FT                   TAAASSHKLSAFDMQVFNSIEQTLTRDAPFQQKTQWRDWSTLPGVNPDWPYGIAGYKGD
FT                   KVFTGTWTGPWYNKQLACTQQNSWATYCYVNPSNGAVDFLWVNTAGAGNGQCNH"
FT                   /protein_id="YP_001585521.1"
FT   gene            275834..276358
FT                   /db_xref="GeneID:5770578"
FT                   /locus_tag="Bmul_5560"
FT   CDS_pept        275834..276358
FT                   /locus_tag="Bmul_5560"
FT                   /gene_family="HOG000266651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HMG-I and HMG-Y DNA-binding domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: HMG-I and HMG-Y DNA-binding domain protein;
FT                   KEGG: bam:Bamb_6206 HMG-I and HMG-Y, DNA-binding domain
FT                   protein"
FT                   /db_xref="GI:161522593"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="GeneID:5770578"
FT                   /translation="MTKYDEQFKQRVVSAYLRGDSGFDALAARHGIHSGMLQRWVAAYR
FT                   AHGRAGLQSKYSSYDARFKLRVLQHMQRDELSLREVSALYDIRDAGSVARWARLYDEGG
FT                   INALTPRPRGRPRKMVTSLPPKPTEAGTPDERSREELLKENEYLRAEVAYLKKLDALLA
FT                   KKQAAQKKKRK"
FT                   /protein_id="YP_001585522.1"
FT   misc_feature    275834..276157
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG2963"
FT                   /db_xref="CDD:32783"
FT                   /locus_tag="Bmul_5560"
FT   gene            276358..277194
FT                   /db_xref="GeneID:5770579"
FT                   /locus_tag="Bmul_5561"
FT   CDS_pept        276358..277194
FT                   /locus_tag="Bmul_5561"
FT                   /gene_family="HOG000023133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bam:Bamb_2714 integrase, catalytic region"
FT                   /db_xref="GI:161522594"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="GeneID:5770579"
FT                   /translation="MRELRQHHPVAALLKVAGLARSTFYYQLGTLNADDRHADLKAKIR
FT                   TVFEHHKGRYGYRRVTAAIRQAGYLVNHKAVQRLMQQLQLKSLVRPKKYRSWRGEIGQA
FT                   APNLLQRQFSATQANQKWVTDVTEFNVGGQKLYLSPVMDLYNGEIVAYQMDQRPSFELV
FT                   SGMLKKALAKLRRKDKPLLHSDQGWQYRMPAYRRELKKRKLTQSMSRKGNCLDNAAMES
FT                   FFGTLKSECYNGHCFTCVEQLRDTLDHYIHYYNHERIKLKLKGLSPVQYRTQPLGA"
FT                   /protein_id="YP_001585523.1"
FT   misc_feature    276409..277167
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:177368"
FT                   /locus_tag="Bmul_5561"
FT   misc_feature    276700..277050
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5561"
FT   gene            complement(277261..278283)
FT                   /db_xref="GeneID:5770707"
FT                   /locus_tag="Bmul_5562"
FT   CDS_pept        complement(277261..278283)
FT                   /locus_tag="Bmul_5562"
FT                   /gene_family="HOG000263280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SCP-like extracellular"
FT                   /transl_table="11"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   bvi:Bcep1808_7071 allergen V5/TPX-1 related"
FT                   /db_xref="GI:161522595"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="GeneID:5770707"
FT                   /translation="MQKITTTTVSALAAAAVLALAACGGGGDGGSTNTGSTGNNPNPPN
FT                   PGNASATVPGTVEIPQYAAGSAQLAALTLLNQYRSQCGFPALKQNTVLDQAAQNHAKYI
FT                   GENNAVTDTEVPGNAGYTGATYIDRAVAAGFPGGVIGIGASGANAVFTNNFNATVAGQQ
FT                   FVGSLLGGAYHAVVATFPVDLVGFGESETQTTSGSYTFTESWQSISMYAAKPQALQGGP
FT                   KTFPCDGVTGVPYRGIGEVPTPPNVSSSGWGTPITVMGNLTDVINMQSASVTGPSGTVD
FT                   VQILNSDSDPNKLLGKYQAVAYPTSPLQPNTTYSVTINGTVNGAAFSRTFSFATANTAG
FT                   "
FT                   /protein_id="YP_001585524.1"
FT   sig_peptide     complement(278209..278283)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.644 at
FT                   residue 25"
FT                   /locus_tag="Bmul_5562"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<277861..278082)
FT                   /note="SCP_bacterial: SCP-like extracellular protein
FT                   domain, as found in bacteria and archaea. The wider family
FT                   of SCP containing proteins includes plant
FT                   pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
FT                   cysteine-rich secretory proteins, and allergen 5...;
FT                   Region: SCP_bacterial; cd05379"
FT                   /db_xref="CDD:88558"
FT                   /locus_tag="Bmul_5562"
FT   gene            complement(278508..278873)
FT                   /db_xref="GeneID:5770708"
FT                   /locus_tag="Bmul_5563"
FT   CDS_pept        complement(278508..278873)
FT                   /locus_tag="Bmul_5563"
FT                   /gene_family="HOG000263281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7072 hypothetical protein"
FT                   /db_xref="GI:161522596"
FT                   /db_xref="GeneID:5770708"
FT                   /translation="MDDLAYLVADSSAAWLDGRGDGRFERYERFYRSEREKLADAFELE
FT                   QVNEAYATWIGSQPSRVLGALSRPWFGKVLVALTCMYVGAQVVPAVSTAIPYKSTVLLG
FT                   VAFVGLRIFHRKRRRAR"
FT                   /protein_id="YP_001585525.1"
FT   gene            complement(278881..279075)
FT                   /db_xref="GeneID:5770709"
FT                   /locus_tag="Bmul_5564"
FT   CDS_pept        complement(278881..279075)
FT                   /locus_tag="Bmul_5564"
FT                   /gene_family="HOG000024000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522597"
FT                   /db_xref="GeneID:5770709"
FT                   /translation="MTHSNDRSVNALPDLPASLIVINADYRPQFAWYDVETEQYYSEAD
FT                   GKVIVDVRAAMPWAALYVH"
FT                   /protein_id="YP_001585526.1"
FT   gene            complement(279059..280264)
FT                   /db_xref="GeneID:5770478"
FT                   /locus_tag="Bmul_5565"
FT   CDS_pept        complement(279059..280264)
FT                   /locus_tag="Bmul_5565"
FT                   /gene_family="HOG000263282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7073 hypothetical protein"
FT                   /db_xref="GI:161522598"
FT                   /db_xref="GeneID:5770478"
FT                   /translation="MEKKNSRETYRSIERLYVPDWLADRIRETNFDLVDQMRWLLEMDG
FT                   AFNDILAVERKEIDHVKHNEASLRNLLRAPFLMVAPTLESVEDWRCFVDDTATTVAVDR
FT                   LIRKLPPLDALAKMSVEHHNRVFLDLVTSVIHISVLAAPLLGITTEVASYLVSVPTYKL
FT                   RIALGKMNGLPLFRWRFNSPTFWYQFTASNLTDEMVAHQIMATSPIRMNSAPGKAGWSE
FT                   LRLPRDRNETYASALMAYGCRASTAASLFRLNQNAMRQRFFEMHGTSSPCGNTPNSLSW
FT                   FVETPTNRLHGTIFTWLYRAALAAGANAPQALIATNDVYQQIFGGQHAISVDRGCNLTR
FT                   AMAADNRLTIAPCRSCRTEYLVSNNETKIEMHHSFDCPACTGQLGPKRRGTKARARNDA
FT                   QQ"
FT                   /protein_id="YP_001585527.1"
FT   gene            complement(280317..281549)
FT                   /db_xref="GeneID:5770479"
FT                   /locus_tag="Bmul_5566"
FT   CDS_pept        complement(280317..281549)
FT                   /locus_tag="Bmul_5566"
FT                   /gene_family="HOG000263283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7074 hypothetical protein"
FT                   /db_xref="GI:161522599"
FT                   /db_xref="GeneID:5770479"
FT                   /translation="MSKKPQKQSQVESFNPTVPDHPTSEADAVDLPATFAHVPDKLELS
FT                   TTAREMFGDLPENLIRNIIHETEEVAHSTRKILQEHMRIGGNFAHIHAAVIGHYVSTQG
FT                   DTRQVRNTAAELVYSFLTKLFRKSKSSVSLYIRCYNKFSNNIGAVEMLTISDMSLLVHN
FT                   NISDEIVEKVIDAKREDPTLTKSQVTALINSLKEQIAGKDNSIEEATSQLTTAVGKLDD
FT                   AQREIDRLSAELANVRQEQAREKTKAQETQVSLASAGKQVSTLQHTIAGKEREVEQLTA
FT                   EIAKLKANPTKVEVEVPTVPSSYATLEDAVAAKLAEHTAVKAQLEQAQAELAELEARAQ
FT                   EHRAAIEASEVLEKKIRGLIDTFSSFVHEYHSAQLLATADGNPGRFKPLFQAFGDLIGK
FT                   FHGEVMAAARA"
FT                   /protein_id="YP_001585528.1"
FT   misc_feature    complement(<280599..>281024)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bmul_5566"
FT   gene            281858..282850
FT                   /db_xref="GeneID:5770480"
FT                   /locus_tag="Bmul_5567"
FT   CDS_pept        281858..282850
FT                   /locus_tag="Bmul_5567"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="GI:161522600"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:5770480"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT                   /protein_id="YP_001585529.1"
FT   misc_feature    282008..282235
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bmul_5567"
FT   misc_feature    282044..282817
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bmul_5567"
FT   gene            complement(282993..283694)
FT                   /db_xref="GeneID:5770809"
FT                   /locus_tag="Bmul_5568"
FT   CDS_pept        complement(282993..283694)
FT                   /locus_tag="Bmul_5568"
FT                   /gene_family="HOG000263284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NERD domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NERD domain protein; KEGG: bvi:Bcep1808_7075
FT                   NERD domain protein"
FT                   /db_xref="GI:161522601"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="GeneID:5770809"
FT                   /translation="MILTIILLCGAWALYKQYADSHRGQRSTRPVTRSQASGDAGEARV
FT                   NAELRRVLAHLCGSDFYVHPTALLLLHAPGTEFPTAEVDHLVVTPFGIFVIETKNWAGT
FT                   ILPGQTADQLVCHLPSGRLEERRSPISQNRAKVAFLRGTLPATWNVQGLGVFSHDACTL
FT                   SAGLPLALVNLRDLGYWLRTQRDRHAESGNPNINVSAAWDVVRRLSVDDPTGSAISAHR
FT                   HKVARNSSVNI"
FT                   /protein_id="YP_001585530.1"
FT   misc_feature    complement(283206..283586)
FT                   /note="Nuclease-related domain; Region: NERD; pfam08378"
FT                   /db_xref="CDD:149442"
FT                   /locus_tag="Bmul_5568"
FT   gene            284117..284476
FT                   /db_xref="GeneID:5770810"
FT                   /locus_tag="Bmul_5569"
FT   CDS_pept        284117..284476
FT                   /locus_tag="Bmul_5569"
FT                   /gene_family="HOG000263285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7077 hypothetical protein"
FT                   /db_xref="GI:161522602"
FT                   /db_xref="GeneID:5770810"
FT                   /translation="MLQSLIGGAFKSPGKFLALCFAVYLAAHSILVSVFLAIAGFHYFK
FT                   NAAKTARRDAERDAAIRHDRDENPQHANRAQATAARSDVKASTTPQRQYAKSAVVIPLK
FT                   PAINPAVETMKTGTK"
FT                   /protein_id="YP_001585531.1"
FT   gene            284590..285039
FT                   /db_xref="GeneID:5770811"
FT                   /locus_tag="Bmul_5570"
FT   CDS_pept        284590..285039
FT                   /locus_tag="Bmul_5570"
FT                   /gene_family="HOG000263286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7078 hypothetical protein"
FT                   /db_xref="GI:161522603"
FT                   /db_xref="GeneID:5770811"
FT                   /translation="MEQQVAAWQLDIFGSASPILVTRPKPDPLPDPELWEPHVREKLAE
FT                   AVVFFALDSRHSDNVPEALIDCAEMLHQRLCNRPVDKGDYYATLGWIMELWTGAIPYQV
FT                   VCALGRVRPRAMQDAIRDIPLLNYDFNRLNRWCSGQLSLEAQWVA"
FT                   /protein_id="YP_001585532.1"
FT   gene            285027..285860
FT                   /db_xref="GeneID:5770803"
FT                   /locus_tag="Bmul_5571"
FT   CDS_pept        285027..285860
FT                   /locus_tag="Bmul_5571"
FT                   /gene_family="HOG000263287" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7079 hypothetical protein"
FT                   /db_xref="GI:161522604"
FT                   /db_xref="GeneID:5770803"
FT                   /translation="MGGVAMFFTRILAQAFPGGARVSTADPPSTSRQAERTVGTGASNE
FT                   TFVTIDGIAHLFVDEGDCVVEFVPAFDDAPGDTMFGTKILPALAPHWALAHEYSASLKD
FT                   AIAAAIRRESVPASPALNTASAPDAADLWTLQPADVPKARSHDEDDGRGLSPTPQSSRT
FT                   QYQRGRRDDSSRSSVVEGSITGWGEETFPDRRPGKSGSYRSFALRLETRDGEQVLQGEG
FT                   LKEAINECGCCVGDIVSVKRLRKIKVPAFRKEDGSPIYKDGQQVMWDKWLWSITK"
FT                   /protein_id="YP_001585533.1"
FT   gene            285872..286426
FT                   /db_xref="GeneID:5770804"
FT                   /locus_tag="Bmul_5572"
FT   CDS_pept        285872..286426
FT                   /locus_tag="Bmul_5572"
FT                   /gene_family="HOG000106483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: bvi:Bcep1808_7080 single-strand binding
FT                   protein"
FT                   /db_xref="GI:161522605"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:5770804"
FT                   /translation="MASVNKVIIVGNLGADPEVRYLPSGDAVANARVATTDRYKDKATG
FT                   EYKETTEWHRVSFFGRLAEIVSEYLRKGSSIYVEGKIRTRKWQGQDGQDRYSTEIVADQ
FT                   MQMLGGRNSGGRGDSDGHGGDGDFEQGSRRQATAPAARQASGQPPANTRAQTQHSAPRP
FT                   AQTQSYGGGGGFDEMDDDIPF"
FT                   /protein_id="YP_001585534.1"
FT   misc_feature    285890..286195
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bmul_5572"
FT   misc_feature    order(285890..285901,285974..285982,286025..286027,
FT                   286031..286033,286094..286096,286121..286123,
FT                   286154..286156,286163..286165)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bmul_5572"
FT   misc_feature    order(285905..285913,285929..285931,285959..285961,
FT                   285980..285985,286019..286024,286028..286030,
FT                   286034..286036,286040..286042,286046..286048,
FT                   286085..286090,286112..286114,286118..286120,
FT                   286124..286129,286166..286168,286172..286174)
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bmul_5572"
FT   misc_feature    order(286094..286096,286100..286102,286106..286108,
FT                   286187..286189)
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bmul_5572"
FT   gene            286822..287964
FT                   /db_xref="GeneID:5770805"
FT                   /locus_tag="Bmul_5573"
FT   CDS_pept        286822..287964
FT                   /locus_tag="Bmul_5573"
FT                   /gene_family="HOG000263288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7082 hypothetical protein"
FT                   /db_xref="GI:161522606"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="GeneID:5770805"
FT                   /translation="MRELKKLVLSNLDWTNIFPHYIDTRFLSGKGRWWTCPLCDGEETF
FT                   RLFPAEKDRSGGWHCARCLKGGTGVQLIHEVTGKPYREIYYELETGNYNGRIPAAVALK
FT                   AKPVPVRPEKSDEQKCREMQAAWDSAAPVTVGSPVWTYLSTRIPGLRSEWIGRDVRCHP
FT                   GMEYVDAFGKKQGRFPVMLLRARSQAGKPRRVHRTFLTAAGEKVPFLTKKGKSRAKLEM
FT                   SAPAGSFGSSVLLNTTRSRTLAVVEGAETGFAVVARYENRIEVRCLLNCGGLEHADINW
FT                   NDYDRVIIYADRDKVDSRRGFRPGEHHAQLLADRIRGHGKRVSIVKSVVDGVDFCDVWK
FT                   LQYQRRAQQRDRLRARQLAREEARKRNLARIRGSAMTAAL"
FT                   /protein_id="YP_001585535.1"
FT   gene            288060..288284
FT                   /db_xref="GeneID:5770322"
FT                   /locus_tag="Bmul_5574"
FT   CDS_pept        288060..288284
FT                   /locus_tag="Bmul_5574"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7083 hypothetical protein"
FT                   /db_xref="GI:161522607"
FT                   /db_xref="GeneID:5770322"
FT                   /translation="MGSFRLVLDEFEVVEVAAAAVPEGAADLCEGPRFDVIDRLLEGDD
FT                   RYILRDEAFQPAVDFCIAWLDEKAKSKKH"
FT                   /protein_id="YP_001585536.1"
FT   gene            complement(288581..288736)
FT                   /db_xref="GeneID:5770323"
FT                   /locus_tag="Bmul_5575"
FT   CDS_pept        complement(288581..288736)
FT                   /locus_tag="Bmul_5575"
FT                   /gene_family="HOG000024001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522608"
FT                   /db_xref="GeneID:5770323"
FT                   /translation="MLELIGWIRNGELIHKLASPYFWLAMAATAIAAEYCVAAWQTYMV
FT                   NAKEDQ"
FT                   /protein_id="YP_001585537.1"
FT   gene            complement(288854..289189)
FT                   /db_xref="GeneID:5770324"
FT                   /locus_tag="Bmul_5576"
FT   CDS_pept        complement(288854..289189)
FT                   /locus_tag="Bmul_5576"
FT                   /gene_family="HOG000263291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7085 hypothetical protein"
FT                   /db_xref="GI:161522609"
FT                   /db_xref="GeneID:5770324"
FT                   /translation="MSDKIEMTITINELVSPLLFERLSACSSARRRAALLKALAESALR
FT                   HEMTGRFVAAPTTAGRVAELASRQDTPARSLSAVENDEFKVLSVGDGSDDRTTFDEALH
FT                   DQLGAWM"
FT                   /protein_id="YP_001585538.1"
FT   gene            complement(289199..290203)
FT                   /db_xref="GeneID:5770496"
FT                   /locus_tag="Bmul_5577"
FT   CDS_pept        complement(289199..290203)
FT                   /locus_tag="Bmul_5577"
FT                   /gene_family="HOG000002736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7086 hypothetical protein"
FT                   /db_xref="GI:161522610"
FT                   /db_xref="GeneID:5770496"
FT                   /translation="MKTAVFAIDVGYGNTKYAYRAATNAVVSGMFPSLAPLAASRSIAG
FT                   YGESVLTARKVATIVIDQVEYEVGPDVSLTAAYGNTGRALADDYVLSANYAGLLFGAIH
FT                   FAGVDHIERLVLGLPVHNMKKYSAELKERFTGELNFGAGRVTIDKVMVIPQPLGSLVLA
FT                   SSNRQGGFGRDVEHLVVDVGYFTTDWVYANGFTMDDKRSGGMPGGASQIYQRIAALIAR
FT                   DQGDEVEDIERIDKALREQTPFFFYGSNIDLAPYLEMAQPLISGVVKEMQNNVGRLANV
FT                   RSIILSGGGAALYAGVIRRAFPRVVIEVIDAPCLANVRGFLLVGESSLARERR"
FT                   /protein_id="YP_001585539.1"
FT   misc_feature    complement(289229..290185)
FT                   /note="PRTRC system protein D; Region: PRTRC_D; TIGR03739"
FT                   /db_xref="CDD:163451"
FT                   /locus_tag="Bmul_5577"
FT   gene            291077..291247
FT                   /db_xref="GeneID:5770497"
FT                   /locus_tag="Bmul_5578"
FT   CDS_pept        291077..291247
FT                   /locus_tag="Bmul_5578"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7087 hypothetical protein"
FT                   /db_xref="GI:161522611"
FT                   /db_xref="GeneID:5770497"
FT                   /translation="MIGDDLREARVASFMAAGWTVGWHALPMQPADRMESLKDRKQQDR
FT                   AGGNRRRRSRK"
FT                   /protein_id="YP_001585540.1"
FT   gene            291625..292755
FT                   /db_xref="GeneID:5770498"
FT                   /locus_tag="Bmul_5579"
FT   CDS_pept        291625..292755
FT                   /locus_tag="Bmul_5579"
FT                   /gene_family="HOG000263292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fis family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG:
FT                   bvi:Bcep1808_7088 transcriptional regulator, fis family"
FT                   /db_xref="GI:161522612"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:5770498"
FT                   /translation="MAAILNVRAVVGRYRLAPEFRDALLVLFDQHVAEIHSTTRISKRA
FT                   LSIKTQEYRATAICKAFVELREGGFALQSPWSLKSKHVAYLVDRWVKDQQSGGTIENKL
FT                   TYLRALAQWLGKGNLVGTLGDYVDRREAGLERSYVATEDKSWGANGVDAVAKIEEIART
FT                   CPYTAVQLKLQAAFGLRVEESFMLRPAEAVRNPNILAVTRGTKGGRPREVPIERKIAIL
FT                   EEAARLSNGVTGSTIPAGRTLKQWRDWYYYVLAKHGVTKSGIGVTSHGLRHEYLQTLYE
FT                   RVAEVPAPIKGSPARPDPAAHEDAKRRVVEAAGHSRPSKANAYLSTFARQATLKKPLPT
FT                   VEETKAALEAAGGNKSHAAAALGISRQALYRLLASS"
FT                   /protein_id="YP_001585541.1"
FT   misc_feature    292135..292599
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_5579"
FT   misc_feature    order(292162..292167,292240..292242,292426..292431,
FT                   292594..292596)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_5579"
FT   misc_feature    order(292162..292164,292240..292242,292429..292431,
FT                   292438..292440,292567..292569,292594..292596)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_5579"
FT   misc_feature    order(292162..292164,292429..292431,292438..292440,
FT                   292567..292569,292594..292596)
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_5579"
FT   misc_feature    order(292162..292164,292438..292440,292594..292596)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bmul_5579"
FT   gene            292882..293016
FT                   /db_xref="GeneID:5770909"
FT                   /locus_tag="Bmul_5580"
FT   CDS_pept        292882..293016
FT                   /locus_tag="Bmul_5580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_2140 ankyrin"
FT                   /db_xref="GI:161522613"
FT                   /db_xref="GeneID:5770909"
FT                   /translation="MSLRFWHKPSETARETLINGPTSEVAGEMASNFLDDEANRRSIQ"
FT                   /protein_id="YP_001585542.1"
FT   gene            complement(293054..294046)
FT                   /db_xref="GeneID:5770910"
FT                   /locus_tag="Bmul_5581"
FT   CDS_pept        complement(293054..294046)
FT                   /locus_tag="Bmul_5581"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="GI:161522614"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:5770910"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT                   /protein_id="YP_001585543.1"
FT   misc_feature    complement(293669..293896)
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bmul_5581"
FT   misc_feature    complement(293087..293860)
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bmul_5581"
FT   gene            complement(294173..294754)
FT                   /db_xref="GeneID:5770911"
FT                   /locus_tag="Bmul_5582"
FT   CDS_pept        complement(294173..294754)
FT                   /locus_tag="Bmul_5582"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ftw:FTW_1215 cold shock DNA -binding
FT                   domain protein"
FT                   /db_xref="GI:161522615"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="GeneID:5770911"
FT                   /translation="MRGTVKWFSKDKGHGFIYGESAVDYFFHVSDVVGADAPREGDIVE
FT                   FDATSNKRGPRAATVRIVERQVRTPTRQHRDDRVECIACKKKMVPRIITHRGRPERSVC
FT                   PYCAATYKRFGMCFIASAVYGSYDAPEVVALRAFRDNVLRATKAGRWTIRAYYRASPPF
FT                   ARFLHAHPKLTRHIKPILDVVVRSIQARPH"
FT                   /protein_id="YP_001585544.1"
FT   misc_feature    complement(294569..294754)
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bmul_5582"
FT   misc_feature    complement(order(294596..294598,294677..294679,
FT                   294707..294709,294734..294736))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bmul_5582"
FT   misc_feature    complement(order(294671..294682,294698..294718))
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Bmul_5582"
FT   gene            complement(294840..295511)
FT                   /db_xref="GeneID:5770993"
FT                   /locus_tag="Bmul_5583"
FT   CDS_pept        complement(294840..295511)
FT                   /locus_tag="Bmul_5583"
FT                   /gene_family="HOG000024002" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7089 hypothetical protein"
FT                   /db_xref="GI:161522616"
FT                   /db_xref="GeneID:5770993"
FT                   /translation="MIEQLYPCEHCGGRPTVGRSQRLIDCDENRRFDFSQFGRFGGPPE
FT                   LGDVLPRPPEAPLTEHLVCIYCTACGISTRWEAIGEDEAAAKDRCAESWNRRVARPRTT
FT                   HDDLRRLIEREVGACDSQLVLDMLARVEGDWAEIGPIFKLLAQRIVDATVVTFDTWPIA
FT                   PVLEDASRYRKLVQLAKWIEVDGEDYIQFPKIHSPGEHRDFLFEDRIATAVDAKPDRDR
FT                   W"
FT                   /protein_id="YP_001585545.1"
FT   gene            complement(295622..296041)
FT                   /db_xref="GeneID:5770994"
FT                   /locus_tag="Bmul_5584"
FT   CDS_pept        complement(295622..296041)
FT                   /locus_tag="Bmul_5584"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522617"
FT                   /db_xref="GeneID:5770994"
FT                   /translation="MLGKTLFLQRAVSRTDLWGPGFPTLSMACRQADSISGGRQITIAV
FT                   TDSHGIRCAVFTNFGAILEFRASWAELERAGTWWHYARTWHFWIVDSPQSAQRIFPEDP
FT                   SHAAISSSGTDFTSGTSTDALLSLICAAEKSASGG"
FT                   /protein_id="YP_001585546.1"
FT   gene            complement(296110..297342)
FT                   /db_xref="GeneID:5770995"
FT                   /locus_tag="Bmul_5585"
FT   CDS_pept        complement(296110..297342)
FT                   /locus_tag="Bmul_5585"
FT                   /gene_family="HOG000263293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7090 hypothetical protein"
FT                   /db_xref="GI:161522618"
FT                   /db_xref="GeneID:5770995"
FT                   /translation="MKANTSPGKVSISGIAVPLDEVQENPAAFVRQLERAKLNPGYAQC
FT                   LCRGTAAPLRLQIRRYGSLLHLAGWPDEGPLHDRQSCSFHKDPNEAGSETGRTLPGVVT
FT                   TAVGLLAKLDVALTQRTINTVSRGTRQAGAPTSSRRSTPLLGFLQALWLVAGLNRWSAT
FT                   DRVRNWGVCNARILAGLGDAMINGEPAEKILHVMRRFQEADRVAINSEFDAFLGRVGQR
FT                   NGTNHRGLVVGEISEIGTTPYGRSITLRQSAKRYYCSNDLIDLAEKRYAHALRALGDRA
FT                   ARVAAILVIERTAKGHHVIVDFAAMLCSSTYVACDSIHEVAMANRLVAEGRSFDKPIRL
FT                   DTGGDMLPDFVLTDTPAPTHVEVYGMNGMATYEARKREKQRLRLSRGIPAVEWNVDAID
FT                   LAEIRLPPAGR"
FT                   /protein_id="YP_001585547.1"
FT   misc_feature    complement(296158..297279)
FT                   /note="Protein of unknown function (DUF1173); Region:
FT                   DUF1173; pfam06666"
FT                   /db_xref="CDD:148331"
FT                   /locus_tag="Bmul_5585"
FT   gene            complement(297339..297581)
FT                   /db_xref="GeneID:5770752"
FT                   /locus_tag="Bmul_5586"
FT   CDS_pept        complement(297339..297581)
FT                   /locus_tag="Bmul_5586"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522619"
FT                   /db_xref="GeneID:5770752"
FT                   /translation="MLGAIADSDSIPEWAKFEVAAEYSGRGDVTVATLTEIDSRIVEQR
FT                   AALRAAANSTPGADRLLGRYSNSAKTGDAPDRSGH"
FT                   /protein_id="YP_001585548.1"
FT   gene            complement(298203..298598)
FT                   /db_xref="GeneID:5770753"
FT                   /locus_tag="Bmul_5587"
FT   CDS_pept        complement(298203..298598)
FT                   /locus_tag="Bmul_5587"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522620"
FT                   /db_xref="GeneID:5770753"
FT                   /translation="MFAGKWAFYVFFVLPSVIIGGVLALYSNFSFGTIPREVLQFAAQT
FT                   ATNPAAPPGSLSIQVCKDKIPDHALRTSPICQSKGFEQRPIVALAREVGERLSWAYATV
FT                   VIFSAGLAVGLGFFGRDRAALRRRLRS"
FT                   /protein_id="YP_001585549.1"
FT   gene            299135..300136
FT                   /db_xref="GeneID:5770754"
FT                   /locus_tag="Bmul_5588"
FT   CDS_pept        299135..300136
FT                   /locus_tag="Bmul_5588"
FT                   /gene_family="HOG000263294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7092 hypothetical protein"
FT                   /db_xref="GI:161522621"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:5770754"
FT                   /translation="MSRKSAERKLVREADPHQAELVKLIKQFGYAHQPSVVFADFVEMA
FT                   AIALSNSVDKPQFEPREKRYVEIARKYKPEELQLFARMFAELTLSFEHRLGVEEGLAPG
FT                   DLPCPGNLTDVLGETYMTMGIGNDGAGQFFTPYSVSRLMAGIAIGDRSEAVERDGFMRM
FT                   QEPACGAGGMVIATADALLSIGQNYQQTLHATCIDIDARCVHMTYLQLSMMHIPAIVVH
FT                   GNALTMEVWGMWYTPAHILGGWRSKLRQRRQLDAMRKVLALDRSIAATDPGADPDPNGE
FT                   MVCDSDVAVEPPVAVEAAATVHHVDSLSDLFDEAVERSKDSIFEAVDQLALF"
FT                   /protein_id="YP_001585550.1"
FT   misc_feature    299474..>299713
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Bmul_5588"
FT   gene            300410..302089
FT                   /db_xref="GeneID:5770610"
FT                   /locus_tag="Bmul_5589"
FT   CDS_pept        300410..302089
FT                   /locus_tag="Bmul_5589"
FT                   /gene_family="HOG000081510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="parB-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bvi:Bcep1808_7093 ParB-like
FT                   partition protein"
FT                   /db_xref="GI:161522622"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:5770610"
FT                   /translation="MQEALLQQPTIKLGRIKLGRNPRTYFDDAKMAEMKASISARGVDT
FT                   PVIVRPVDDGYFELIAGGRRYKAALETRGEDYDMPVNVKDVSDEEAEEIALIENIQRDD
FT                   MSPGDEAVEAARLLGRCKGDREEAARRIGWSLPTLNSRLALLNCSNEVLAALNTRRILL
FT                   GHAELLAALSKENQDRVLPVIIDEKKSVAEVRKLVESAACSLSAAIFDKADCAACPHNS
FT                   ALQSEMFGESIATGNCTNRQCYNGKTDQRLEAIAEGLRDEFPVVRVVRAGDNHTRVQLA
FT                   VDGPNGVGEAQAKACHACQNFGVAVSGLPDSLGKTYRGQCFDTVCNMRKVADRITAEKV
FT                   AAKAATTDAEGSPVPGKAAGKSASGSDASAPTAVTVVAESDRVKQYREALWRKALRRDV
FT                   GKDAALARQYLIAIVLAGYARQIKDEVFRSVYEKVTDEKAPAADLSKALILACATSDEQ
FT                   AATLVTGMFVAAIEGLDVTYLKQLCKHHNLDLTQYWKLDKEFLELVTKAEMMVIADELG
FT                   LRAAMGDNFKKVFSKSKADVISALLAVEGFTYEGKLLKVLKY"
FT                   /protein_id="YP_001585551.1"
FT   misc_feature    300440..300709
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bmul_5589"
FT   misc_feature    300452..302086
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Bmul_5589"
FT   gene            302165..302602
FT                   /db_xref="GeneID:5770611"
FT                   /locus_tag="Bmul_5590"
FT   CDS_pept        302165..302602
FT                   /locus_tag="Bmul_5590"
FT                   /gene_family="HOG000263295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7094 hypothetical protein"
FT                   /db_xref="GI:161522623"
FT                   /db_xref="GeneID:5770611"
FT                   /translation="MFQALEPLLRSAEKLVLSLSMDGDNIVVFLTPAGGKDAMLRQPLI
FT                   LKATAAELDEGFASAIGSFTTAHQSLGEQVAATNAILEAQQQTQVKKAQKVLSKASTPT
FT                   AANAGADEDADDEDGADAASPNVAPDAAEKPAGTDLSSLIL"
FT                   /protein_id="YP_001585552.1"
FT   misc_feature    302165..302413
FT                   /note="PRTRC system protein E; Region: PRTRC_E; TIGR03741"
FT                   /db_xref="CDD:163453"
FT                   /locus_tag="Bmul_5590"
FT   gene            302614..302832
FT                   /db_xref="GeneID:5770612"
FT                   /locus_tag="Bmul_5591"
FT   CDS_pept        302614..302832
FT                   /locus_tag="Bmul_5591"
FT                   /gene_family="HOG000081532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7095 hypothetical protein"
FT                   /db_xref="GI:161522624"
FT                   /db_xref="GeneID:5770612"
FT                   /translation="MSISIAALVREFTYNGVALMDPGPAFSPDQVRDLYTAQYPELTTA
FT                   AVDGPDMKGEVAHYKFVRAAGAKGAHA"
FT                   /protein_id="YP_001585553.1"
FT   misc_feature    302623..302820
FT                   /note="PRTRC system protein C; Region: PRTRC_C; TIGR03738"
FT                   /db_xref="CDD:163450"
FT                   /locus_tag="Bmul_5591"
FT   gene            302932..304074
FT                   /db_xref="GeneID:5770758"
FT                   /locus_tag="Bmul_5592"
FT   CDS_pept        302932..304074
FT                   /locus_tag="Bmul_5592"
FT                   /gene_family="HOG000263296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7096 hypothetical protein"
FT                   /db_xref="GI:161522625"
FT                   /db_xref="GeneID:5770758"
FT                   /translation="MFFDPALPDSSIAAGSAARWQPPRAAPARRRPTFDLLTLPSFSTE
FT                   VPGEVRLKWRDDVQLSDLVRKHFQYGPLRAGDVRDPADAGDAFQQAFYAWVGRQYGKFS
FT                   RLQFVPRLFDAHAVRDVLDCLDNGNNDDDPTPLFFGFGLEDEWVYSLEGAIETLRSTHP
FT                   SLFRTVMAALYRASSRTMFIRLPDWFMYEFSCWYWDGDPNISDEEADRMLKERFGDDVE
FT                   TRNAHLPSVVREQLCPDDADPCSYSGGRWLDRRALTVSELLSLRGRSKGMPRRVCTEVL
FT                   KLRALMRRSRTRDLFHVSYYTNPAYALCSVIVEGNDFVGDLLDCHFDNESQSGDATTYS
FT                   GFSGLASTPQAIRRQYADLALAFRILTHIDRLLALVSQPI"
FT                   /protein_id="YP_001585554.1"
FT   misc_feature    303034..304065
FT                   /note="PRTRC system protein F; Region: PRTRC_F; TIGR03742"
FT                   /db_xref="CDD:163454"
FT                   /locus_tag="Bmul_5592"
FT   gene            304087..304815
FT                   /db_xref="GeneID:5770759"
FT                   /locus_tag="Bmul_5593"
FT   CDS_pept        304087..304815
FT                   /locus_tag="Bmul_5593"
FT                   /gene_family="HOG000081543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7097 hypothetical protein"
FT                   /db_xref="GI:161522626"
FT                   /db_xref="GeneID:5770759"
FT                   /translation="MSGISAGRTGSDVALSQALLLYTSADGAHFATAHAVIADRKSGRP
FT                   IIGAGRPLDRKVLIRTLQQLAEHVAPRAEFLPATVLGVSPEAVTWWCPAAMRRVFFECE
FT                   NLGKRSAVVPHPGLVFQASNQGFRVFAVACSDRPVRETPLFEPPYFNTWDHGRICIGSA
FT                   QVPKRVDVASIDGWEAGFFDSAFTHPNVGGKRIEYKDGEYAFWRDMLDGKFGEVFPQTV
FT                   MVPTKLTVGLLVNSQIGMGA"
FT                   /protein_id="YP_001585555.1"
FT   misc_feature    304123..304791
FT                   /note="PRTRC system protein B; Region: PRTRC_B; TIGR03737"
FT                   /db_xref="CDD:163449"
FT                   /locus_tag="Bmul_5593"
FT   gene            304812..305447
FT                   /db_xref="GeneID:5770760"
FT                   /locus_tag="Bmul_5594"
FT   CDS_pept        304812..305447
FT                   /locus_tag="Bmul_5594"
FT                   /gene_family="HOG000081110" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7098 hypothetical protein"
FT                   /db_xref="GI:161522627"
FT                   /db_xref="GeneID:5770760"
FT                   /translation="MNAVDTVLQQSFPSVMVPSREAVVPMTRSGERLLITSDGVYLEVL
FT                   RPWVRVVRRIAHYAVSTAVPYGQVEETTAFSCGQIPAALVAEFHAMARAALPNEVGAWI
FT                   VWNSMTGAFRIVALPSVSHGPGHLVYERPRLADGEWLVVDCHSHGTGSAFFSRTDNQDD
FT                   KHDVKLALVLGHCDRTPSVVLRLCAKGIFEKFERVPESWATALTAEVV"
FT                   /protein_id="YP_001585556.1"
FT   misc_feature    304824..305399
FT                   /note="Domain of unknown function (DUF2016); Region:
FT                   DUF2016; cl09677"
FT                   /db_xref="CDD:164137"
FT                   /locus_tag="Bmul_5594"
FT   gene            305447..306274
FT                   /db_xref="GeneID:5771015"
FT                   /locus_tag="Bmul_5595"
FT   CDS_pept        305447..306274
FT                   /locus_tag="Bmul_5595"
FT                   /gene_family="HOG000081554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   bvi:Bcep1808_7099 UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="GI:161522628"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="GeneID:5771015"
FT                   /translation="MSEVITHSIPADMIRRPWRVVVVGAGGTGSAFLPSLARLHHAMIE
FT                   LGHPGGIECTVYDDDTVSETNVGRQGFYPNDVGHYKALLLVNRLNNLMGTNWVAEPRRV
FT                   DSSVRIVADIVVGCVDSRRARHAIVQAAKRGSCRYYLDCGNETDRGQVILGEFGKTRRD
FT                   RLPHVGDLFPQLLNARNDKDDETPSCSMADALRKQSLVINQAISVQAFNLLWTLYRTGT
FT                   LSYSAVFVNLETGRTNPVPIDPVAWARFGYDAPKPQKARSRKRFDRMDPHIPR"
FT                   /protein_id="YP_001585557.1"
FT   misc_feature    305465..306175
FT                   /note="PRTRC system ThiF family protein; Region:
FT                   PRTRC_ThiF; TIGR03736"
FT                   /db_xref="CDD:163448"
FT                   /locus_tag="Bmul_5595"
FT   misc_feature    305564..305902
FT                   /note="Superfamily of activating enzymes (E1) of the
FT                   ubiquitin-like proteins. This family includes classical
FT                   ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
FT                   activating enzymes and other mechanistic homologes, like
FT                   MoeB, Thif1 and others. The common...; Region:
FT                   E1_enzyme_family; cd01483"
FT                   /db_xref="CDD:73265"
FT                   /locus_tag="Bmul_5595"
FT   misc_feature    order(305618..305620,305624..305626,305651..305653,
FT                   305687..305689,305798..305800,305816..305818)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73265"
FT                   /locus_tag="Bmul_5595"
FT   misc_feature    order(305819..305821,305876..305881,305897..305899)
FT                   /note="substrate interface; other site"
FT                   /db_xref="CDD:73265"
FT                   /locus_tag="Bmul_5595"
FT   gene            306543..307004
FT                   /db_xref="GeneID:5771016"
FT                   /locus_tag="Bmul_5596"
FT   CDS_pept        306543..307004
FT                   /locus_tag="Bmul_5596"
FT                   /gene_family="HOG000220583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative outer membrane lipoprotein
FT                   transmembrane"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7101 putative outer membrane
FT                   lipoprotein transmembrane"
FT                   /db_xref="GI:161522629"
FT                   /db_xref="GeneID:5771016"
FT                   /translation="MFKLLISALLLASLTACASYDFGSPDVYQRYDVQRAGEIEAATVV
FT                   SVRGVTISNESDRSGLASLLSAGVSAFLGSRTIGGGNGRYIAGALAGAGAAYVSQRLSE
FT                   SLARHAGLEVVVRTVSGRTLVVVQSDEQRFAPGDRVMLVSSSSGMRITR"
FT                   /protein_id="YP_001585558.1"
FT   sig_peptide     306543..306614
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.503 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5596"
FT                   /product="hypothetical protein"
FT   misc_feature    306603..306998
FT                   /note="Rickettsia 17 kDa surface antigen; Region:
FT                   Rick_17kDa_Anti; cl10470"
FT                   /db_xref="CDD:187001"
FT                   /locus_tag="Bmul_5596"
FT   gene            307091..307483
FT                   /db_xref="GeneID:5771017"
FT                   /locus_tag="Bmul_5597"
FT   CDS_pept        307091..307483
FT                   /locus_tag="Bmul_5597"
FT                   /gene_family="HOG000263297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7102 hypothetical protein"
FT                   /db_xref="GI:161522630"
FT                   /db_xref="GeneID:5771017"
FT                   /translation="MFKVPKVLYADRRAGGVASDAALTHQATRMLHRVARDLRLRAGEH
FT                   EVVAEPAKAGRGCRVTLRTSRMMLEVADSTSRQHVAVSFRTRRGHRDLSGGGDNVVPLA
FT                   QLDTDEGYQALLGGLRLVDGLDSDRR"
FT                   /protein_id="YP_001585559.1"
FT   gene            307493..307966
FT                   /db_xref="GeneID:5770930"
FT                   /locus_tag="Bmul_5598"
FT   CDS_pept        307493..307966
FT                   /locus_tag="Bmul_5598"
FT                   /gene_family="HOG000263298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7103 hypothetical protein"
FT                   /db_xref="GI:161522631"
FT                   /db_xref="GeneID:5770930"
FT                   /translation="MEFVDVRVEFPSGLTLADRGSYDSDEQIVFISVPMRAMLDAAKEM
FT                   EPPPAVTATWDGFEATLIQATADSFDVVSVTELGAKPRSKLGARLVRASWSKDQRQQFG
FT                   RFCHTLTVSSIVGVVGYVHAISEFSIWAAMNVAALVAIGVITYIVGMDSMNGE"
FT                   /protein_id="YP_001585560.1"
FT   gene            308182..308577
FT                   /db_xref="GeneID:5770931"
FT                   /locus_tag="Bmul_5599"
FT   CDS_pept        308182..308577
FT                   /locus_tag="Bmul_5599"
FT                   /gene_family="HOG000263299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7104 hypothetical protein"
FT                   /db_xref="GI:161522632"
FT                   /db_xref="GeneID:5770931"
FT                   /translation="MSEVLDLPVELANVPFEPVGKTIGEVAGEIDRALRSAGLAPEYVV
FT                   PANGYADAPEELHGLRGTSVWPKVPYRAGYPCVSVLRFDRGAGVLVSFVGAVDGCWRIQ
FT                   RAIRIAARCRSHAWAIAAAVSRLFDLD"
FT                   /protein_id="YP_001585561.1"
FT   gene            308654..310174
FT                   /db_xref="GeneID:5770932"
FT                   /locus_tag="Bmul_5600"
FT   CDS_pept        308654..310174
FT                   /locus_tag="Bmul_5600"
FT                   /gene_family="HOG000263300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7105 hypothetical protein"
FT                   /db_xref="GI:161522633"
FT                   /db_xref="GeneID:5770932"
FT                   /translation="MYTIHTPKDAIHVDTLAHVFHVFFHDASLSAYETAEIFLTRGNTA
FT                   LPVLRYNGILTVRQPGTAHAIFTALFAELRDRWFTKDGKQLLPWQVTRKRWEIFQFVFE
FT                   LATKPAWLLSAEQLENETDAARAAGRRFHLADVCDEVAVGVFGYTSQGPQLSLSGGVNG
FT                   RHEVHVAYALFQDRPIPESVLADYRGNAKHFKYDLQWFPVLLDIPVLRNPLPYNAMQSA
FT                   VAIFRHENQPIDAELGERIVEALRTAPADSTYVDVDDRLFAAGLVAKPDLPERYQQSVD
FT                   VGTARSPVAERLRELIGDAVLKKSLDRLDAERRQGRISQRRYSLQVEMAKLDRGRTTFE
FT                   RPNQFAAVVEARDVAALLKVLDQPAGSNDQSKQVLREQFGLSLRGLNSAGRQRVIFAFC
FT                   GYDEAAQAEWEAKQDAARVQRLAEEAANDAKEQAGRARYRRRDNVVISGVEHVDQAIAE
FT                   GYSEIRTFRRGAATRYVLAKPGSTEGRTLHAKNGTLEYARSRLTSPAA"
FT                   /protein_id="YP_001585562.1"
FT   gene            310189..310656
FT                   /db_xref="GeneID:5770261"
FT                   /locus_tag="Bmul_5601"
FT   CDS_pept        310189..310656
FT                   /locus_tag="Bmul_5601"
FT                   /gene_family="HOG000263302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7106 hypothetical protein"
FT                   /db_xref="GI:161522634"
FT                   /db_xref="GeneID:5770261"
FT                   /translation="MRFDRKVRYEDYVWTRRKELAFLNRHKRVAQKLERDCPLFADQLV
FT                   PAPETNIEAEKVRRIMRAREDEQMMRDLDARHWRAGRASYFACDPEIRARIMAEWRSWR
FT                   GPAKPTYFIYVVEKHNGVGEERRRRIREEDDALRARLARRLCSQGDLLFGT"
FT                   /protein_id="YP_001585563.1"
FT   gene            310911..311162
FT                   /db_xref="GeneID:5770262"
FT                   /locus_tag="Bmul_5602"
FT   CDS_pept        310911..311162
FT                   /locus_tag="Bmul_5602"
FT                   /gene_family="HOG000146509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7107 hypothetical protein"
FT                   /db_xref="GI:161522635"
FT                   /db_xref="GeneID:5770262"
FT                   /translation="MNQPDSSAPVPPDAVSIAEIEAAINVWRNRSPAPTGPDELLVLCA
FT                   EARVLADVYGVMIVSCSTSVPRSSLTATQAAALLGART"
FT                   /protein_id="YP_001585564.1"
FT   misc_feature    310944..>311117
FT                   /note="Protein of unknown function (DUF3717); Region:
FT                   DUF3717; pfam12512"
FT                   /db_xref="CDD:152946"
FT                   /locus_tag="Bmul_5602"
FT   gene            311280..312305
FT                   /db_xref="GeneID:5770263"
FT                   /locus_tag="Bmul_5603"
FT   CDS_pept        311280..312305
FT                   /locus_tag="Bmul_5603"
FT                   /gene_family="HOG000230241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7108 ATPase"
FT                   /db_xref="GI:161522636"
FT                   /db_xref="GeneID:5770263"
FT                   /translation="MKLSPARLAKLLSAYIPRRLPVLITGRPGIGKSDIVESATEAAGH
FT                   DLLISHPVVEDPTDSKGLPFPSADGQHARFLPFGDLERALSATRPLVWFFDDLGQASPA
FT                   VQAAKMQLLLARRIGEHQLPDFVTFVAATNRRGDNAAVSGILDPLISRFAAVVELEATV
FT                   DDWTTWAVQQDVPPELIAFLRFRPDLLWEERSGRDIVASASPRKWGFLAKTMSAVPADL
FT                   LPDAINATVGEGAGAELLSFLAIYRALPSVDAILLNPDLGVIPDEPSILYALTAALAHK
FT                   ASDGNFERVLQYADRLVDAGRREFTALLVRDATARRPDLANHHAFIRAQGGEIGKIIRG
FT                   E"
FT                   /protein_id="YP_001585565.1"
FT   misc_feature    311295..311759
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5603"
FT   misc_feature    311355..311378
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5603"
FT   misc_feature    order(311358..311381,311565..311567,311679..311681)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5603"
FT   misc_feature    311553..311570
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5603"
FT   misc_feature    311733..311735
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5603"
FT   gene            312409..313338
FT                   /db_xref="GeneID:5770445"
FT                   /locus_tag="Bmul_5604"
FT   CDS_pept        312409..313338
FT                   /locus_tag="Bmul_5604"
FT                   /gene_family="HOG000263303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7109 hypothetical protein"
FT                   /db_xref="GI:161522637"
FT                   /db_xref="GeneID:5770445"
FT                   /translation="MNITELQSKVMLSSLTISTWVARRYDGKVTEEVEKSHSARGIGRF
FT                   NKRLLPEHAPSYAEVLSIGSRIRSHYYGRTLKYDQLGVRLLPTMVYMELADRLRAMKDE
FT                   FDLAVSVFLTNYLDLKEQARAEMHTLYNEADYPSLAELKGKFGVKLSVLPFPDASQFGV
FT                   DLPTDVLTTLRTEVDAHAMASIQTANKDLVGRLYEAVSTMASRLYASGNVRLDVANHVR
FT                   ELCDLLPKLNFSDDPKLAHILSEAKRHLAAHNGAELKESSVLRSQVASKATEIEGLMAA
FT                   FMGGAPAVPLTDQVTAPPATAVSFLAAA"
FT                   /protein_id="YP_001585566.1"
FT   gene            313346..314554
FT                   /db_xref="GeneID:5770446"
FT                   /locus_tag="Bmul_5605"
FT   CDS_pept        313346..314554
FT                   /locus_tag="Bmul_5605"
FT                   /gene_family="HOG000263304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7110 hypothetical protein"
FT                   /db_xref="GI:161522638"
FT                   /db_xref="GeneID:5770446"
FT                   /translation="MDARIAKQRTALVLDHPFIGALALRLKVREDPGCKTFWTDGESLG
FT                   YNPVYAAGLTDLQIRAVLAHEVWHVAGGHCWRQGPRDPEGWNEACDYVVNLIVEGAGMQ
FT                   LPPGALIDSRFQGMSAEEVYGIRMHEKRQAAKQHAGSQLSAPRPGSKPGRSAGSPNGRP
FT                   SGSGDDLAAEPAPSCGEVRQYAGPDKPAKEAEWKVAVLQAAKAAQACGKLGGALQAAVE
FT                   QSAAAVVDWRSLLHRFAQDAAPTDYTWAQPNRRYLHLGMYLPSLNEPAVGDAVFVRDAS
FT                   GSVWDETQAQFAAEILAVSEAVRPRRLIVMDCDERVTQVQVFESDDPVELAPLKGGGGT
FT                   SFVDPFRWLAREDIEPAFLVYLTDMDGTFPSEEPAYPVLWASTTPLKRARRAPFGETIE
FT                   VVC"
FT                   /protein_id="YP_001585567.1"
FT   misc_feature    313349..314545
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cl00057"
FT                   /db_xref="CDD:185787"
FT                   /locus_tag="Bmul_5605"
FT   gene            314829..315875
FT                   /db_xref="GeneID:5770447"
FT                   /locus_tag="Bmul_5606"
FT   CDS_pept        314829..315875
FT                   /locus_tag="Bmul_5606"
FT                   /gene_family="HOG000119934" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bvi:Bcep1808_7111 type II secretion system protein E"
FT                   /db_xref="GI:161522639"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:5770447"
FT                   /translation="MSEIAENPFLKVARLEENAVQLFFESLKLIKPYLDSPNVAEVMIN
FT                   SANNIWVEERGVMRRLEIEFNPATLTGAIHSLAASVEKSAHAGTAQGIINGGHKNLRIA
FT                   TVMKPTAIDGDALAIRRHRETNLSIKDYARMGAFSLVHAKRSIERPIFPPGVADEALAE
FT                   AFTTMVQQRANVLVAGGTSTGKTTFLNALNGLIPSEERVITIEDTMELKVDLPNRVRLL
FT                   SNPDKGVTTQVLVALCLRFRPDRIIVGEVRGGEAFDFIQALSTGHDGGMGSIHSNDARG
FT                   GLSRLESLAMLGIPRGSRWELTDMRKAIADCFHYVIHLRRSGELRHVSEVLAIKGFKDG
FT                   DYVLERVF"
FT                   /protein_id="YP_001585568.1"
FT   misc_feature    314847..315872
FT                   /note="Flp pilus assembly protein, ATPase CpaF
FT                   [Intracellular trafficking and secretion]; Region: CpaF;
FT                   COG4962"
FT                   /db_xref="CDD:34569"
FT                   /locus_tag="Bmul_5606"
FT   misc_feature    315291..315824
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bmul_5606"
FT   misc_feature    order(315363..315368,315378..315386)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bmul_5606"
FT   misc_feature    order(315369..315374,315429..315431,315453..315455,
FT                   315474..315485,315489..315494,315546..315554,
FT                   315558..315560,315597..315599,315609..315611,
FT                   315618..315623,315651..315659,315669..315671,
FT                   315678..315680,315789..315791)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bmul_5606"
FT   misc_feature    order(315372..315389,315804..315806)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bmul_5606"
FT   misc_feature    315561..315578
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bmul_5606"
FT   gene            315894..316274
FT                   /db_xref="GeneID:5770701"
FT                   /locus_tag="Bmul_5607"
FT   CDS_pept        315894..316274
FT                   /locus_tag="Bmul_5607"
FT                   /gene_family="HOG000263305" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7112 hypothetical protein"
FT                   /db_xref="GI:161522640"
FT                   /db_xref="GeneID:5770701"
FT                   /translation="MKKHLQSLRSLVRKKVRHTAHYYFGRGHRLSTLIALALTFAAPAA
FT                   KAVDLSDLGSATAIICLIQAYVSGPWLMAIGVVLIIVGAVAIANSESNIGKFLSSVIVG
FT                   IGLAACAIPIVKNQLKINYTCA"
FT                   /protein_id="YP_001585569.1"
FT   sig_peptide     315894..316037
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 48"
FT                   /locus_tag="Bmul_5607"
FT                   /product="hypothetical protein"
FT   gene            316315..316578
FT                   /db_xref="GeneID:5770702"
FT                   /locus_tag="Bmul_5608"
FT   CDS_pept        316315..316578
FT                   /locus_tag="Bmul_5608"
FT                   /gene_family="HOG000263306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7113 hypothetical protein"
FT                   /db_xref="GI:161522641"
FT                   /db_xref="GeneID:5770702"
FT                   /translation="MGGADRGLAIANGTLTTLLCYTSMSPTFLVVGIVVHWVLRWLSSS
FT                   DPWWREVLVVYNRYPDVHEPLATADVAARFRRPYGFDQELPL"
FT                   /protein_id="YP_001585570.1"
FT   misc_feature    <316315..316509
FT                   /note="Type IV secretory pathway, VirB3-like protein;
FT                   Region: VirB3; cl01501"
FT                   /db_xref="CDD:186439"
FT                   /locus_tag="Bmul_5608"
FT   gene            316575..319052
FT                   /db_xref="GeneID:5770703"
FT                   /locus_tag="Bmul_5609"
FT   CDS_pept        316575..319052
FT                   /locus_tag="Bmul_5609"
FT                   /gene_family="HOG000263307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7114 type IV secretory pathway
FT                   VirB4 components-like protein"
FT                   /db_xref="GI:161522642"
FT                   /db_xref="GeneID:5770703"
FT                   /translation="MSANPKRRAVQEIAPWATMVTPEIILDKDGSLLTLYSFEGVDADS
FT                   PNSDEISAARDNLDHACKNFDHRITAWWRVSHRRVRGEIGGKFASEMDRHVDAINQKSI
FT                   GSGKYFRNTHSLALAYTPETGINKLFEKVAYHMTVGGKSVPIALLETVKDMVLARSAFV
FT                   FDMERITSDIKRFEGILDAFKGGVARLKMKRLQLQSALAFLHQTANPSVPPRRVRYPVT
FT                   MLDTHLTETFVTYGAEHIMFESAYGTRYAKIISVKEWMGFQEAALDVLTDVDAELDVCV
FT                   MFRFLSTSKAQAFIEKMRKFYKVAAFSPMKILKGFFSKDEKKENMENEKGREILAEEAE
FT                   NALARLIADGQQYGFVNISVVVYGDTVTECDDNAREIVGRIGNAGFGVLVEKRNLPAAW
FT                   ASTLPGRWDQQKRLQFVETPVVSDIAPVRGVAEGSDVNPWLTQQLGERIGPLTLLPTRH
FT                   RTLQRVSLHDPSGKSHALIVGPIGAGKTIFLNFLVSQTGRFRPRRIKFDKNRSTRIPTV
FT                   FANGKFVDVTGKFAAATQVNPLSLLADPRHYTYVSGWVQMAIEGDGEDFRCTPQQERTI
FT                   YERVVTLAQGYGPEYWTLSFLAPLLPAELRDRLQIWTKGEKNGRFFDHVEDAFSLSDDL
FT                   AIEMGELFESYPVAAALFMDYAFYRISQWLDGKRVTIIEVEECGFFFRYPRFYARLEMW
FT                   VVTIRGLNGTLVMATQSLSQLERVPNFEIMKENIPNFFFLPNRDARNNKRLYRDVFGLT
FT                   DDQIDMISDGVPNRDYLWVTPDHSRMLQAKFPKEALAILRADGAAQRTLDKHLASGSPT
FT                   WREDYLAEMATLD"
FT                   /protein_id="YP_001585571.1"
FT   misc_feature    316587..318959
FT                   /note="type IV secretion/conjugal transfer ATPase, VirB4
FT                   family; Region: VirB4_CagE; TIGR00929"
FT                   /db_xref="CDD:162115"
FT                   /locus_tag="Bmul_5609"
FT   misc_feature    317244..317798
FT                   /note="VirB family, component of type IV transporter
FT                   system; Region: CagE_TrbE_VirB; pfam03135"
FT                   /db_xref="CDD:111973"
FT                   /locus_tag="Bmul_5609"
FT   misc_feature    317964..>318119
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5609"
FT   misc_feature    318009..318032
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5609"
FT   misc_feature    order(318018..318023,318027..318035)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5609"
FT   gene            319063..320025
FT                   /db_xref="GeneID:5770271"
FT                   /locus_tag="Bmul_5610"
FT   CDS_pept        319063..320025
FT                   /locus_tag="Bmul_5610"
FT                   /gene_family="HOG000263308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7115 hypothetical protein"
FT                   /db_xref="GI:161522643"
FT                   /db_xref="GeneID:5770271"
FT                   /translation="MKPTTISTLQSLYRGAPGLTEDEIKKTATDTPARVHLPVGRPSLC
FT                   RSSQTPVRRNTNAVCRARGTSQPRLKGLTMKLLPTLRAAAFAASLFVAQHASAMIVFDP
FT                   TNFAQNVITAAKAVQGEIYQNTNIIYQYQMMANQLLQATNLNPAAWKAAYDQITGDINK
FT                   VKNLVGTLNGLYGDLKKGGEWVNQVQGLISRSGKSNAQWFADMNTLFEQNDKVARNLFQ
FT                   MGSNIMQHTNDMAQRRQELQSQLSMSPTQQATAEITTHYLDIVTSQNADILQLSAAKAQ
FT                   KDAQKDAQQAEEDKEKAGDAQKFISKQQAERAAYGVGQQ"
FT                   /protein_id="YP_001585572.1"
FT   misc_feature    319351..>319602
FT                   /note="Conjugal transfer/entry exclusion protein
FT                   [Intracellular trafficking and secretion]; Region: COG5314;
FT                   cl02193"
FT                   /db_xref="CDD:186517"
FT                   /locus_tag="Bmul_5610"
FT   gene            320022..321032
FT                   /db_xref="GeneID:5770272"
FT                   /locus_tag="Bmul_5611"
FT   CDS_pept        320022..321032
FT                   /locus_tag="Bmul_5611"
FT                   /gene_family="HOG000263309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7116 hypothetical protein"
FT                   /db_xref="GI:161522644"
FT                   /db_xref="GeneID:5770272"
FT                   /translation="MRNSAFRVLLRGGLILLALALPIVARAALLDGLSEAMSSGWSSSY
FT                   VNGEVAKGASAAIDTIGQIMKDLIDLAVELSRTLDKESNKMAFGLSVTTVVLASLRFGA
FT                   TKDPIAAWQSLFEDLAILGIFAAIYIAYDRWAPGFYKWFNEMAIAISGTDADSLPMAMV
FT                   KSAGAIYDSVIEALKAEHWWNYIALLINLAPLLFAWLFLMLAALVFLFYVSLGTIQMAV
FT                   AIVMGKIAFALGMSEFTRGWFKSWLDYTISAGMYMVVAAILQRLMTTTIAKSFGDTISK
FT                   GLTTPYAGSLTLDMSIFVLILAFEIPKFASMFGGGASASGSAFKSLTKMATKGLA"
FT                   /protein_id="YP_001585573.1"
FT   sig_peptide     320022..320105
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 28"
FT                   /locus_tag="Bmul_5611"
FT                   /product="hypothetical protein"
FT   misc_feature    320355..320942
FT                   /note="TrbL/VirB6 plasmid conjugal transfer protein;
FT                   Region: TrbL; cl01503"
FT                   /db_xref="CDD:174636"
FT                   /locus_tag="Bmul_5611"
FT   gene            321032..322372
FT                   /db_xref="GeneID:5770273"
FT                   /locus_tag="Bmul_5612"
FT   CDS_pept        321032..322372
FT                   /locus_tag="Bmul_5612"
FT                   /gene_family="HOG000263310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7117 hypothetical protein"
FT                   /db_xref="GI:161522645"
FT                   /db_xref="GeneID:5770273"
FT                   /translation="MVATVLFEAADVAELVLRNERRIDLIAQCANESSRHEFERKWMSV
FT                   ILRCADWYSSIPLSPELYREPAGAFRWTVETAFYAMRLSGGLKFGTNLPSERRRRVEPQ
FT                   YNYGVFLAAICSGLDEPYRHFDVERTTDCQVWNPSVHGAVGPWLGGARYRMTRRSTPLP
FT                   VERMRTGMLAHALVGPELLSGLDAEVQAEIFGAINPTQSPQGVETLTHKVVRQAIATAA
FT                   DFDRKAQRAVFEPVTFAVPSAIHVAAELEPKLDPAASSATSLAAAPTPAAAAEPETAAP
FT                   APATDARVGTSIPSPPLPLATAGIDGSSRAALSAAANAAPKAPDQRQMALELPPAAVVN
FT                   PAEIRQERPGAIVTPAEDRFDEILKGAPRMISDFFVALQQDVAGGKVKVRWAEKGLVVS
FT                   KRTIGGYGVASDTLIEHMRRRNLLLANEPTEVTLAPRIGELIQGRDA"
FT                   /protein_id="YP_001585574.1"
FT   misc_feature    321050..>321721
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:185790"
FT                   /locus_tag="Bmul_5612"
FT   gene            322369..324237
FT                   /db_xref="GeneID:5770349"
FT                   /locus_tag="Bmul_5613"
FT   CDS_pept        322369..324237
FT                   /locus_tag="Bmul_5613"
FT                   /gene_family="HOG000221876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7118 hypothetical protein"
FT                   /db_xref="GI:161522646"
FT                   /db_xref="GeneID:5770349"
FT                   /translation="MRGYINHFRPIYEVRAAFGWLIALLALPLSGMPYGWAFTLFALVS
FT                   FAIRSGQTWRALKFRMGLSTKWLTTLAVPTLLAIQNRMRAEVNAMYLGTGFEWTQKHCQ
FT                   MAHDILRMPTTEIPGLPKWLPKTKAGRAFEEMIENLFAPKDSIRDRTPQGASWIHGLEP
FT                   AKGFVPFHYKAMGGHTAVGGTTGSGKTRTYEVISTQVIHCGDVLIDIDPKNDKEWKARA
FT                   EREAQRTGRKFLYFNQAKPSESIRLEPLDSWSQPSEIPSRIAQLMEEGPFRDFAYLFIS
FT                   RSVNGELYIGDKPNLRSILKYAQLGIDPLLEKALKRFFIESGMAEWEELVAADTVKFAN
FT                   KPGSTRVDAMISLYQARFGANDRGHEAIDGLIATHVHDREHYMRIIASALPLLQMLATG
FT                   ETGLMLAPKVDDFEDEREIWTIEKVIRQKAVLHIGLDSLSNSIVAKAIASMILADVSAV
FT                   CGSIYNFYDKAPEVVLIIDEIAEAINEQVIQILNKGRGAGFKAFVAFQTRADLEAKLGN
FT                   AAKMLQVLGNLNNQIILRLEDTDTAEWFSKKVGDTAIRNLIVSSSTSKASEGHVGEFTG
FT                   SVTRSQQLEAVPLIPTRLIQTLPNLQYFMRISGGAVYQGRIPILTG"
FT                   /protein_id="YP_001585575.1"
FT   sig_peptide     322369..322482
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.435 at
FT                   residue 38"
FT                   /locus_tag="Bmul_5613"
FT                   /product="hypothetical protein"
FT   misc_feature    322390..324195
FT                   /note="Type IV secretory pathway, VirD4 components
FT                   [Intracellular trafficking and secretion]; Region: VirD4;
FT                   COG3505"
FT                   /db_xref="CDD:33308"
FT                   /locus_tag="Bmul_5613"
FT   misc_feature    <323767..324201
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5613"
FT   misc_feature    323785..323799
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bmul_5613"
FT   gene            324248..324763
FT                   /db_xref="GeneID:5770350"
FT                   /locus_tag="Bmul_5614"
FT   CDS_pept        324248..324763
FT                   /locus_tag="Bmul_5614"
FT                   /gene_family="HOG000263311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7119 hypothetical protein"
FT                   /db_xref="GI:161522647"
FT                   /db_xref="GeneID:5770350"
FT                   /translation="MSAVFKKIIREHKLSAHLTPVFTLAPELELVCTRVAEFVGEHFIG
FT                   KAEPLVKEMFVDGLAAFKRVRKTGDPHVAFMQGLFGSAHMLYARRFVVRDGDRCHVWSP
FT                   MFESVTAFESRFKLAPEMVDERCPENISQKSAAFQLAARALTGETFRLYFEEYDVAHTY
FT                   SDSDADAA"
FT                   /protein_id="YP_001585576.1"
FT   gene            324720..324983
FT                   /db_xref="GeneID:5770351"
FT                   /locus_tag="Bmul_5615"
FT   CDS_pept        324720..324983
FT                   /locus_tag="Bmul_5615"
FT                   /gene_family="HOG000001484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522648"
FT                   /db_xref="GeneID:5770351"
FT                   /translation="MLLTHILIRTLTRLDDQTVRRVMSTAAAQDDPSAPPPAEFRQGRH
FT                   AMAYALATFVGRRPVHFYVGLSGLVALPIYLVGTFVGGIYGR"
FT                   /protein_id="YP_001585577.1"
FT   gene            324973..325578
FT                   /db_xref="GeneID:5770698"
FT                   /locus_tag="Bmul_5616"
FT   CDS_pept        324973..325578
FT                   /locus_tag="Bmul_5616"
FT                   /gene_family="HOG000263313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7120 hypothetical protein"
FT                   /db_xref="GI:161522649"
FT                   /db_xref="GeneID:5770698"
FT                   /translation="MAGSRFVGHIKMWFFFVPLLSVALMPAAPDPSLFDIPDAEAASVA
FT                   SSLGEVRTADAIDTTNRTFKHYFVATGLVQASMASSGETQIEDGGVANFASRWVHNFWR
FT                   LVYRMVYRITVMKYWLLGMLVFGIAMFTDGTVRRKVRAAAAGYVSPLSFHLAGHGILLV
FT                   FGVTFTVLIAPLPLIAPYWLAIAACLGALLWKAASTYQ"
FT                   /protein_id="YP_001585578.1"
FT   gene            325933..326826
FT                   /db_xref="GeneID:5770699"
FT                   /locus_tag="Bmul_5617"
FT   CDS_pept        325933..326826
FT                   /locus_tag="Bmul_5617"
FT                   /gene_family="HOG000263314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7121 hypothetical protein"
FT                   /db_xref="GI:161522650"
FT                   /db_xref="GeneID:5770699"
FT                   /translation="MSTINEEAHVGTDTADVAPVHAAANVLEGETVLAATGDSAATDRR
FT                   PTTDGADDGDVERELDEMERSAGILQREGLISAEEAVTKLEEVARTRTLFRDLPPEQRA
FT                   RIVQRRREIGRELMNKQLSGAAVVTARVTMKHTRLKPLFEQWWPYLNRMTINMQRFGRA
FT                   TYGANEQGIVSTWFEKQLDQLEGYVNEQLDVAKGFREKTEAEMRERGETVFEPTVTKPS
FT                   LDIEVEAYSRFSMRLLSVILKFDQVMDHFDFLVWNGVRDQSDVDDETARFLRKFHPVGL
FT                   RGYTTHLKLMNTVRGN"
FT                   /protein_id="YP_001585579.1"
FT   gene            326844..327164
FT                   /db_xref="GeneID:5770700"
FT                   /locus_tag="Bmul_5618"
FT   CDS_pept        326844..327164
FT                   /locus_tag="Bmul_5618"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UvrD/REP helicase"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7122 UvrD/REP helicase"
FT                   /db_xref="GI:161522651"
FT                   /db_xref="GeneID:5770700"
FT                   /translation="MLDELNPQQREVALLRRHCLAIACPGAGKTKMSATKAAFLLQDPT
FT                   AVVGAVTFSKDAAVELRERILALAPADAKRRLIAGTFHSLAYKGNADLFGSAVIADVAE
FT                   DV"
FT                   /protein_id="YP_001585580.1"
FT   misc_feature    326856..>327107
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:187234"
FT                   /locus_tag="Bmul_5618"
FT   gene            327194..328186
FT                   /db_xref="GeneID:5770680"
FT                   /locus_tag="Bmul_5619"
FT   CDS_pept        327194..328186
FT                   /locus_tag="Bmul_5619"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="GI:161522652"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:5770680"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT                   /protein_id="YP_001585581.1"
FT   misc_feature    327344..327571
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bmul_5619"
FT   misc_feature    327380..328153
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bmul_5619"
FT   gene            complement(328224..329360)
FT                   /db_xref="GeneID:5770681"
FT                   /locus_tag="Bmul_5620"
FT   CDS_pept        complement(328224..329360)
FT                   /locus_tag="Bmul_5620"
FT                   /gene_family="HOG000133006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG: cvi:CV_1900
FT                   probable transcriptional regulator"
FT                   /db_xref="GI:161522653"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="GeneID:5770681"
FT                   /translation="MRPAPPSGSLYRALADELSVAITSGRLPAGSGLPSLRECAAKRKL
FT                   SLNTVTAAYRLLEDRGLIAARPQSGFYVCSKLPEPQYSLRRIPKDPMGGAQEDLMSLVL
FT                   ESQHRPEHIDLAFAGPRGKKFYPGERLARITNSVLHRQTELISAYALPPGSDLLREQIA
FT                   RRGMRLGMTLSADDIVLTHGAMEALHLALRAVTSAGDHVGIEAPSYFNLYPLLSSLGLK
FT                   AIEIPTHPQRGLDVDAVETLLREKRIAALVAMPTVHNPLGCTMPVDAKQRLAKLVNQHG
FT                   VPLIEDAVYAELQYVEPLEPAVKAFDRKGWVLVCAGFSKTLAPDYRLGWVDGGRFGGAV
FT                   RRLKFSARETLINGPTSEVAGEMASNFLDDEANRRSIQ"
FT                   /protein_id="YP_001585582.1"
FT   misc_feature    complement(329139..329336)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5620"
FT   misc_feature    complement(order(329148..329159,329163..329168,
FT                   329196..329198,329205..329210,329214..329228,
FT                   329250..329255,329259..329261,329328..329330,
FT                   329334..329336))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bmul_5620"
FT   misc_feature    complement(<328368..328949)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5620"
FT   misc_feature    complement(order(328380..328382,328401..328406,
FT                   328410..328412,328491..328493,328584..328586,
FT                   328734..328736,328806..328814))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5620"
FT   misc_feature    complement(order(328380..328388,328512..328514,
FT                   328704..328706,328803..328805))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5620"
FT   misc_feature    complement(328401..328403)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Bmul_5620"
FT   gene            329790..330668
FT                   /db_xref="GeneID:5770682"
FT                   /locus_tag="Bmul_5621"
FT   CDS_pept        329790..330668
FT                   /locus_tag="Bmul_5621"
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PhzF family phenazine biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bam:Bamb_6454 phenazine biosynthesis protein PhzF family"
FT                   /db_xref="GI:161522654"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="GeneID:5770682"
FT                   /translation="MSNILFKQVDVFTSVRFKGNPVAVVLRADGLTTEQMQQIANWTNL
FT                   SETTFVLPTMDSRADYRVRIFTPGAELPFAGHPTIGTAHALLEAGLVHAKEGMLIQECG
FT                   AGLIRLKVAREDDGEQWISFDLPESTITPLDDAQIDELDAILGSPSCRQFNPSLIDVGA
FT                   RWIVAQLADAQAVLSTKPDLQRMRVQDTKAKATGVVIFGEYDEKAPSRIEVRAFAPAHG
FT                   VNEDPVCGSGNGAVGVFIQHTGQTAHFGSEFLASQGKVVGRAGVLRLAVTDQRIQVGGV
FT                   AVTCIDGQLSI"
FT                   /protein_id="YP_001585583.1"
FT   misc_feature    329790..330665
FT                   /note="Predicted epimerase, PhzC/PhzF homolog [General
FT                   function prediction only]; Region: COG0384"
FT                   /db_xref="CDD:30733"
FT                   /locus_tag="Bmul_5621"
FT   misc_feature    329811..330638
FT                   /note="Diaminopimelate epimerase; Region: DAP_epimerase;
FT                   cl14668"
FT                   /db_xref="CDD:187422"
FT                   /locus_tag="Bmul_5621"
FT   gene            complement(331202..331423)
FT                   /db_xref="GeneID:5770424"
FT                   /locus_tag="Bmul_5622"
FT   CDS_pept        complement(331202..331423)
FT                   /locus_tag="Bmul_5622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6590 transposase Tn3"
FT                   /db_xref="GI:161522655"
FT                   /db_xref="GeneID:5770424"
FT                   /translation="MIGYFTNVSFRSEMQHTLNREEAVHTVQRAIHIGRIPVERARRAR
FT                   CGVIGIDTVIKHLDGVEHHLHATPPGEH"
FT                   /protein_id="YP_001585584.1"
FT   misc_feature    complement(331289..>331423)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bmul_5622"
FT   gene            331580..331819
FT                   /db_xref="GeneID:5770425"
FT                   /locus_tag="Bmul_5623"
FT   CDS_pept        331580..331819
FT                   /locus_tag="Bmul_5623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6928 hypothetical protein"
FT                   /db_xref="GI:161522656"
FT                   /db_xref="GeneID:5770425"
FT                   /translation="MRYRVTDARANSQENTALAVLLDAASTLVNAASSDCERLQTLKRF
FT                   GHPRPRAVRRPPAQLPGQQDFFADSNELEQLADH"
FT                   /protein_id="YP_001585585.1"
FT   sig_peptide     331580..331675
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.609 at
FT                   residue 32"
FT                   /locus_tag="Bmul_5623"
FT                   /product="hypothetical protein"
FT   gene            331947..333068
FT                   /db_xref="GeneID:5770426"
FT                   /locus_tag="Bmul_5624"
FT   CDS_pept        331947..333068
FT                   /locus_tag="Bmul_5624"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: stm:STM3291 putative cytoplasmic protein"
FT                   /db_xref="GI:161522657"
FT                   /db_xref="GeneID:5770426"
FT                   /translation="MSTFRTEQDLRHALSEAGLDSLSDRIVATMRPAIQFVRRQQPDDA
FT                   LPPGTSKIGGLPDLPPGFGWPHRRSPVDADTQIRALREQRIRDRERSASSRSQRPSDDI
FT                   LALLSEHEREAWLRSIEANRPDPDKLTAIHAQEDRYDDLMVVALGCEFPLAFLAQINLG
FT                   ALSNESGFDRDFPRHGVFSLFEDLTARDGDGSFQMHWFDVTAETLERRAPPATLIELSD
FT                   ARQPDFPWHEQMMAEVLQPHSTLVVPFHWIEAVGPERDAVFDFLHRPVGGYFPQPDVVE
FT                   GEQAGNFGDFLGGWPKPIQGDPERMFIGDARSFLRPGDDRIRHLFSWGGEYYAGTRRMH
FT                   APSGGDGTTYLMIQRDDLLSRRFDKAQSLYQCD"
FT                   /protein_id="YP_001585586.1"
FT   misc_feature    332403..333062
FT                   /note="Domain of unknown function (DUF1963); Region:
FT                   DUF1963; cl01600"
FT                   /db_xref="CDD:154496"
FT                   /locus_tag="Bmul_5624"
FT   gene            333138..333509
FT                   /db_xref="GeneID:5770493"
FT                   /locus_tag="Bmul_5625"
FT   CDS_pept        333138..333509
FT                   /locus_tag="Bmul_5625"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xom:XOO_2068 hypothetical protein"
FT                   /db_xref="GI:161522658"
FT                   /db_xref="GeneID:5770493"
FT                   /translation="MAAATFSAIVPHMQARAATPSADVYRPLTAEALLSGIDNGTLAGS
FT                   EEGEVRQRTISTNRATSFIYGVADTTAGMAWCPPPRMAATELVVATYGYLTKLSPRDLQ
FT                   APAAPLITRALKTAYPCIR"
FT                   /protein_id="YP_001585587.1"
FT   gene            333829..334560
FT                   /db_xref="GeneID:5770494"
FT                   /locus_tag="Bmul_5626"
FT   CDS_pept        333829..334560
FT                   /locus_tag="Bmul_5626"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   rme:Rmet_1668 transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="GI:161522659"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770494"
FT                   /translation="MTCMMAKTKTPRKTLPAGIGKVLKRLHYPMDVILLCVRWYVAYSL
FT                   SLRNLEEMMAERGIEVDHSSVHRWVIKLLPVFEKAFRKRKRPVGRSWRVDETYVKVKGQ
FT                   WKYLYRAVDKQGNTVDFLLRAHRDKAAARRYFEKAIEQNGEPETITVDRSGSNLAALEA
FT                   LNAERSVPIKVRQNKYLNNIVEQDHRAIKRIIRPMMGFRNFRCARIILAGIEIMHMIRK
FT                   GQMRDDGVASTAAEQFYSLAA"
FT                   /protein_id="YP_001585588.1"
FT   misc_feature    333889..334515
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5626"
FT   gene            complement(334601..334786)
FT                   /db_xref="GeneID:5770495"
FT                   /locus_tag="Bmul_5627"
FT   CDS_pept        complement(334601..334786)
FT                   /locus_tag="Bmul_5627"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ATPase subunit-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR2032 putative excinuclease ABC subunit
FT                   A2 UvrA"
FT                   /db_xref="GI:161522660"
FT                   /db_xref="GeneID:5770495"
FT                   /translation="MRDHVRRNTHSGVSGSGKSSLAFGTIYAEAQRRYFESVAPYARRL
FT                   IDQAGVPDVDAMVVSR"
FT                   /protein_id="YP_001585589.1"
FT   misc_feature    complement(<334616..334756)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5627"
FT   misc_feature    complement(334730..334753)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5627"
FT   misc_feature    complement(order(334727..334735,334739..334744))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5627"
FT   gene            335022..336578
FT                   /db_xref="GeneID:5770252"
FT                   /locus_tag="Bmul_5628"
FT   CDS_pept        335022..336578
FT                   /locus_tag="Bmul_5628"
FT                   /gene_family="HOG000289215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bvi:Bcep1808_7617 integrase, catalytic region"
FT                   /db_xref="GI:161522661"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770252"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT                   /protein_id="YP_001585590.1"
FT   misc_feature    335439..335840
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5628"
FT   misc_feature    335796..336560
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="Bmul_5628"
FT   gene            336595..337344
FT                   /db_xref="GeneID:5770253"
FT                   /locus_tag="Bmul_5629"
FT   CDS_pept        336595..337344
FT                   /locus_tag="Bmul_5629"
FT                   /gene_family="HOG000113194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding domain protein; SMART: AAA ATPase; KEGG:
FT                   bvi:Bcep1808_7618 IstB domain protein ATP-binding protein"
FT                   /db_xref="GI:161522662"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="GeneID:5770253"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT                   /protein_id="YP_001585591.1"
FT   misc_feature    336595..337317
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    336661..336750
FT                   /note="IstB-like ATP binding N-terminal; Region: IstB_N;
FT                   pfam08483"
FT                   /db_xref="CDD:117060"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    336838..337266
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    336913..336936
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    order(336916..336939,337096..337098,337195..337197)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    337084..337101
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5629"
FT   misc_feature    337261..337263
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5629"
FT   gene            complement(337422..337580)
FT                   /db_xref="GeneID:5770254"
FT                   /locus_tag="Bmul_5630"
FT   CDS_pept        complement(337422..337580)
FT                   /locus_tag="Bmul_5630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative excinuclease ABC subunit A2 UvrA"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR2032 putative excinuclease ABC subunit
FT                   A2 UvrA"
FT                   /db_xref="GI:161522663"
FT                   /db_xref="GeneID:5770254"
FT                   /translation="MPSNSFGESSCTAAASGLVQVRGARENNLKEVDVSIPRNALVVFS
FT                   GCGFRRW"
FT                   /protein_id="YP_001585592.1"
FT   misc_feature    complement(<337443..337526)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5630"
FT   gene            complement(337639..338973)
FT                   /db_xref="GeneID:5770987"
FT                   /locus_tag="Bmul_5631"
FT   CDS_pept        complement(337639..338973)
FT                   /locus_tag="Bmul_5631"
FT                   /gene_family="HOG000124735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR2037 hypothetical protein"
FT                   /db_xref="GI:161522664"
FT                   /db_xref="GeneID:5770987"
FT                   /translation="MKEPANINTTTVQPTPTATVYGMPAYADRAAAVGEVHARPHLLLE
FT                   APRGILQLAFMTEGDQAMDQMAMSELSHRFGVAEPDHATPLHGVTWDEGDLHCEKHTEF
FT                   STYLWCASLDSKTGEPCGENPFKHGFVPPGPVVSGIRLRLLPWTPETEKEADRFDPASL
FT                   CYSLVENGSAAILTDFRQDEDGLTQILILARDLTPARAGALAQRLLEIETYRTLALLSL
FT                   PLTRSMTSELRHMESRLAAITDEMCTNLVERRDSDVLLSELTGLAAELEAGVAANLYRF
FT                   GASRAYYEIVEERLAALSEVAVSGYSTWADFLQRRIAPAMRTCQSVKERQAKLSDKLTR
FT                   AIALLRSWIDVELERQNRDLLASMNNRAKLQLRLQQTVEGLSVAAISYYVVSLLGYLLK
FT                   GIPLVHDSVAQVMAVLVPAVMLTIWWIVRRIRHAHSDTAAEEKSS"
FT                   /protein_id="YP_001585593.1"
FT   misc_feature    complement(337669..338907)
FT                   /note="Protein of unknown function (DUF3422); Region:
FT                   DUF3422; cl02073"
FT                   /db_xref="CDD:154733"
FT                   /locus_tag="Bmul_5631"
FT   gene            complement(339159..339557)
FT                   /db_xref="GeneID:5770988"
FT                   /locus_tag="Bmul_5632"
FT   CDS_pept        complement(339159..339557)
FT                   /locus_tag="Bmul_5632"
FT                   /gene_family="HOG000232022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: har:HEAR2038 putative enzyme"
FT                   /db_xref="GI:161522665"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:5770988"
FT                   /translation="MSTPVISGDGIFSHIFIGAADLQKSVAFYDAALGALGIKNLGPFN
FT                   NGWVLFGREKPAFIIARPGNGEAPSSNGVTIGFAAATPAEVDAFHAAGLAAGGIDEGQP
FT                   GARGHLPGAYAAYLRDPAGNKVCSYTFV"
FT                   /protein_id="YP_001585594.1"
FT   misc_feature    complement(339177..339524)
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_19; cd07262"
FT                   /db_xref="CDD:176683"
FT                   /locus_tag="Bmul_5632"
FT   gene            complement(339601..340710)
FT                   /db_xref="GeneID:5770989"
FT                   /locus_tag="Bmul_5633"
FT   CDS_pept        complement(339601..340710)
FT                   /locus_tag="Bmul_5633"
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: har:HEAR2039
FT                   alcohol dehydrogenase class III (glutathione-dependent
FT                   formaldehyde dehydrogenase) (FDH) (FALDH)"
FT                   /db_xref="GI:161522666"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="GeneID:5770989"
FT                   /translation="MKSRAAVAFGPGKPLEIVEIDVEPPRKGEVLVRITNTGVCHTDAF
FT                   TLSGEDPEGVFPAVLGHEGAGIVVEVGEGVTSVKPGDHVIPLYTAECGECLFCKSGKTN
FT                   LCVAVRATQGKGVMPDGTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPDANPEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAIFGLGGIGLAAIQGARQAKAGRIIAIDTNPA
FT                   KFELARTFGATECLNPKDFDKPIHEVLIEMTGWGVDHTFECIGNVNVMRSALEAAHRGW
FT                   GQSIVIGVAGAGKEISTRPFQLITGRTWKGSAFGGVKGRTQLPGMVEDAMKGEIDLAPF
FT                   VTHTMGLDDINKAFDLMHEGKSIRTVIHY"
FT                   /protein_id="YP_001585595.1"
FT   misc_feature    complement(339607..340710)
FT                   /note="class III alcohol dehydrogenases; Region:
FT                   alcohol_DH_class_III; cd08300"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(339604..340707)
FT                   /note="S-(hydroxymethyl)glutathione dehydrogenase/class III
FT                   alcohol dehydrogenase; Region: adh_III_F_hyde; TIGR02818"
FT                   /db_xref="CDD:131865"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(order(339772..339774,339844..339846,
FT                   340204..340206,340444..340449,340525..340527,
FT                   340552..340560,340585..340587,340591..340593))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(order(340204..340206,340522..340527,
FT                   340591..340593))
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(order(339619..339621,339769..339777,
FT                   339847..339852,339904..339909,339919..339924,
FT                   340042..340044,340054..340059,340117..340131,
FT                   340192..340194,340204..340206,340585..340590))
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(order(340393..340395,340417..340419,
FT                   340426..340428,340435..340437))
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   misc_feature    complement(order(339772..339789,339796..339804,
FT                   339811..339834,339841..339843,339868..339879,
FT                   339898..339903,339934..339936,339949..339951,
FT                   340390..340392,340396..340398,340402..340407,
FT                   340411..340413,340420..340425))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Bmul_5633"
FT   gene            complement(340770..340994)
FT                   /db_xref="GeneID:5770972"
FT                   /locus_tag="Bmul_5634"
FT   CDS_pept        complement(340770..340994)
FT                   /locus_tag="Bmul_5634"
FT                   /gene_family="HOG000023914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   har:HEAR2040 hypothetical protein"
FT                   /db_xref="GI:161522667"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:5770972"
FT                   /translation="MPHGPEEKKQALDAGAECPAILQQLAAVRGAVNGLMATVLESYLR
FT                   EEFPSSEIRSDSQNKSIDETISIVRSYLR"
FT                   /protein_id="YP_001585596.1"
FT   misc_feature    complement(340773..340994)
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:186220"
FT                   /locus_tag="Bmul_5634"
FT   gene            complement(341055..341798)
FT                   /db_xref="GeneID:5770973"
FT                   /locus_tag="Bmul_5635"
FT   CDS_pept        complement(341055..341798)
FT                   /locus_tag="Bmul_5635"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pmy:Pmen_4578 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:161522668"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:5770973"
FT                   /translation="MSNNISGKVVVITGASSGLGEATARHLAALGARVVLAARRKDKLD
FT                   ALVAELTNAGGQAIAYQTDVTSQEEVKTLIQGAVDTYGRIDVLINNAGLMAIAPLSDTR
FT                   TDEWDRMIDINIKGLLYGVAAALPVFQKQNSGHFINIASVAGLKVFSPGGTVYSGTKFA
FT                   VRAISEGLRHEVGGSIRTTTIEPGAVDSELKFGSTHQQSRDFVVDFYKHAIPAESVARA
FT                   IAFAIEQPADVDINEIVLRPTVQEF"
FT                   /protein_id="YP_001585597.1"
FT   misc_feature    complement(341058..341795)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="Bmul_5635"
FT   misc_feature    complement(341124..341789)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="Bmul_5635"
FT   gene            complement(341841..343046)
FT                   /db_xref="GeneID:5770974"
FT                   /locus_tag="Bmul_5636"
FT   CDS_pept        complement(341841..343046)
FT                   /locus_tag="Bmul_5636"
FT                   /gene_family="HOG000093866" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bvi:Bcep1808_6264
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="GI:161522669"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:5770974"
FT                   /translation="MQDTQQRDAVDVFVGVDVGKGHHHAVALDRNGKRLYNKALPNDEA
FT                   KLRALIAELKTHGRLLFVVDQPSTIGALPVAVARAEGVLVAYLPGLAMRRIADLHAGEA
FT                   KTDARDAAIIAEAARSMPHTLRSLRLADEQLAELTMLCGFDDDLAAQVTQTSNRIRGLL
FT                   TQIHPALERVLGPRLDHPAVLDLLERYPSPAALAGTSEKTLANRLTKLAPRMGKGLAAE
FT                   IVQALSEQAVTVPGTQAATIVMPRLAQQLAALRKQRDEIAAEVERLVLAHPLWPVLTSM
FT                   PGVGVRTAARLLTEVAHKSFASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKVLKRA
FT                   LFLSAFAALRDPVSRAYYSRKIQQGKRHNQALIALARRRCDVLFAMLRDGTIYQLKSAP
FT                   SA"
FT                   /protein_id="YP_001585598.1"
FT   misc_feature    complement(342522..342812)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="Bmul_5636"
FT   misc_feature    complement(341973..342218)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Bmul_5636"
FT   gene            343610..344730
FT                   /db_xref="GeneID:5770604"
FT                   /locus_tag="Bmul_5637"
FT                   /pseudo
FT   gene            344793..345011
FT                   /db_xref="GeneID:5770605"
FT                   /locus_tag="Bmul_5638"
FT   CDS_pept        344793..345011
FT                   /locus_tag="Bmul_5638"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative excinuclease ABC subunit A2 UvrA"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR2032 putative excinuclease ABC subunit
FT                   A2 UvrA"
FT                   /db_xref="GI:161522670"
FT                   /db_xref="GeneID:5770605"
FT                   /translation="MQLQRLVDAGNTVVMIEHDMRAVAQADWVIDVGPGAGAAGGSIVV
FT                   AGSPQQVARKSGSRTAPFLARELARAE"
FT                   /protein_id="YP_001585599.1"
FT   misc_feature    <344799..345002
FT                   /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
FT                   PRK00349"
FT                   /db_xref="CDD:178984"
FT                   /locus_tag="Bmul_5638"
FT   misc_feature    <344799..344876
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5638"
FT   misc_feature    344832..344852
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bmul_5638"
FT   gene            complement(345262..346251)
FT                   /db_xref="GeneID:5770606"
FT                   /locus_tag="Bmul_5639"
FT   CDS_pept        complement(345262..346251)
FT                   /locus_tag="Bmul_5639"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pfo:Pfl_2299 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="GI:161522671"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:5770606"
FT                   /translation="MARIVRIHEYGDASVLKLEDLEVSAPAANEVQISVKAIGLNRAEV
FT                   MFRNHAYLQEAEFPSRLGYEAAGVVTAVGSDVTEITIGDSVALIPPLDIARWGTYGELA
FT                   NVPAHLVVKSPENLSFEEAAASWMQYVTAWGALIEQAKLRQGDFVIVTAASSSVGLAAF
FT                   QIARMVGATSIAITRTRAKKQALLDAGAAHVIVSDEEDIVERVMTITAGQGARVVFDPV
FT                   GGPSFEPLTQSMARGGILLVYGALSSEPTPFPLFTVLGKSLTLKGYIYAEIVADPEALE
FT                   RAKAFILQGLKSGTLRPIIAKTFALSDIQDAHRFLEANQQIGKIVVTV"
FT                   /protein_id="YP_001585600.1"
FT   misc_feature    complement(345265..346248)
FT                   /note="Medium chain dehydrogenases/reductase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR2; cd08268"
FT                   /db_xref="CDD:176229"
FT                   /locus_tag="Bmul_5639"
FT   misc_feature    complement(345265..346248)
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="Bmul_5639"
FT   misc_feature    complement(order(345442..345450,345520..345525,
FT                   345580..345582,345586..345591,345661..345663,
FT                   345706..345708,345718..345723,345775..345780,
FT                   345784..345795,345856..345858,345886..345888,
FT                   346114..346116,346123..346131))
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176229"
FT                   /locus_tag="Bmul_5639"
FT   gene            complement(346464..346736)
FT                   /db_xref="GeneID:5771071"
FT                   /locus_tag="Bmul_5640"
FT   CDS_pept        complement(346464..346736)
FT                   /locus_tag="Bmul_5640"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein ArsR; KEGG: ppu:PP_2484
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="GI:161522672"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5771071"
FT                   /translation="MANPTRLAILNWLKDPRTVFPEQEVDPETVGVCVSIIQERTGLSQ
FT                   STTSLYLAALQRAQLVTSQRIGPWTYYKRHDENIDAFFKALQERI"
FT                   /protein_id="YP_001585601.1"
FT   misc_feature    complement(346509..346736)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5640"
FT   misc_feature    complement(order(346560..346562,346692..346694,
FT                   346701..346706,346713..346718,346725..346727,
FT                   346734..346736))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5640"
FT   misc_feature    complement(order(346521..346529,346542..346550,
FT                   346566..346571,346575..346580,346587..346592,
FT                   346596..346607,346632..346640,346719..346727))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5640"
FT   misc_feature    complement(order(346629..346631,346638..346640))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5640"
FT   gene            complement(346907..347890)
FT                   /db_xref="GeneID:5771072"
FT                   /locus_tag="Bmul_5641"
FT   CDS_pept        complement(346907..347890)
FT                   /locus_tag="Bmul_5641"
FT                   /gene_family="HOG000158692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="luciferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: luciferase family protein; KEGG: ppu:PP_2485
FT                   hypothetical protein"
FT                   /db_xref="GI:161522673"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="GeneID:5771072"
FT                   /translation="MYQPSTIPYQEHRGFKRTFRQGHLSLGLFFPLEAFEGDTPSMLDQ
FT                   VALAKRAEALGFSALWFRDVPLRDPSFGDVGQVFDPWVYLGYMAAHTTKIALGTASIAL
FT                   TLRNPLHTAKAAASIDQLSGGRLLLGVASGDRPVEFPAFSVDPEKRGETFQENLNVIRQ
FT                   AHRTHFEPIRWSHGELLGADLVPKPTTREIPLFVTGHSRQSLDWIARESHGWINYPRPP
FT                   KMQRLIVEDWRQETAKQCGAIYKPFLQSLYIDLVEHPPTPPSPIHLGFRLGRNHLLALL
FT                   DTLQEIGVDHVILNLKYGKRPAAEVIEELGKHIVPQFGAQEPDSSI"
FT                   /protein_id="YP_001585602.1"
FT   misc_feature    complement(346937..347833)
FT                   /note="luciferase-type oxidoreductase, BA3436 family;
FT                   Region: lucif_BA3436; TIGR03571"
FT                   /db_xref="CDD:163333"
FT                   /locus_tag="Bmul_5641"
FT   misc_feature    complement(347174..347821)
FT                   /note="Flavin-utilizing monoxygenases; Region:
FT                   Flavin_utilizing_monoxygenases; cl07892"
FT                   /db_xref="CDD:186707"
FT                   /locus_tag="Bmul_5641"
FT   misc_feature    complement(<346952..>347146)
FT                   /note="SIT4 phosphatase-associated protein; Region: SAPS;
FT                   pfam04499"
FT                   /db_xref="CDD:146907"
FT                   /locus_tag="Bmul_5641"
FT   gene            complement(347941..349061)
FT                   /db_xref="GeneID:5771073"
FT                   /locus_tag="Bmul_5642"
FT                   /pseudo
FT   gene            complement(349197..350336)
FT                   /db_xref="GeneID:5771053"
FT                   /locus_tag="Bmul_5643"
FT   CDS_pept        complement(349197..350336)
FT                   /locus_tag="Bmul_5643"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   ppu:PP_2486 NADH-dependent flavin oxidoreductase, Oye
FT                   family"
FT                   /db_xref="GI:161522674"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="GeneID:5771053"
FT                   /translation="MQATEMTQSELFKTTQLGPYTLKNRIVLPPLTRSRSSQPGNIAND
FT                   LMATYYRQRSGAGFMVTEGTQIEPRGQGYAWTPGIHSAEQIQGWRKVTDAVHAEGGVIF
FT                   AQLWHVGRVSHTSLQPGGEAPVAPSAIRADNVKVFIETGPGTGTLADPSTPRALSTKEV
FT                   KELVELYAQAARNALDAGFDGVELHCANGYLVNQFISAHTNQRDDEYGGSLQNRLRFLR
FT                   EITLAVAGVVGKERVGVRFAPLFATTDEDRVYLGLVEEDPHQTYIEAVKILEEVGIAYL
FT                   SLAEADWENAPELPETFREAVRKTFSGKIIYAGKYTAERANRVIKAGWADLIAFGRPFI
FT                   ANPDLPARIANNWPLNPVDPSSMYGGTDKGYTDYPTYKS"
FT                   /protein_id="YP_001585603.1"
FT   misc_feature    complement(349200..350321)
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="Bmul_5643"
FT   misc_feature    complement(349257..350309)
FT                   /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE
FT                   was the first flavin-dependent enzyme identified, however
FT                   its true physiological role remains elusive to this day.
FT                   Each monomer of OYE contains FMN as a non-covalently bound
FT                   cofactor, uses NADPH as a...; Region: OYE_like_FMN;
FT                   cd02933"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bmul_5643"
FT   misc_feature    complement(order(349323..349331,349335..349337,
FT                   349395..349397,349617..349619,350019..350021,
FT                   350145..350147,350241..350243,350247..350249))
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bmul_5643"
FT   misc_feature    complement(order(349326..349331,349335..349337,
FT                   349395..349397,349575..349577,349617..349619,
FT                   349758..349760,349764..349766,349773..349775,
FT                   349992..349994,350013..350015,350019..350021,
FT                   350145..350147,350241..350243,350247..350249))
FT                   /note="active site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bmul_5643"
FT   misc_feature    complement(order(349326..349328,349758..349760,
FT                   349764..349766,349773..349775,350013..350015,
FT                   350241..350243))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bmul_5643"
FT   misc_feature    complement(349758..349760)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:73381"
FT                   /locus_tag="Bmul_5643"
FT   gene            complement(350514..350651)
FT                   /db_xref="GeneID:5771054"
FT                   /locus_tag="Bmul_5644"
FT   CDS_pept        complement(350514..350651)
FT                   /locus_tag="Bmul_5644"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mca:MCA0907 ISMca2, transposase, OrfB"
FT                   /db_xref="GI:161522675"
FT                   /db_xref="GeneID:5771054"
FT                   /translation="MIDQVFAFHDAMAFYNYRRLHSSLGYLSPMQYEQRWHEVQRKKAA
FT                   "
FT                   /protein_id="YP_001585604.1"
FT   gene            complement(350816..351826)
FT                   /db_xref="GeneID:5771055"
FT                   /locus_tag="Bmul_5645"
FT   CDS_pept        complement(350816..351826)
FT                   /locus_tag="Bmul_5645"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ppf:Pput_2719 alcohol dehydrogenase. zinc-binding type 1"
FT                   /db_xref="GI:161522676"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="GeneID:5771055"
FT                   /translation="MKAIVFTEYGLPIDDPRALFDSELPEPTPGPHDLLVQVRAIAVNP
FT                   VDTKVRSGKGATPQPKVLGWDTVGVVRAVGSDVTLFQPGDEVFYAGAIDRPGSYSELHL
FT                   VDERIVGRKPRSLDDASAAALPLTSITAWELLFDRLGIGEHGGAGQSLLILGAGGGVGS
FT                   ILTQLARQLTGLKVIGTTSRPETREWVSALGAHHVIDHSRPLAEQLKHIGIEVVDYVIS
FT                   LTHTDSYLPQLIEVLRPQGHLALIDDPAVLDVVPLKRKSLALHWELMFTRSLYGTDDMI
FT                   KQHQLLNRVAELIDTGVLKTTVGEHFGRIEAANLRRAHALIESGKAMGKIVLEGF"
FT                   /protein_id="YP_001585605.1"
FT   misc_feature    complement(350825..351826)
FT                   /note="Arginate lyase and other MDR family members; Region:
FT                   AL_MDR; cd08252"
FT                   /db_xref="CDD:176214"
FT                   /locus_tag="Bmul_5645"
FT   misc_feature    complement(350819..351823)
FT                   /note="zinc-binding alcohol dehydrogenase family protein;
FT                   Region: adh_fam_1; TIGR02817"
FT                   /db_xref="CDD:163031"
FT                   /locus_tag="Bmul_5645"
FT   misc_feature    complement(order(351020..351028,351086..351091,
FT                   351149..351151,351155..351160,351224..351226,
FT                   351269..351271,351281..351286,351341..351346,
FT                   351350..351361,351434..351436,351446..351448,
FT                   351680..351682,351689..351697))
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176214"
FT                   /locus_tag="Bmul_5645"
FT   misc_feature    complement(order(350996..350998,351002..351004,
FT                   351011..351016,351023..351058,351062..351073,
FT                   351083..351085,351107..351112,351137..351139,
FT                   351410..351415,351425..351427))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176214"
FT                   /locus_tag="Bmul_5645"
FT   gene            351938..352861
FT                   /db_xref="GeneID:5770969"
FT                   /locus_tag="Bmul_5646"
FT   CDS_pept        351938..352861
FT                   /locus_tag="Bmul_5646"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppf:Pput_2720 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:161522677"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:5770969"
FT                   /translation="MVRIEDLQLFVRTAALGSFSNVAREVGLLPGQVAAAIKRLERELD
FT                   IRLFARSTRSLRLTAEGEQYLPFAREALHTLHEGQDRIRRESTQLQGLLQVSAPSDLGR
FT                   NMLLLWLSEFRRQHPALSLRLLISDQVADVFRDPVDVALRYGVFDDASWVALPLAPWNR
FT                   RVLVGAPDYLERNGRPQKPTDLAQHHCLLYSLNGRAHDRWPVGDQTVQVTGPLFSNDAD
FT                   IVRRLAVAGEGLAYKSWLDVRDDIEAGRLEIVLAHYQGEPTPLNLVCPHRKQYSPAVQQ
FT                   LHALLRSRLDPLKQELPPPGLNGSAK"
FT                   /protein_id="YP_001585606.1"
FT   misc_feature    351944..352825
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bmul_5646"
FT   misc_feature    351947..352126
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="Bmul_5646"
FT   misc_feature    352211..352777
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5646"
FT   misc_feature    order(352241..352243,352253..352255,352370..352372,
FT                   352412..352414,352421..352423,352598..352600,
FT                   352649..352651,352730..352732)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5646"
FT   misc_feature    order(352244..352249,352259..352264,352268..352273,
FT                   352280..352282,352292..352294,352298..352318,
FT                   352502..352504,352580..352594,352613..352618,
FT                   352625..352627)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bmul_5646"
FT   gene            complement(352917..353210)
FT                   /db_xref="GeneID:5770970"
FT                   /locus_tag="Bmul_5647"
FT   CDS_pept        complement(352917..353210)
FT                   /locus_tag="Bmul_5647"
FT                   /gene_family="HOG000145619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bxe:Bxe_A2683 hypothetical protein"
FT                   /db_xref="GI:161522678"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="GeneID:5770970"
FT                   /translation="MMYMPIIVVASITLQPGSRESAEAALRKAVARSRKEPGCDQYQLH
FT                   EDTEQPDRLVMIERWRDEAALQDHLEGPVFRELSETLEGHITLDVMKLSLLA"
FT                   /protein_id="YP_001585607.1"
FT   misc_feature    complement(352980..353198)
FT                   /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
FT                   cl10022"
FT                   /db_xref="CDD:186887"
FT                   /locus_tag="Bmul_5647"
FT   gene            353293..354255
FT                   /db_xref="GeneID:5770971"
FT                   /locus_tag="Bmul_5648"
FT   CDS_pept        353293..354255
FT                   /locus_tag="Bmul_5648"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   aav:Aave_3460 transposase, IS4 family protein"
FT                   /db_xref="GI:161522679"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:5770971"
FT                   /translation="MKQSSLGLGTSTKRTRRREFLDEMDRVVPWSDLVAQIAPFMPEGK
FT                   RGRPPFPVESLLRIHFMQQWFTLSDPAMEDALHDMPLFRDFAGLGGWDDRLPDESTILR
FT                   FPHVLEKHKLAERILATVNLLLGAKGLMLRSGTVVDATLISAPSSTKNASGERDPEMHQ
FT                   SKKGQQWFFGMKAHIGVDADSGLVHTVRGTSGNVNDVVEANSLLHGQETDAFADAGYQG
FT                   AHKRPDAKEDVQWHVAMRPGLRKLLDKADPADALTEQVERIKASIRAKVEHPFRVIKRQ
FT                   FGHVKVRYRGLAKNTAQLHTLFALANLWMVRKRLTGSLA"
FT                   /protein_id="YP_001585608.1"
FT   misc_feature    353431..353661
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bmul_5648"
FT   misc_feature    353467..354240
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bmul_5648"
FT   gene            354737..355045
FT                   /db_xref="GeneID:5771068"
FT                   /locus_tag="Bmul_5649"
FT                   /pseudo
FT   gene            complement(355103..356116)
FT                   /db_xref="GeneID:5771069"
FT                   /locus_tag="Bmul_5650"
FT   CDS_pept        complement(355103..356116)
FT                   /locus_tag="Bmul_5650"
FT                   /gene_family="HOG000063198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: neu:NE2511 AraC
FT                   type helix-turn-helix:ThiJ/PfpI family"
FT                   /db_xref="GI:161522680"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:5771069"
FT                   /translation="MTAIPIDNNDNFDIIVAMKLHILVCDGVFDLGLAALTDTVGLANA
FT                   MSGSLPQAPSRIELTLVGVRRRIRTAQGLTVPVLPVRGVPEPDVVLVPAFGDKMPDTLS
FT                   ARLTRPDLPDAVAALKQWSTAGAHLGAACSGSFLLAESGLLDGHRATTSWWLGPMFRQR
FT                   YPNVTLDESRMIVNSTRFTTAGAALAHVDLALRIIRGRSPALAALVARYLLVETRSSQA
FT                   EFVIPDHLAHADPMVERFECWARRRLAQGFSLAEAASAAGTSERTLARRLQSVLGKTPL
FT                   SYFQDLRVEHAVHLLRTGNASVDQVAAQVGYSDGVTLRALLRRKLGRGVRELRRGG"
FT                   /protein_id="YP_001585609.1"
FT   misc_feature    complement(355520..356059)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_2; cd03138"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bmul_5650"
FT   misc_feature    complement(355181..>355771)
FT                   /note="transcriptional activator FtrA; Provisional; Region:
FT                   ftrA; PRK09393"
FT                   /db_xref="CDD:181818"
FT                   /locus_tag="Bmul_5650"
FT   misc_feature    complement(355718..355720)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="Bmul_5650"
FT   gene            356180..356482
FT                   /db_xref="GeneID:5771070"
FT                   /locus_tag="Bmul_5651"
FT   CDS_pept        356180..356482
FT                   /locus_tag="Bmul_5651"
FT                   /gene_family="HOG000145619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neu:NE2512 hypothetical protein"
FT                   /db_xref="GI:161522681"
FT                   /db_xref="GeneID:5771070"
FT                   /translation="MTKLALFVRLEAKPGQEAALADFLASALPLANAESGTTAWFALKF
FT                   GPSTFGVFDAFADEAGRQAHLNGQIAAALMANAATLLSSPPNIEKVELLAAKLPA"
FT                   /protein_id="YP_001585610.1"
FT   gene            complement(356880..358418)
FT                   /db_xref="GeneID:5770984"
FT                   /locus_tag="Bmul_5652"
FT   CDS_pept        complement(356880..358418)
FT                   /locus_tag="Bmul_5652"
FT                   /gene_family="HOG000023133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bvi:Bcep1808_5525 integrase, catalytic region"
FT                   /db_xref="GI:161522682"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770984"
FT                   /translation="MYSYEDRVRAVELYLKLGKRVKATIRQLGYPTKNSLKAWCEEFEK
FT                   SGDLQKEYVRVKPKYSEEQKNLALEHYVNHGRSFSFTLRALGYPCRQILTAWVRERYPE
FT                   TRKRVVGKAGRPAVSLATRQLAVYELCTREGSAQAVAQKLDVDRVSLYNWKNQLLGRGA
FT                   PASMKRDKGSPSETDRDELERQVEELRRDIRNLKLEHDLLKKANELVKKDLGVDLSLLS
FT                   NREKTTLVDALREEYGLTELLERLDLARSSYFYHRSPIRVADKYADVRRTVAEIFEDNH
FT                   RSYGYRRVQAALSRQRVFLSEKVVRRLMKQGGLHAARPKRRRYRSYIGEISPAPDNIIN
FT                   RDFHANAPNEKWVTDISEFQIPAGKVYLSPMIDCFDGMVVSWSIGTSPDAELVNSMLDA
FT                   AIETVTEDDETPIVHSDRGGHYRWPGWLSRVAKAKLIRSMSRKACSPDNAACEGFFGRL
FT                   KTEMFYPGDWRSTTIAEFVEVLDAYVRWYNEKRIKGSLGYLSPIEYRESLGLAT"
FT                   /protein_id="YP_001585611.1"
FT   misc_feature    complement(356910..357683)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:177368"
FT                   /locus_tag="Bmul_5652"
FT   misc_feature    complement(357033..357389)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5652"
FT   gene            358624..360156
FT                   /db_xref="GeneID:5770985"
FT                   /locus_tag="Bmul_5653"
FT   CDS_pept        358624..360156
FT                   /locus_tag="Bmul_5653"
FT                   /gene_family="HOG000023904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="GI:161522683"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770985"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT                   /protein_id="YP_001585612.1"
FT   misc_feature    359041..359418
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5653"
FT   gene            360161..360949
FT                   /db_xref="GeneID:5770986"
FT                   /locus_tag="Bmul_5654"
FT   CDS_pept        360161..360949
FT                   /locus_tag="Bmul_5654"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bvi:Bcep1808_4315 IstB domain
FT                   protein ATP-binding protein"
FT                   /db_xref="GI:161522684"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:5770986"
FT                   /translation="MNPSPELNSILKQLRLSGILDSLEQRNRQAIDGQLAYTEFLAMLL
FT                   HDEVARREHKKLGTRLLRAGFAMGKTLETFDFDRLPTLNRSHVHDLATGRYLDEKVAIL
FT                   IAGPTGTGKSHLAQALGHCAARQGRDVLFISQTELLKRLNAARATGAYDRKFQQYARVP
FT                   LLIVDDFALKPLRTPQDEDFHDLVAARYEHAATILTSNLDFGEWGAAFPDNRILGTATL
FT                   DRLRHGAYRLVLEGDSYRTPKPMPDPPQNAVAKNGKKPQP"
FT                   /protein_id="YP_001585613.1"
FT   misc_feature    360161..360880
FT                   /note="transposase/IS protein; Provisional; Region:
FT                   PRK09183"
FT                   /db_xref="CDD:181681"
FT                   /locus_tag="Bmul_5654"
FT   misc_feature    360422..>360667
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5654"
FT   misc_feature    360479..360502
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5654"
FT   misc_feature    order(360482..360505,360662..360664)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5654"
FT   misc_feature    360650..360667
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bmul_5654"
FT   gene            361829..362215
FT                   /db_xref="GeneID:5770586"
FT                   /locus_tag="Bmul_5655"
FT   CDS_pept        361829..362215
FT                   /locus_tag="Bmul_5655"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bam:Bamb_6382 histone family protein
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:161522685"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:5770586"
FT                   /translation="MCRSWTEGLHLRSKPSRPLANLLNRSSFTYMATYLELKAQAEALA
FT                   QQAEEARIAELESIIATIREQIAEYGITPEQLFGRRRAPASGTRAPVAPKYRDPKTGAT
FT                   WSGRGKAPHWIANAKNRDRFLIEQ"
FT                   /protein_id="YP_001585614.1"
FT   misc_feature    362093..362206
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:186852"
FT                   /locus_tag="Bmul_5655"
FT   gene            362238..362462
FT                   /db_xref="GeneID:5770587"
FT                   /locus_tag="Bmul_5656"
FT   CDS_pept        362238..362462
FT                   /locus_tag="Bmul_5656"
FT                   /gene_family="HOG000263188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6383 hypothetical protein"
FT                   /db_xref="GI:161522686"
FT                   /db_xref="GeneID:5770587"
FT                   /translation="MPSTLHDGNYRAICRERTVLAAKAMGHGEVFPYAEMIVKVGWATF
FT                   TRDGVEVWNCSARYPQFNSTFSPLRNIRK"
FT                   /protein_id="YP_001585615.1"
FT   gene            362655..362981
FT                   /db_xref="GeneID:5770588"
FT                   /locus_tag="Bmul_5657"
FT   CDS_pept        362655..362981
FT                   /locus_tag="Bmul_5657"
FT                   /gene_family="HOG000024003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522687"
FT                   /db_xref="GeneID:5770588"
FT                   /translation="MTDTLRLSAFALPPTFPPESVPDACTCFVRECVPGLTKRQLLART
FT                   RARGWAPAWRPLAHLVREGFEAFAFDLIVDGTRVPVIAWMQRAGKDVGCVSVATRDPRQ
FT                   LPLF"
FT                   /protein_id="YP_001585616.1"
FT   gene            complement(363326..363613)
FT                   /db_xref="GeneID:5770574"
FT                   /locus_tag="Bmul_5658"
FT   CDS_pept        complement(363326..363613)
FT                   /locus_tag="Bmul_5658"
FT                   /gene_family="HOG000265486" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bam:Bamb_0139 transcriptional regulator, XRE family"
FT                   /db_xref="GI:161522688"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:5770574"
FT                   /translation="MDKELEQFQADLLESARQMKAGVAGRVTRVQPTEASIARAKVGMS
FT                   QSEFAGLLGVSVRTYQQWEQGRRNPTGAAQTLLRVAVQHPEALKDLQAAG"
FT                   /protein_id="YP_001585617.1"
FT   misc_feature    complement(363347..>363574)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Bmul_5658"
FT   gene            complement(363606..363938)
FT                   /db_xref="GeneID:5770575"
FT                   /locus_tag="Bmul_5659"
FT   CDS_pept        complement(363606..363938)
FT                   /locus_tag="Bmul_5659"
FT                   /gene_family="HOG000265475" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_0140 hypothetical protein"
FT                   /db_xref="GI:161522689"
FT                   /db_xref="GeneID:5770575"
FT                   /translation="MAYSCAMYTIIETPIFQRYADEIWRNDEREAFINWLADNPLAGDV
FT                   IPGTSGLRKVRWSRAGMGKRGGSRVIYYNLLDDGEIWLLIAYTKAKFDNLPTSFLNQLR
FT                   EEIDRG"
FT                   /protein_id="YP_001585618.1"
FT   gene            complement(364719..366650)
FT                   /db_xref="GeneID:5770576"
FT                   /locus_tag="Bmul_5660"
FT   CDS_pept        complement(364719..366650)
FT                   /locus_tag="Bmul_5660"
FT                   /gene_family="HOG000112359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: AAA-4 family protein; KEGG: sbm:Shew185_0048
FT                   putative transcriptional regulator"
FT                   /db_xref="GI:161522690"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="GeneID:5770576"
FT                   /translation="MALGESVDVEFKRAGGRDGKGEVPKEFWPTYSAMANTEGGEILLG
FT                   VEELKPTGIRPHNLANAAAMRQDIFNLVNNRQKVSANLLRDDDVQTIHIDHCTLLRVRV
FT                   PRASRKQRPIYVGENPLRGTYERRHEGDFLVDEAKVRQMLAEQSDAPRDATILAHYGIE
FT                   DLDLETVQAYRQIFASRVPTHPFIAQSLPDFLRAIQAWKKDRESGAEGLTTAGLLMFGK
FT                   LNSILDAVPNYIVDYQERPEARTEARWIDRLTTDSTWSGNLFDFYRKVLAKLTSDLKMP
FT                   FRLEGDVVRQGVTPIHEALQEALVNALVHADFSGRVSILVVKRPDMYGFRNPGLMRVPI
FT                   EQAIRGGDSDCRNRLIQKMFQLVGAGDQAGSGVPRIFGVWKEQSWRMPVVHEKREPEQT
FT                   LFELRMASLLPVEMVAQLEATHGAKFAELSALEKLIVVTASVEGYVDHKRIREITDEHP
FT                   ADITKTLSKLSREGLLSATGHGRGTVYFDTRQLDELLADAEAEVFAAPAGGLSTRPLAE
FT                   VFAPERVAPQPPNLDSGGLGASSEGFEPSSEGLISLPTASLDGARLVVLSRYPGGLPGK
FT                   MKPEALRELILELCAIEALSLRDLAALHDRSPDFIRIQYIRPLVVEGLIVPEFPDRPRH
FT                   PAQRYRRI"
FT                   /protein_id="YP_001585619.1"
FT   misc_feature    complement(365181..366644)
FT                   /note="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen [Transcription]; Region:
FT                   COG2865"
FT                   /db_xref="CDD:32692"
FT                   /locus_tag="Bmul_5660"
FT   misc_feature    complement(366255..366638)
FT                   /note="Divergent AAA domain; Region: AAA_4; pfam04326"
FT                   /db_xref="CDD:146784"
FT                   /locus_tag="Bmul_5660"
FT   gene            complement(367975..369060)
FT                   /db_xref="GeneID:5770856"
FT                   /locus_tag="Bmul_5661"
FT   CDS_pept        complement(367975..369060)
FT                   /locus_tag="Bmul_5661"
FT                   /gene_family="HOG000008439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: rha:RHA1_ro08602 transposase"
FT                   /db_xref="GI:161522691"
FT                   /db_xref="GeneID:5770856"
FT                   /translation="MRIAAKVELSEAQRKQLKTWATGRTIPVRLAERAKMILLAAQGKT
FT                   DKEISADLAIWRGTVARWRARFIADGVTGIERDETRPGRKPKISARKVKTVVALTTQQR
FT                   PDNATHWSTRSMAAVAGISEASVRRIWQAHGLKPHRLESFKVSNDKHFAEKLEDIVGLY
FT                   LDPPEHALVLCCDEKSQIQALDRTQPGLPLKRGRAQTMTHDYKRHGVTTLFAAMNTLDG
FT                   SVIGQCQTKHRHQEWLSFLRKIDRNTPKDKELHLIADNYATHKHPEVQAWLAKHPRFHM
FT                   HFTPTSASWLNMVERFFRDLSVNQLRRAAFRSVPELVSTIEQYVQKHNRHPKPFIWTAK
FT                   ASDILAKVTRARAKLNKMQSV"
FT                   /protein_id="YP_001585620.1"
FT   misc_feature    complement(368158..>368424)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5661"
FT   gene            complement(369158..369421)
FT                   /db_xref="GeneID:5770857"
FT                   /locus_tag="Bmul_5662"
FT   CDS_pept        complement(369158..369421)
FT                   /locus_tag="Bmul_5662"
FT                   /gene_family="HOG000263188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7149 hypothetical protein"
FT                   /db_xref="GI:161522692"
FT                   /db_xref="GeneID:5770857"
FT                   /translation="MLDARAIQENIVTKSGRPNPDLLPDGDYWATCRERNEMSAAINGH
FT                   SAVFPQARMTVAKGWAVFYRNGEEVWTCNARYAAANFNIQKA"
FT                   /protein_id="YP_001585621.1"
FT   gene            369960..370910
FT                   /db_xref="GeneID:5770858"
FT                   /locus_tag="Bmul_5663"
FT   CDS_pept        369960..370910
FT                   /locus_tag="Bmul_5663"
FT                   /gene_family="HOG000262914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7458 hypothetical protein"
FT                   /db_xref="GI:161522693"
FT                   /db_xref="GeneID:5770858"
FT                   /translation="MPRPATTTPDQIRSTVLAMLAEAGDATPATGARFRKLVSVRKLRA
FT                   RLGAGDPATLSRALNAIEAEVVRSGLSEIAIPGLPPEIAEQMHALWQAAVAVQLDDVVR
FT                   LKREAQEAIDAAEAARTDAEMRVELLRQEITELRSALTARDAELADVRAQHALVHERCA
FT                   TLDAAAVERQAALDAAVTKHAELDRAHVEALAAAQHRYEALSKQLLQETAHQREALKKE
FT                   HAQSASQLKFAERRIAALEAERDRLDGELAHEREARQQAVGEALALKAVNAQQHAQLGD
FT                   LLRDIAPKPSRATTHTGLASAKRTASGTAAKRKSK"
FT                   /protein_id="YP_001585622.1"
FT   gene            370953..372425
FT                   /db_xref="GeneID:5770890"
FT                   /locus_tag="Bmul_5664"
FT   CDS_pept        370953..372425
FT                   /locus_tag="Bmul_5664"
FT                   /gene_family="HOG000262915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bvi:Bcep1808_7459 phage
FT                   integrase family protein"
FT                   /db_xref="GI:161522694"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:5770890"
FT                   /translation="MSFADWIDIGATPPQRLPGEADAVTAYLTDALGHVVYTRWTLATV
FT                   KQRYPSLAEAKAAKPAVMRLLLDQSTAVEYWDRGRARAVPATEAPAPETIVERVLRAHA
FT                   RRFKRDPGDVSTSTIGEGKQESLLVAGLSGTLLQWVARAGRYANPGSATNTLGVGDDAQ
FT                   AIVLFLRDRGSRSTHTTRAYVTEICRLAAWCIAHELGPFSDLTRHDLLAYRRALHHPAR
FT                   DVNEDDARSLTAASQARALAVVASLFRYWTETGYLTANPAAGLVRGQRRHVGLASSRIL
FT                   TAAQLAACDAKVNEVMADIDPVVAARRRAIWMLYRYAGVRLVELVWSDDQKLPVAEVES
FT                   DGRWTLHVYGKGQKTRAIPLPQGCVSVLQAYRQLRGLPAHPESGERVALIHGLKGGSLQ
FT                   SSGLYDEVKAIFVAAAATLEYTDPGGAATLRRASPHWLRHAYARTLVVDRQVPLPAAQA
FT                   LLGHASIQTTAAYAKTDLSQLRAFVDRAFSSD"
FT                   /protein_id="YP_001585623.1"
FT   misc_feature    371475..372410
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:178942"
FT                   /locus_tag="Bmul_5664"
FT   misc_feature    371841..372368
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5664"
FT   misc_feature    order(371913..371918,372003..372005,372249..372257,
FT                   372363..372365)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5664"
FT   misc_feature    order(371913..371915,372003..372005,372255..372257,
FT                   372264..372266,372336..372338,372363..372365)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5664"
FT   misc_feature    order(371913..371915,372255..372257,372264..372266,
FT                   372336..372338,372363..372365)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5664"
FT   gene            complement(372422..372697)
FT                   /db_xref="GeneID:5770891"
FT                   /locus_tag="Bmul_5665"
FT                   /pseudo
FT   gene            complement(373050..374159)
FT                   /db_xref="GeneID:5770892"
FT                   /locus_tag="Bmul_5666"
FT   CDS_pept        complement(373050..374159)
FT                   /locus_tag="Bmul_5666"
FT                   /gene_family="HOG000240758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   bvi:Bcep1808_5560 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:161522695"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000759"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:5770892"
FT                   /translation="MPTHVDVVVIGGGQAGLATAYFLRRAGIDYIVLDDQSAPGGAWRH
FT                   TWESLHLFSPAEWSSLPGWQMPTSQDTYPSRNDVIDYLVNYEHRYHLPVQRSVHVEAVS
FT                   RTREGLLVTTDRGEWLAQAVVSAAGTWSAPYIPDYPGRELFRGRQVHSAQYRNPDDLRG
FT                   QNVLVVGGGNSGAQILAEISTVCNATWVTLHEPVFLPDDVDGRILFERATAKWKALRDG
FT                   QATGVAVGGLGDVVMVPPVRDARARGVLHAVRPFARFDADGVVWADGTHSRVDAVIWCT
FT                   GFRPALGHLDALQIRDADGLVATDGTRARDEPRLWLVGYGEWCGAASATLIGVMRSARD
FT                   TVREIAEYLRPTQEQVASAPPSMSGGGVH"
FT                   /protein_id="YP_001585624.1"
FT   misc_feature    complement(<373605..374141)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="Bmul_5666"
FT   gene            complement(374178..374588)
FT                   /db_xref="GeneID:5770847"
FT                   /locus_tag="Bmul_5667"
FT   CDS_pept        complement(374178..374588)
FT                   /locus_tag="Bmul_5667"
FT                   /gene_family="HOG000132115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5559 hypothetical protein"
FT                   /db_xref="GI:161522696"
FT                   /db_xref="GeneID:5770847"
FT                   /translation="MKALPILWQRLVTSGKTCPRCADTGEEVNRAIRQLREILLPLGIE
FT                   PVLERREIDEATFKATPAESNRIWIAGKPMEAWLNGTVGSSRCCSVCGDTECRTVEVEG
FT                   ASYEVIPEALLVKAGLIAALTLNAQGSKQDPS"
FT                   /protein_id="YP_001585625.1"
FT   misc_feature    complement(374232..374579)
FT                   /note="Protein of unknown function (DUF2703); Region:
FT                   DUF2703; pfam10865"
FT                   /db_xref="CDD:151314"
FT                   /locus_tag="Bmul_5667"
FT   gene            complement(374608..376371)
FT                   /db_xref="GeneID:5770848"
FT                   /locus_tag="Bmul_5668"
FT   CDS_pept        complement(374608..376371)
FT                   /locus_tag="Bmul_5668"
FT                   /gene_family="HOG000236816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: bvi:Bcep1808_4680 arsenite-activated ATPase
FT                   ArsA; TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="GI:161522697"
FT                   /db_xref="InterPro:IPR003348"
FT                   /db_xref="GeneID:5770848"
FT                   /translation="MSLPDTQTRYLFFTGKGGVGKTSLSCATGLAMADAGKKVLIVSTD
FT                   PASNLDEVLGVGLSQLPTAVPGAPGLFALNIDPEAAAHAYRERMVGPYRGILPTAAIRN
FT                   MEEQFSGACTVEIAAFDEFSKLLGDPAVTADFDHVIFDTAPTGHTLRLLTLPSAWNEFI
FT                   SSSTGGASCLGPLAGLEKQKALYAATVERLSSATETTVVLVSRPEVAALREANRTRHEL
FT                   AELGVRNQMLAINGLFATDRHDDAIATAMAERAQQALADMPRELAGLPQTRIPFLPRGT
FT                   VGLDALRDMAQPERVRMPSDCRMPETTLPPGLGGLVDELSIVGHGVIMTMGKGGVGKTT
FT                   VAAAIAVALAQRGHDVILSTTDPAAHVAATIDGVVPGLTVTRIDPAHEVRQYTEEVLAK
FT                   AGTALDAGGRAMLEEDLRSPCTEEIAVFRAFARAVDQGKSGFVVLDTAPTGHTILLLDA
FT                   AEAYHREVMRTQGDMPESVRQLLPRLRDPDYTRILIVTLPEATPVHEAERLRADLARAG
FT                   IEPYAWVINQSLLASGTTDPLLCQRGTYEVPFVRRVADDLAPRTALIPWLAEAPVGEAG
FT                   LEQVITSRMNT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585626.1"
FT   misc_feature    complement(375496..376350)
FT                   /note="Anion-transporting ATPase; Region: ArsA_ATPase;
FT                   pfam02374"
FT                   /db_xref="CDD:111283"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(375496..376347)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(order(375946..375948,376237..376239,
FT                   376303..376314,376318..376320))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73214"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(order(375532..375543,375610..375612,
FT                   375631..375633,375748..375750,375808..375810,
FT                   375901..375903,375907..375909,375919..375921,
FT                   375928..375930,376039..376041,376051..376053))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:73214"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(order(375928..375930,376033..376035))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:73214"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(374632..375327)
FT                   /note="Anion-transporting ATPase; Region: ArsA_ATPase;
FT                   pfam02374"
FT                   /db_xref="CDD:111283"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(374632..375327)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras...; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:186996"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(order(374662..374673,374737..374739,
FT                   374758..374760,374875..374877,374980..374982,
FT                   374992..374994,374998..375000,375010..375012,
FT                   375019..375021,375118..375120,375130..375132))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:73214"
FT                   /locus_tag="Bmul_5668"
FT   misc_feature    complement(order(375019..375021,375112..375114))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:73214"
FT                   /locus_tag="Bmul_5668"
FT   gene            complement(376381..376749)
FT                   /db_xref="GeneID:5770849"
FT                   /locus_tag="Bmul_5669"
FT   CDS_pept        complement(376381..376749)
FT                   /locus_tag="Bmul_5669"
FT                   /gene_family="HOG000276043" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /transl_table="11"
FT                   /note="PFAM: Arsenical resistance operon trans-acting
FT                   repressor ArsD; KEGG: bvi:Bcep1808_4681 arsenical
FT                   resistance operon trans-acting repressor ArsD"
FT                   /db_xref="GI:161522698"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="GeneID:5770849"
FT                   /translation="MKKLEVFDPAMCCSTGVCGVDVDPVLAQFAADLKWVEAHGVTVAR
FT                   YNLGQAPEAFAANAAVVKEMEAGMDRLPILVVDGHIVSTGMYPSRQQLTQKLGITLATG
FT                   EKPHVKAGSCCSPGSGCC"
FT                   /protein_id="YP_001585627.1"
FT   misc_feature    complement(376429..376749)
FT                   /note="Arsenical resistance operon trans-acting repressor
FT                   ArsD; Region: ArsD; pfam06953"
FT                   /db_xref="CDD:148524"
FT                   /locus_tag="Bmul_5669"
FT   gene            complement(376918..377655)
FT                   /db_xref="GeneID:5770850"
FT                   /locus_tag="Bmul_5670"
FT   CDS_pept        complement(376918..377655)
FT                   /locus_tag="Bmul_5670"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical resistance protein ArsH"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase; KEGG: bur:Bcep18194_C6565
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="GI:161522699"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="GeneID:5770850"
FT                   /translation="MRRASVSDHLNDLPQVDATLFRVPEASQLRTPAPSTHPPRFLLLY
FT                   GSLRERSFSRLLIEEAARLLTAMGGEVRVFNPSGLPLPDDAPESHPKVVELRELVQWSE
FT                   GMVWCSPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRV
FT                   LGRWMRMLTIPNQSSVAKAFMEFDDVGRMKPSAYFDRVVDVMEELVKFTLLTRDIGAYL
FT                   VDRYSERKESAEELARRVNQSNI"
FT                   /protein_id="YP_001585628.1"
FT   misc_feature    complement(376963..377619)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="Bmul_5670"
FT   gene            complement(377633..378055)
FT                   /db_xref="GeneID:5770851"
FT                   /locus_tag="Bmul_5671"
FT   CDS_pept        complement(377633..378055)
FT                   /locus_tag="Bmul_5671"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenate reductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: ajs:Ajs_1283 arsenate
FT                   reductase"
FT                   /db_xref="GI:161522700"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:5770851"
FT                   /translation="MTDITIYHNPNCGTSRNTLAMIRNSGAEPRVVHYLETPPSRGELV
FT                   DLIAAMGVPVRDVLRRKGTPYDELDLDNAKWSDADLIGFMLDHPILINRPIVVTPLGTR
FT                   LCRPSETVLDLLPNPQTGPFTKEDGEVVIDAEGKRV"
FT                   /protein_id="YP_001585629.1"
FT   misc_feature    complement(377711..378046)
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_5671"
FT   misc_feature    complement(order(377735..377737,377774..377776,
FT                   377876..377878,378020..378022))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_5671"
FT   gene            complement(378076..379212)
FT                   /db_xref="GeneID:5770852"
FT                   /locus_tag="Bmul_5672"
FT   CDS_pept        complement(378076..379212)
FT                   /locus_tag="Bmul_5672"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical-resistance protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bur:Bcep18194_C6563 putative
FT                   arsenate-sodium symporter"
FT                   /db_xref="GI:161522701"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="GeneID:5770852"
FT                   /translation="MAARRAARRQPFRTDPSSSSSPMNTSNVAPQGKAVAKPAINFFER
FT                   YLTVWVALCIVVGIALGQALPDLFQRIGRLEYAQVNLPVGLLIWVMIIPMLVKVDFGAL
FT                   HEVRQHIKGIGVTLVVNWLVKPFSMAFLGWLFIRHVFAPMLPADQLDSYIAGLILLAAA
FT                   PCTAMVFVWSRLTGGDPLFTLSQVALNDSIMVIAFAPLVGLLLGISAITVPWATLVTSV
FT                   VLYIVIPVILAQILRKALLSKGQAAFDAAMAKIGPWSITALLATLVLLFAFQGEAILKQ
FT                   PLVIALLAVPILIQVFFNSALAYWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLF
FT                   GFNSGAALATVVGVLIEVPVMLLVVRIVNQSKGWYECA"
FT                   /protein_id="YP_001585630.1"
FT   misc_feature    complement(378109..379095)
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Bmul_5672"
FT   gene            complement(379221..379715)
FT                   /db_xref="GeneID:5770853"
FT                   /locus_tag="Bmul_5673"
FT   CDS_pept        complement(379221..379715)
FT                   /locus_tag="Bmul_5673"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bur:Bcep18194_C6562 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="GI:161522702"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:5770853"
FT                   /translation="MTTNVLILCTHNSARSVLAEGMLNHWARKLDKDVRAYSAGSAPSG
FT                   RLNPFALEALTGAGVDVSGYRSKSWDEFVGDGAPEMHVVVTVCDSAASETCPYWPGSPV
FT                   KVHWGYADPSNAVGGDEGKRLAFELTRQAIGYRMLQLLMLPLDRLDHAALQRALTEISQ
FT                   N"
FT                   /protein_id="YP_001585631.1"
FT   misc_feature    complement(379314..379709)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5673"
FT   misc_feature    complement(379314..379709)
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bmul_5673"
FT   misc_feature    complement(order(379668..379676,379680..379685,
FT                   379689..379691))
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5673"
FT   gene            complement(379726..380220)
FT                   /db_xref="GeneID:5770854"
FT                   /locus_tag="Bmul_5674"
FT   CDS_pept        complement(379726..380220)
FT                   /locus_tag="Bmul_5674"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: ajs:Ajs_1281 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="GI:161522703"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:5770854"
FT                   /translation="MSDKRYNVLFVCTGNSARSILSEALMNQLGEGRFVAYSAGSHPKG
FT                   EVNPFALRELERWHLPTDGYRSKSWDEFAQSDAPTLDFVFTVCDKAAGEVCPVWPGQPM
FT                   TAHWGVPDPAEVEGSDERKQQVMHEVALTLKRRIDLLLSVPIAKLDNVALQKAVRDIGQ
FT                   Q"
FT                   /protein_id="YP_001585632.1"
FT   misc_feature    complement(379795..380205)
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bmul_5674"
FT   misc_feature    complement(379804..380205)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5674"
FT   misc_feature    complement(order(380164..380172,380176..380181,
FT                   380185..380187))
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5674"
FT   gene            complement(380430..380771)
FT                   /db_xref="GeneID:5770855"
FT                   /locus_tag="Bmul_5675"
FT   CDS_pept        complement(380430..380771)
FT                   /locus_tag="Bmul_5675"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bch:Bcen2424_3194 transcriptional regulator, ArsR family"
FT                   /db_xref="GI:161522704"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5770855"
FT                   /translation="METNFVVRALGALAQESRLAVFRLLVEAGPGGMPAGQIAERLGIA
FT                   PSSLSFHMKELTYSNLVTVEQRGRFMIYSANYATMNGLLGFLTENCCGGNPCTPVRPNA
FT                   CKTSQKDES"
FT                   /protein_id="YP_001585633.1"
FT   misc_feature    complement(380544..380738)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5675"
FT   misc_feature    complement(order(380553..380561,380574..380582,
FT                   380598..380603,380607..380612,380619..380624,
FT                   380628..380639,380664..380672,380718..380726,
FT                   380736..380738))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5675"
FT   misc_feature    complement(order(380592..380594,380691..380693,
FT                   380700..380705,380712..380717,380724..380726,
FT                   380733..380735))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5675"
FT   misc_feature    complement(order(380661..380663,380670..380672))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5675"
FT   gene            complement(380959..381387)
FT                   /db_xref="GeneID:5771021"
FT                   /locus_tag="Bmul_5676"
FT   CDS_pept        complement(380959..381387)
FT                   /locus_tag="Bmul_5676"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: psa:PST_0241
FT                   arsenic resistance transcriptional regulator"
FT                   /db_xref="GI:161522705"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5771021"
FT                   /translation="MCRAPDQELTWRKPELRLALRPMDKSTATTVFESLSSGVRLDVFR
FT                   LLVRKGEEGMVAGDIRVALDIPPTNLSFHLKAMTHAGLIHATQEGRFLRYRANLGMMID
FT                   LVAYLTEECCGGQPDRCGDFDVHAICPECTDQHELDGQ"
FT                   /protein_id="YP_001585634.1"
FT   misc_feature    complement(381094..381294)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5676"
FT   misc_feature    complement(order(381142..381144,381232..381234,
FT                   381250..381255,381262..381267,381274..381276,
FT                   381283..381285,381289..381294))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5676"
FT   misc_feature    complement(order(381103..381111,381124..381132,
FT                   381148..381153,381157..381162,381169..381174,
FT                   381178..381189,381214..381222,381268..381276,
FT                   381286..381291))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5676"
FT   misc_feature    complement(order(381211..381213,381220..381222))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5676"
FT   gene            381533..382318
FT                   /db_xref="GeneID:5771022"
FT                   /locus_tag="Bmul_5677"
FT   CDS_pept        381533..382318
FT                   /locus_tag="Bmul_5677"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_0475 ABC-type phosphate transport
FT                   system periplasmic component-like protein"
FT                   /db_xref="GI:161522706"
FT                   /db_xref="GeneID:5771022"
FT                   /translation="MRLKRLILSAAIALVATQSLSALADTVDVRGSTTVNSVLITPYAA
FT                   DIERLSGQKLKVTASNSGEGLTDLIGFSADIAMTSAPFKDVAEQLGKTPNLKGLKIDQN
FT                   EFNVVNLGHAEVLFIVNPSNKVAHLSQSQLVGLLTGKIANWKEIGGADQPVIRVSEQST
FT                   GAMRTEINRNLLDGKDFPTATKVVDLASQIPAVVAATPGAIGFMSSALPASQRADVRVI
FT                   PNDSKIEQTLFVITRPHPDANVESVISAIKGVASKALTH"
FT                   /protein_id="YP_001585635.1"
FT   sig_peptide     381533..381607
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT                   /locus_tag="Bmul_5677"
FT                   /product="hypothetical protein"
FT   misc_feature    381548..382246
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="Bmul_5677"
FT   gene            complement(382431..384920)
FT                   /db_xref="GeneID:5771023"
FT                   /locus_tag="Bmul_5678"
FT   CDS_pept        complement(382431..384920)
FT                   /locus_tag="Bmul_5678"
FT                   /gene_family="HOG000249382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenite oxidase, large subunit"
FT                   /EC_number="1.20.98.1"
FT                   /note="KEGG: rfr:Rfer_3084 arsenate reductase (azurin);
FT                   TIGRFAM: arsenite oxidase, large subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="GI:161522707"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="GeneID:5771023"
FT                   /translation="MATNKDRVALPPVQAQRTNLTCHFCIVGCGYHVFKWPENTEGGRA
FT                   PNQNALGLDFRKQLPPLSIVMTPAMQNTITDKDGRRYNIMVVPDKACSVNRGLSSTRGG
FT                   QLAKVMYSPDGGVAKERLRSPRVYLADQWMDTSWDDALALYAGLAKKILDRDGPSGLAF
FT                   DCFDHGGAGGGFENTWGTGKLMFTALKTPLVRIHNRPAYNSECHATREMGIGELNNSYE
FT                   DAELADVIMAIGCNSYETQTNYFLAHWMPNLQGQTLDKRKQRFPGESIEAARIIFVDPR
FT                   RTTTVAIAEHIAGKQNVLHLDIEPGTDIALFDGLLTYVVDQGWHDKAFIAAYTNGFDDA
FT                   VRTNRLSLDETSRITGVSVERLKQAADWAYKPKASGHRPRTMHAYEKGIIWGNDNYLIQ
FT                   SALVDVVLATHNVGRRGTGVVRMGGHQEGYTRPPYPGNTKIYVDQEIIHGKGMMYTAWG
FT                   ANPFQTTLNAEEHRAVILHRAGIVREAMSRERGASTAQLVDVAYDAVKNKGGLFFTNIN
FT                   LYPTKLAEAAHLMLPAAHPGEMNLTSMNGERRMRLSERFMDPPGSALPDCLIAAAIANT
FT                   LKQMYEAEGKHDMAARFGGFDWKTEEDAFNDGFRQAGQAGVGPIDSQGGKTGNLVTYAR
FT                   LRAMGNNGVQLPAKSYEGGKLIGTEMLYTDGKFDTADGKAQFKPAKWTGLPKPVADQKA
FT                   KYRFWINNGRVNEVWQTLYHDQYNEFVRERVPMAFLELNPDDAHSLDITSGDVVEVFND
FT                   YGSTYAMAYLEPSIKRGQTFMQFGHFNGIMGNVTTPWTDRNVVPYYKGTWANLRRVGDV
FT                   QDFKETVSFKSRRIDVT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585636.1"
FT   misc_feature    complement(382866..384905)
FT                   /note="Arsenite oxidase (Arsenite-Ox) oxidizes arsenite to
FT                   the less toxic arsenate; it transfers the electrons
FT                   obtained from the oxidation of arsenite towards the soluble
FT                   periplasmic electron carriers cytochrome c and/or
FT                   amicyanin.  Arsenite oxidase is a...; Region:
FT                   MopB_Arsenite-Ox; cd02756"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5678"
FT   misc_feature    complement(382494..384902)
FT                   /note="arsenite oxidase, large subunit; Region:
FT                   arsenite_ox_L; TIGR02693"
FT                   /db_xref="CDD:131740"
FT                   /locus_tag="Bmul_5678"
FT   misc_feature    complement(order(384192..384194,384615..384617,
FT                   384621..384623,384828..384830,384834..384839,
FT                   384846..384848,384855..384857))
FT                   /note="[3Fe-4S] binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5678"
FT   misc_feature    complement(order(383223..383225,383319..383324,
FT                   383367..383375,383529..383531,383541..383549,
FT                   383649..383651,383748..383750,383757..383765,
FT                   383997..383999,384003..384005,384078..384089,
FT                   384198..384206,384213..384221,384327..384332,
FT                   384405..384407,384615..384617))
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5678"
FT   misc_feature    complement(382494..382835)
FT                   /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
FT                   of the MopB superfamily of proteins, a  large, diverse,
FT                   heterogeneous superfamily of enzymes that, in general, bind
FT                   molybdopterin as a cofactor. The MopB domain is found in a
FT                   wide variety of molybdenum-; Region: MopB_CT; cl09929"
FT                   /db_xref="CDD:158784"
FT                   /locus_tag="Bmul_5678"
FT   misc_feature    complement(order(382521..382526,382569..382571,
FT                   382593..382595,382788..382799,382803..382808))
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30307"
FT                   /locus_tag="Bmul_5678"
FT   gene            complement(384932..385549)
FT                   /db_xref="GeneID:5770859"
FT                   /locus_tag="Bmul_5679"
FT   CDS_pept        complement(384932..385549)
FT                   /locus_tag="Bmul_5679"
FT                   /gene_family="HOG000253906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenite oxidase, small subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenite oxidase, small subunit; PFAM:
FT                   Rieske [2Fe-2S] domain protein; KEGG: har:HEAR0479 arsenite
FT                   oxidase small subunit precursor , Rieske type subunit, twin
FT                   arginine translocation peptide"
FT                   /db_xref="GI:161522708"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="GeneID:5770859"
FT                   /translation="MCAALQRNCCGRHDLDRNPIRTRIQTTRSSDAATEATMSLNRRQF
FT                   LKLTGGAATAATVAGAPSARAAQADAGRTTLPYTPKVIVRAGQLRENVPLAFTFPDASS
FT                   PCAVVKMGTPVPGGVGPQRDIVAFSVLCTHMGCPVSYDAATREFKCPCHFSTFDAEKAG
FT                   QMVSGQATEKLPAIVLDYNASDGTVRAIAVDGLIYGRQANLL"
FT                   /protein_id="YP_001585637.1"
FT   misc_feature    complement(384941..385318)
FT                   /note="Small subunit of Arsenite oxidase (ArOX) family,
FT                   Rieske domain; ArOX is a molybdenum/iron protein involved
FT                   in the detoxification of arsenic, oxidizing it to arsenate.
FT                   It consists of two subunits, a large subunit similar to
FT                   members of the DMSO reductase...; Region:
FT                   Rieske_ArOX_small; cd03476"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5679"
FT   misc_feature    complement(order(385085..385087,385091..385093,
FT                   385100..385102,385145..385150,385154..385156))
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5679"
FT   misc_feature    complement(order(385037..385060,385070..385072,
FT                   385076..385078,385088..385093,385112..385117,
FT                   385139..385141,385145..385153))
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5679"
FT   gene            complement(386456..386842)
FT                   /db_xref="GeneID:5770860"
FT                   /locus_tag="Bmul_5680"
FT   CDS_pept        complement(386456..386842)
FT                   /locus_tag="Bmul_5680"
FT                   /gene_family="HOG000252150" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   xau:Xaut_2890 protein of unknown function DUF302"
FT                   /db_xref="GI:161522709"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="GeneID:5770860"
FT                   /translation="MNYYFAKTLPIDFDDAVRRTTEVLKAEGFGIVTEIDIQDTLKRKI
FT                   NIDFRRYRILGACNPVLAHEALQIEDKVGTMLPCNVVVQDIGGGRTEVAAIDPVASMQA
FT                   IDNPRLKDAAARVQAKLRRVIEGL"
FT                   /protein_id="YP_001585638.1"
FT   misc_feature    complement(386549..386743)
FT                   /note="Domain of unknown function DUF302; Region: DUF302;
FT                   cl01364"
FT                   /db_xref="CDD:154354"
FT                   /locus_tag="Bmul_5680"
FT   gene            complement(386911..387591)
FT                   /db_xref="GeneID:5770861"
FT                   /locus_tag="Bmul_5681"
FT   CDS_pept        complement(386911..387591)
FT                   /locus_tag="Bmul_5681"
FT                   /gene_family="HOG000221626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c class I"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c class I; KEGG: ngo:NGO0101
FT                   putative cytochrome precursor"
FT                   /db_xref="GI:161522710"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR008169"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:5770861"
FT                   /translation="MFRLSAPILFAGFGAPFALGQIPPGPPGQPNFQSSGPAINDADRG
FT                   ARLAASKCAACHGADGNSTNAQYPKLAGQKAAYLYSQLWAFKDGYRRSEVMSGIAATLS
FT                   NADIADAVSFFSQQSVHPDPVKDPRLRADGERIFLYGARSGRVPACAMCHGSTSQAGMP
FT                   MMGMMPMMANVPSLNGQHSAYIVDQLNRFASGERQAMMMGGIAAALSDSDKKAIAEFLS
FT                   NLPR"
FT                   /protein_id="YP_001585639.1"
FT   sig_peptide     complement(387529..387591)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.990 at
FT                   residue 21"
FT                   /locus_tag="Bmul_5681"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(387178..387480)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="Bmul_5681"
FT   misc_feature    complement(386917..>387150)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="Bmul_5681"
FT   gene            complement(387784..388314)
FT                   /db_xref="GeneID:5770948"
FT                   /locus_tag="Bmul_5682"
FT   CDS_pept        complement(387784..388314)
FT                   /locus_tag="Bmul_5682"
FT                   /gene_family="HOG000266324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pnu:Pnuc_1676 conserved secreted protein with
FT                   internal repeats"
FT                   /db_xref="GI:161522711"
FT                   /db_xref="GeneID:5770948"
FT                   /translation="MKKLVVAVIAGLALSGQLLPASAAAQGTQTKKATPAQVPNTAEFD
FT                   KQLAQVQEQMKAMQAQMDQIRQTQDPQERQRLLQQHWATMQSAMNAMHGLWGPGMMGGP
FT                   GMMGGPGMMGGAGPGCCGGGWGHMGGYYSNLTPEQLRRRQYMSDQYLNMQQQMMNNMMW
FT                   NQQYWMGPPASSK"
FT                   /protein_id="YP_001585640.1"
FT   sig_peptide     complement(388243..388314)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.573 at
FT                   residue 24"
FT                   /locus_tag="Bmul_5682"
FT                   /product="hypothetical protein"
FT   gene            complement(388629..391568)
FT                   /db_xref="GeneID:5770949"
FT                   /locus_tag="Bmul_5683"
FT   CDS_pept        complement(388629..391568)
FT                   /locus_tag="Bmul_5683"
FT                   /gene_family="HOG000111179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   bvi:Bcep1808_7461 transposase Tn3 family protein"
FT                   /db_xref="GI:161522712"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:5770949"
FT                   /translation="MDHWRLAYLGMRHFPHELTEFELNTFFTFSARERALIDGRRSHLY
FT                   RLAVGLHLGFVRMTGRTLDAYKQVPKRLWHHLGEQLGIEPPDLGTLRALYDDRTDTLAD
FT                   HQKLAYKALGFRPMAEHQRRYVVRWLKERLSGRQDRSTALYDLKQWFYDHRVLIVQDRV
FT                   LRTLIVQAVQDVETALTNRLEASFGTATLDQWGVLLPRPEASGASLQQWLWSVPLRNST
FT                   NQMGDLFRKIERLTKLGVHDHWPAECNEAVVRHYARRCANRPPSVSKRIRQPVRRLEAA
FT                   CFVRYALCVATDQLLWMLSRWQRKIVNEARAKVDAARPDLKALLHHFATEVKALAVDTC
FT                   LSRDALAERLVELADTTLAQGGPSRASLVRAQLLTKQRVARAMLAKLLTLPFESQAPHP
FT                   VIGALEVLRTLYVCHVRELPTDVPVQLGRAWQAVVEGDDRANALLAFEWATLSALRVAL
FT                   RNGSVFVGHSFAFRSQATLLIPDAIWQAQRNHYYGHLKLPQDPEEFLAPVCEHLNEGLE
FT                   RLQQASVHGEVRVDRAIHLDAASAQRAEPAIEALRRAIFGTHPDGQLPRIILEIDSETR
FT                   FSWLLLGREPRSRIELLMVYAAVLAHGTSMSAAEVARMVPELSSGAIRQMMHRVADERV
FT                   LRQAADAVLEFMHRHPIGEHWGRADLASSDMMSLETTRTVWQARADPRRRTASIGIYTH
FT                   VRDRWGIFYDQPIILNERQAGAAIEGVIRQEGTDDVAQLAVDTHGYTDFAMGLARALGF
FT                   DLCPRLAHLRDRRLHVPVGFAVPDGLSAVVDCDVRLEAIGGIWDDFVRVVASVQSGHCT
FT                   AVQALTRFGSAARGQPLYDGGVALGRLFRTIFLIDYFTMPAFRTELQHVLNRGEALHTV
FT                   QRAIHQGKIPAELTRHRHSIMAVSSALSLLTNAVLAWNTMHMQQAVDRIETLGQLPVRP
FT                   EYLRRIAPTFLEGINLRGTFDFPVADFADRLMPSVAISEPVRGSHQARG"
FT                   /protein_id="YP_001585641.1"
FT   misc_feature    complement(388719..391481)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bmul_5683"
FT   misc_feature    complement(388764..389732)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bmul_5683"
FT   gene            complement(391874..392200)
FT                   /db_xref="GeneID:5770950"
FT                   /locus_tag="Bmul_5684"
FT   CDS_pept        complement(391874..392200)
FT                   /locus_tag="Bmul_5684"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /transl_table="11"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bvi:Bcep1808_7182 nitrogen regulatory protein P-II"
FT                   /db_xref="GI:161522713"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="GeneID:5770950"
FT                   /translation="MERKCVIAVLRPDVLAVLERRLGALHIHGMTVTNARGFGAHPNLF
FT                   ANDWTTEHIKIEIFTAAENVDALIEEIVTVANEQSGGDGVVAVVPVERFLRVRTATEAT
FT                   HDQT"
FT                   /protein_id="YP_001585642.1"
FT   misc_feature    complement(391904..392185)
FT                   /note="Nitrogen regulatory protein P-II; Region: P-II;
FT                   cl00412"
FT                   /db_xref="CDD:185979"
FT                   /locus_tag="Bmul_5684"
FT   gene            complement(392375..392725)
FT                   /db_xref="GeneID:5770942"
FT                   /locus_tag="Bmul_5685"
FT   CDS_pept        complement(392375..392725)
FT                   /locus_tag="Bmul_5685"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7177 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="GI:161522714"
FT                   /db_xref="GeneID:5770942"
FT                   /translation="MKTLIVTSAVLAAVFAMPAFAGKDMASMDMPTQAPAMKVSSSNAL
FT                   TDAEVKKVDAATGMVTLKHGALENVGMPPMTMAFKAKDLAMVKQIKEGDKVKVRVEEVN
FT                   GTLTIVKLEKRS"
FT                   /protein_id="YP_001585643.1"
FT   sig_peptide     complement(392660..392725)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT                   /locus_tag="Bmul_5685"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(392411..392584)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:186524"
FT                   /locus_tag="Bmul_5685"
FT   gene            complement(392722..395928)
FT                   /db_xref="GeneID:5770943"
FT                   /locus_tag="Bmul_5686"
FT   CDS_pept        complement(392722..395928)
FT                   /locus_tag="Bmul_5686"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CzcA family heavy metal efflux protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: bvi:Bcep1808_7176
FT                   heavy metal efflux pump, CzcA family"
FT                   /db_xref="GI:161522715"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:5770943"
FT                   /translation="MIARLIRWSIHNRFLVLLATVLVTGWGLYSVADTPLDALPDLSDT
FT                   QVIIKASYPGKAPQVIEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDKTDQY
FT                   WARSRVLEYLNQVQSRLPQGATVSLGPDATGVGWVYEYALVDRTGQHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVADALGKANQASGGSVV
FT                   ELAESEYMVRSSGYLRSLDDFRHVVLRTNDAGTPVLLGDVARIQIGPEMRRGIAELNGQ
FT                   GEVAGGVIVMRSGKNALKTIDAVKAKLADLKRSLPPGVEVVTTYDRSQLIERAVDNLKD
FT                   KLIEEFIIVGLVCAVFLFHLRSAFVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAFDHQFPDTRMTAAQRWELIATSAAEVGPALFFSLLIIT
FT                   LSFIPVFSLEGQEGKLFSPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPHENANPI
FT                   NRVLIRLYRPLLEATLRRPWAAIGLAVVALVLTIVPISRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAGKASELLQQTDRLIKTVPEVATVFGKSGRADTATDPAPLEMFETTIQFKPRSQ
FT                   WRPGMTPEKLVDELDRTVNVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTQID
FT                   RIATQVETAVKAVPGVTSVLAERLNGGRYIDVDIDRLAAARYGLSVADIQSVVSSAVGG
FT                   ENVGEVIAGRERFPINIRYPREIRDSLEKLRELPVVTDRGAQIQLGDVAHITIADGPPM
FT                   IRSENARLSGYVYVDIRNTDLQSAVKAMQTVVAHQVQLPPGYSIAWSGQFEYLERATAK
FT                   LSTVIPVTLVVIFVLLFLTFNSAADALLLMSTVPFALVGGFWLIWTLGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALSRRLEGGEPLTEPLLFDAIREGAVLRVRPKAMTVAVV
FT                   LAGLIPIMVGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWFLLQRRRARQANAAR
FT                   FPHAVPFGTKVPVNPTGEVQ"
FT                   /protein_id="YP_001585644.1"
FT   misc_feature    complement(392839..395928)
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="Bmul_5686"
FT   sig_peptide     complement(395830..395928)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 33"
FT                   /locus_tag="Bmul_5686"
FT                   /product="hypothetical protein"
FT   gene            complement(395925..397454)
FT                   /db_xref="GeneID:5770944"
FT                   /locus_tag="Bmul_5687"
FT   CDS_pept        complement(395925..397454)
FT                   /locus_tag="Bmul_5687"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bvi:Bcep1808_7175 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="GI:161522716"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:5770944"
FT                   /translation="MTKKPLVRAVLTVFAGAALLGAGYFAGTRHAATPAAAASTVAAWS
FT                   GDKLDPKTGRKVLYWHDPMVPNQHFDKPGKSPFMDMQLEPVYADEGGGSSGIKIDPGLQ
FT                   QNLGIRYTTVRRQDTAGGFDAVGTTQFDESRADVVQSRVTGYIDRLYANAPMQRIAKGA
FT                   PVASLFVPEWLAPQEEYLALQRGGMDASLLEASRARMRAMSIPDGIIASLDRTGKAQTH
FT                   VVLTSPEAGVVSELNVRDGAMVAPGQTLAKIAGLSKLWLIVEIPEALALNVQPGMTVDA
FT                   TFAGDPSQHFAGHIREILPGISTTSRTLQARLEIDNAALKLTPGMLMRVRVAGQKAVSR
FT                   LLVPSEAVITTGKRSVVIVKNGDGRLQPATVTVGNDIGNETEVLSGLNDGDTVVASGQF
FT                   LIDSEASLKSVLPRLEGGTGASAVAPASASAAAAQTYETTGKVEKVTAADITFSHQPVP
FT                   ALGWGAMTMAFNKPAPSAFPNVKAGQTVRFVFKQSDDGYQLTKVEPVGGPQ"
FT                   /protein_id="YP_001585645.1"
FT   sig_peptide     complement(397359..397454)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 32"
FT                   /locus_tag="Bmul_5687"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(396213..397304)
FT                   /note="copper/silver efflux system membrane fusion protein
FT                   CusB; Provisional; Region: PRK09783"
FT                   /db_xref="CDD:182073"
FT                   /locus_tag="Bmul_5687"
FT   misc_feature    complement(396696..>396785)
FT                   /note="Biotinyl_lipoyl_domains are present in
FT                   biotin-dependent carboxylases/decarboxylases, the
FT                   dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
FT                   dehydrogenases, and the H-protein of the glycine cleavage
FT                   system (GCS). These domains transport CO2...; Region:
FT                   Biotinyl_lipoyl_domains; cl11404"
FT                   /db_xref="CDD:187023"
FT                   /locus_tag="Bmul_5687"
FT   misc_feature    complement(395967..396137)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:186524"
FT                   /locus_tag="Bmul_5687"
FT   gene            complement(397466..398758)
FT                   /db_xref="GeneID:5770797"
FT                   /locus_tag="Bmul_5688"
FT   CDS_pept        complement(397466..398758)
FT                   /locus_tag="Bmul_5688"
FT                   /gene_family="HOG000125980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bvi:Bcep1808_7174 outer membrane efflux protein"
FT                   /db_xref="GI:161522717"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:5770797"
FT                   /translation="MPFIFGTPLRRRVPRRVHSLVAALLVAGVAHAQLAPFTLDAALQS
FT                   ATDRSLSMQAAQASVRASSEAAVKAGQLPDPMLKAGIDNLPINGPQRFTIGQDFMTMRR
FT                   IGIEQEWVSGDKRRLRSALADEMVGRERAGYLVQLANVRQQTATTWLNAVYAKQALALQ
FT                   QALLDHMHHEFAATKASYRGAKASAADVVQAQAMLAQTQDQVLKAQQAYQTALIGLSRW
FT                   TATPVSEVTGEPPAPESFVSSLPLDELRLSQPTLVAAADDIAVAEADTAVASSERSPNW
FT                   TWEVAYQQRGGAYSNMVSVGVTIPLPLNQKNRQNRDVAEKAELATKARLMYDDALRQVQ
FT                   ADIRTQSATLASGRERIANLSRLLLPAADQRVQLANAAYRAGSGSLADTFAARRAQLEA
FT                   QLQVLDLKREVSQTWAQLEYQVVPSTMAAAQ"
FT                   /protein_id="YP_001585646.1"
FT   sig_peptide     complement(398660..398758)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 33"
FT                   /locus_tag="Bmul_5688"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(398090..398644)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bmul_5688"
FT   misc_feature    complement(397502..397936)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bmul_5688"
FT   gene            complement(398850..399218)
FT                   /db_xref="GeneID:5770798"
FT                   /locus_tag="Bmul_5689"
FT   CDS_pept        complement(398850..399218)
FT                   /locus_tag="Bmul_5689"
FT                   /gene_family="HOG000125759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7173 hypothetical protein"
FT                   /db_xref="GI:161522718"
FT                   /db_xref="GeneID:5770798"
FT                   /translation="MKLLRTFILLLLCAVLPISGLAASGLTGECPMQQTMSMDADAGMP
FT                   ADAPGCDSMKPSSVDKAKAKGGFCKVTAQCQFGSLYHPAAKADISRPAVFGTPVVFHYI
FT                   QSLPVRDPNGLWRPPRLV"
FT                   /protein_id="YP_001585647.1"
FT   sig_peptide     complement(399150..399218)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.583 at
FT                   residue 23"
FT                   /locus_tag="Bmul_5689"
FT                   /product="hypothetical protein"
FT   gene            complement(399952..400769)
FT                   /db_xref="GeneID:5770799"
FT                   /locus_tag="Bmul_5690"
FT                   /pseudo
FT   gene            complement(400993..401148)
FT                   /db_xref="GeneID:5770713"
FT                   /locus_tag="Bmul_5691"
FT   CDS_pept        complement(400993..401148)
FT                   /locus_tag="Bmul_5691"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mes:Meso_4582 hypothetical protein"
FT                   /db_xref="GI:161522719"
FT                   /db_xref="GeneID:5770713"
FT                   /translation="MLQYALLKNHAGLLLCGDYNSLRELHEVVHEVNENSVLVMDKEGA
FT                   ALVPGI"
FT                   /protein_id="YP_001585648.1"
FT   gene            401753..402745
FT                   /db_xref="GeneID:5770714"
FT                   /locus_tag="Bmul_5692"
FT   CDS_pept        401753..402745
FT                   /locus_tag="Bmul_5692"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="GI:161522720"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:5770714"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT                   /protein_id="YP_001585649.1"
FT   misc_feature    401903..402130
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bmul_5692"
FT   misc_feature    401939..402712
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bmul_5692"
FT   gene            complement(403633..403992)
FT                   /db_xref="GeneID:5770715"
FT                   /locus_tag="Bmul_5693"
FT   CDS_pept        complement(403633..403992)
FT                   /locus_tag="Bmul_5693"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522721"
FT                   /db_xref="GeneID:5770715"
FT                   /translation="MNSTRGFKKPTIKDKGRAYVRLFQYFETPESWLEFLDQYAIETQT
FT                   FGSRWDADCEVRVIDRTTGDLAVVGLQVPNHIKYHTFAAERSFWNEWYSSATEKRHRVI
FT                   EVGYDRPSKDETVPR"
FT                   /protein_id="YP_001585650.1"
FT   gene            complement(404774..405718)
FT                   /db_xref="GeneID:5770565"
FT                   /locus_tag="Bmul_5694"
FT   CDS_pept        complement(404774..405718)
FT                   /locus_tag="Bmul_5694"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522722"
FT                   /db_xref="GeneID:5770565"
FT                   /translation="MTKRRKEPRQKANAGILSWHASDQPKVRAMPSQPALPAARVLAVK
FT                   TPAKLARESVTASKDVSLLNSPDRIVESVFRCDLKPNSSQKAVLDALFSGPLLLKALLK
FT                   QVDPKPRTSHDASMFLLRHRRELEPYLATSDRSDSVDLLTQLVIQWGSRSPTAIEIQFC
FT                   EDCTISGANEIYVPIPRLGGLAVFNESRLAEARYRSRYKPSFALVHSSLGYLIEIVFLR
FT                   REQTREVAPYVSGRLDLPTEGGSAPSIAKKSGRSETKTGRIQVARFVALFGALDRARAA
FT                   EARVGKNFVRPDFGTLEGRAVQGGLPSLGKRRR"
FT                   /protein_id="YP_001585651.1"
FT   gene            complement(405932..406501)
FT                   /db_xref="GeneID:5770566"
FT                   /locus_tag="Bmul_5695"
FT   CDS_pept        complement(405932..406501)
FT                   /locus_tag="Bmul_5695"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522723"
FT                   /db_xref="GeneID:5770566"
FT                   /translation="MDKVSKAPVIDGIDLSLAMTWSRHQQFAAYSGQVVRAHRYIEDLM
FT                   DVLLKDFRLRVCRNGKPTLRPTYHEKYKCLNRHWAKKSQAGRWVWEAVRLLNDCRNEMA
FT                   HGVSRSDAPPWRLARAQLKRYVEYVEKHGPDVVEPAAGVLPAGTFNTVTVVLALSIQRL
FT                   ALAERRAILQSDEEPHQRDALRALFE"
FT                   /protein_id="YP_001585652.1"
FT   gene            complement(407100..407282)
FT                   /db_xref="GeneID:5770567"
FT                   /locus_tag="Bmul_5696"
FT   CDS_pept        complement(407100..407282)
FT                   /locus_tag="Bmul_5696"
FT                   /gene_family="HOG000263143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5567 hypothetical protein"
FT                   /db_xref="GI:161522724"
FT                   /db_xref="GeneID:5770567"
FT                   /translation="MFDTMRRELSELMQRVKRATEWDTTIACGKVHLDEVSPEALAKHR
FT                   ADTQRIAELMAKYGL"
FT                   /protein_id="YP_001585653.1"
FT   gene            complement(407348..407860)
FT                   /db_xref="GeneID:5770791"
FT                   /locus_tag="Bmul_5697"
FT   CDS_pept        complement(407348..407860)
FT                   /locus_tag="Bmul_5697"
FT                   /gene_family="HOG000229102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7337 hypothetical protein"
FT                   /db_xref="GI:161522725"
FT                   /db_xref="GeneID:5770791"
FT                   /translation="MQLSDADLRRPPARSSTGTRPLGAILGTVQVPAHVIRLSDQLVGE
FT                   CYTAAEESDFSDQVETFAIPSWAKRDGAPWLPNLAALGYCHADSGYRGRDEQFVATAAV
FT                   DMHTDDEGLVLMVVLHNDGLTFRQGTVRHKPKAGDWFIFDDRLPHGVVEAPGRAAFLGW
FT                   NIPIIPL"
FT                   /protein_id="YP_001585654.1"
FT   gene            complement(407871..408221)
FT                   /db_xref="GeneID:5770792"
FT                   /locus_tag="Bmul_5698"
FT   CDS_pept        complement(407871..408221)
FT                   /locus_tag="Bmul_5698"
FT                   /gene_family="HOG000290185" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="toxin ChpB"
FT                   /transl_table="11"
FT                   /note="toxin of the ChpB-ChpS toxin-antitoxin system"
FT                   /db_xref="GI:161522726"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="GeneID:5770792"
FT                   /translation="MVKRVKFDRGDIVRVSLNRTIGREQQGDFRPALVLSPAAFNALGV
FT                   ALVAPITQGGEFARFAGFAVPLSGSGTETQGVALVNMVRMLDLEARGARTIERAPAEVV
FT                   EDALARLQSIIE"
FT                   /protein_id="YP_001585655.1"
FT   misc_feature    complement(407874..408221)
FT                   /note="PemK-like protein; Region: PemK; cl00995"
FT                   /db_xref="CDD:186293"
FT                   /locus_tag="Bmul_5698"
FT   gene            complement(408215..408466)
FT                   /db_xref="GeneID:5770793"
FT                   /locus_tag="Bmul_5699"
FT   CDS_pept        complement(408215..408466)
FT                   /locus_tag="Bmul_5699"
FT                   /gene_family="HOG000289070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG:
FT                   bvi:Bcep1808_7445 transcriptional regulator/antitoxin,
FT                   MazE"
FT                   /db_xref="GI:161522727"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:5770793"
FT                   /translation="MELKIQKWGNSAAVRLPAVLLEQMHASVGGSLNADVRPDGVLLTP
FT                   ARRKYALDELVAQCDAKAPFPADMAAWGEVRPVGREGW"
FT                   /protein_id="YP_001585656.1"
FT   misc_feature    complement(408218..408466)
FT                   /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
FT                   cl00877"
FT                   /db_xref="CDD:186236"
FT                   /locus_tag="Bmul_5699"
FT   gene            complement(408658..409338)
FT                   /db_xref="GeneID:5770779"
FT                   /locus_tag="Bmul_5700"
FT   CDS_pept        complement(408658..409338)
FT                   /locus_tag="Bmul_5700"
FT                   /gene_family="HOG000002983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: eba:p1B207
FT                   putative site-specific recombinase"
FT                   /db_xref="GI:161522728"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:5770779"
FT                   /translation="MSNTVTRAAVLSPCQIRHLLRVTEATSRHPARDAVILLLGMSVGM
FT                   RITEVAQLTVADVMFRSGALRTEVSLRAAITKGCRQRAVYFSSRKLVDAIERYLAFRVT
FT                   HELGTTLDKSRFRGLIPDLPLILSRKRYPYSLNRKKRFSADGQLMDYWAADSLQSYVTS
FT                   LYKAAGIKASSHSGRRTFATRLLGRGATIEQVQLLLGHESIDDTRRYIDVDREVLSRIL
FT                   EEAI"
FT                   /protein_id="YP_001585657.1"
FT   misc_feature    complement(408691..409311)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Bmul_5700"
FT   misc_feature    complement(408700..>409311)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5700"
FT   misc_feature    complement(order(408709..408711,408814..408822,
FT                   409108..409110,409198..409203))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5700"
FT   misc_feature    complement(order(408709..408711,408736..408738,
FT                   408805..408807,408814..408816,409108..409110,
FT                   409201..409203))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5700"
FT   misc_feature    complement(order(408709..408711,408736..408738,
FT                   408805..408807,408814..408816,409201..409203))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5700"
FT   gene            409545..409829
FT                   /db_xref="GeneID:5770780"
FT                   /locus_tag="Bmul_5701"
FT   CDS_pept        409545..409829
FT                   /locus_tag="Bmul_5701"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="SMART: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bch:Bcen2424_6900 histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:161522729"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:5770780"
FT                   /translation="MNIRLADVKKDEKQAYLAGVQERVALYGITEDELLRAAGFRKARK
FT                   RQAQAKYYDPSSGKQWSGFGPRPKWLEGKNLDDYLIERAAKPWWPGEDA"
FT                   /protein_id="YP_001585658.1"
FT   misc_feature    409554..409763
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bmul_5701"
FT   misc_feature    409668..409787
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:186852"
FT                   /locus_tag="Bmul_5701"
FT   gene            409960..410751
FT                   /db_xref="GeneID:5770781"
FT                   /locus_tag="Bmul_5702"
FT   CDS_pept        409960..410751
FT                   /locus_tag="Bmul_5702"
FT                   /gene_family="HOG000222339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6868 putative uncharacterized
FT                   conserved protein"
FT                   /db_xref="GI:161522730"
FT                   /db_xref="GeneID:5770781"
FT                   /translation="MCYSAKIQANYREYVRRYGAEMDIETFRRLFFARAAGSDIKIPKA
FT                   VDAALAGLDDEISGAIAAYRTHRASELESDLFKQRARLAAAEKKLATKVTKAASEDVRI
FT                   ATDKIEAAMRGLDDLRRTDLQERDARIYPGWYAPVLIELEGKRLIVPMRYRCRIPGWTE
FT                   ADERAKPGSYNSRVDSLSTAWRKVFGFTHGLLLVDAFFENVKRDGQNVVLRFDPTPPQQ
FT                   MQVACLWTRTEIPGGDDLWSFAAITDDPPPEVAAAGHDRCV"
FT                   /protein_id="YP_001585659.1"
FT   misc_feature    410275..>410745
FT                   /note="Uncharacterized ACR, COG2135; Region: DUF159;
FT                   cl03646"
FT                   /db_xref="CDD:186594"
FT                   /locus_tag="Bmul_5702"
FT   gene            412011..412517
FT                   /db_xref="GeneID:5770794"
FT                   /locus_tag="Bmul_5703"
FT   CDS_pept        412011..412517
FT                   /locus_tag="Bmul_5703"
FT                   /gene_family="HOG000253906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenite oxidase, small subunit"
FT                   /EC_number="1.20.98.1"
FT                   /note="KEGG: har:HEAR0479 arsenite oxidase small subunit
FT                   precursor , Rieske type subunit, twin arginine
FT                   translocation peptide; TIGRFAM: arsenite oxidase, small
FT                   subunit; PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="GI:161522731"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="GeneID:5770794"
FT                   /translation="MGLNRRQFLKLTGGAAAGVTVAGAPSAQAAQVDAGRTTLPYTPKV
FT                   IARAGQLRPNVPLAFTFPDASSPCAVVKMRTPVPGGVGPDKDIVAFSVLCTHMGCPVAY
FT                   DGTTREFNCPCHFSKFDAEKAGQMISGQATEKLPSIVLDYNASNGTVRAIAVDGLIYGR
FT                   QANLL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585660.1"
FT   sig_peptide     412011..412100
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT                   /locus_tag="Bmul_5703"
FT                   /product="hypothetical protein"
FT   misc_feature    412131..412508
FT                   /note="Small subunit of Arsenite oxidase (ArOX) family,
FT                   Rieske domain; ArOX is a molybdenum/iron protein involved
FT                   in the detoxification of arsenic, oxidizing it to arsenate.
FT                   It consists of two subunits, a large subunit similar to
FT                   members of the DMSO reductase...; Region:
FT                   Rieske_ArOX_small; cd03476"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5703"
FT   misc_feature    order(412293..412295,412299..412304,412347..412349,
FT                   412356..412358,412362..412364)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5703"
FT   misc_feature    order(412296..412304,412308..412310,412332..412337,
FT                   412356..412361,412371..412373,412377..412379,
FT                   412389..412412)
FT                   /note="subunit interaction site; other site"
FT                   /db_xref="CDD:58546"
FT                   /locus_tag="Bmul_5703"
FT   gene            412529..415018
FT                   /db_xref="GeneID:5770795"
FT                   /locus_tag="Bmul_5704"
FT   CDS_pept        412529..415018
FT                   /locus_tag="Bmul_5704"
FT                   /gene_family="HOG000249382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenite oxidase, large subunit"
FT                   /EC_number="1.20.98.1"
FT                   /note="KEGG: rfr:Rfer_3084 arsenate reductase (azurin);
FT                   TIGRFAM: arsenite oxidase, large subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="GI:161522732"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="GeneID:5770795"
FT                   /translation="MATNKDRVALPPVQAQRTNLTCHFCIVGCGYHVFKWPENVEGGRA
FT                   PNQNALGLDFRTQLPPLSIVMTPAMQNTITDKDGRRYNIMVVPDKTCSVNRGLSSTRGG
FT                   QLAKVMYNPDGGVAKERLRSPRIYLSDQWMDTSWEDALALYAGLTKKILDRDGPSVLAF
FT                   DCFDHGGAGGGFENTWGTGKLMFTALKTPLVRIHNRPAYNSECHATREMGIGELNNSYE
FT                   DAELADVIMAIGCNSYETQTNYFLAHWLPNLQGQTIDKRKQRFPGESVAAAKIIFVDPR
FT                   RTTTVAIAEKVAGKQNVLHLDIEPGTDIALFDGLLTYVVDQGWHDKAFVAEYTSAFDDA
FT                   LKTNRLSLDETSRITGVPVERLKQAAEWAYKPKASGHRPRTMHAYEKGIIWGNDNYLIQ
FT                   SALVDVVLATHNVGRRGTGVVRMGGHQEGYTRPPYPGNMKIYVDQEIIHGKGMMYTAWG
FT                   ANPFQTTLNAEEHRAVILHRAGIVREAMSRERGASTAQLVDVAYDAVKNKGGLFFANIN
FT                   LYPTKLAEAAHLMLPAAHPGEMNLTSMNGERRMRLSERFMDPPGSAMPDCLIAAAIANT
FT                   LKRMYEAEGKSDMAARFAGFDWKTEEDAFNDGFRQAGQAGVGPIDSQGGKTGNLVTYAR
FT                   LRAMGNNGVQLPAKSFEGGKLIGTEMLYMDGKFDTADGKAQFKPAKWTGLPKPVADQKA
FT                   KYKFWINNGRVNEVWQTLYHDQYNEFVRERVPMAFLELNPDDARSLGITSGDVVEVYND
FT                   YGSTYAMAYLEPAIKHGQTFMQFGHFNGIMGNVTTPWTDRNVVPYYKGTWANLRRVGSV
FT                   QDFKETVSFKSRRIDAT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001585661.1"
FT   misc_feature    412544..414583
FT                   /note="Arsenite oxidase (Arsenite-Ox) oxidizes arsenite to
FT                   the less toxic arsenate; it transfers the electrons
FT                   obtained from the oxidation of arsenite towards the soluble
FT                   periplasmic electron carriers cytochrome c and/or
FT                   amicyanin.  Arsenite oxidase is a...; Region:
FT                   MopB_Arsenite-Ox; cd02756"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5704"
FT   misc_feature    412547..414955
FT                   /note="arsenite oxidase, large subunit; Region:
FT                   arsenite_ox_L; TIGR02693"
FT                   /db_xref="CDD:131740"
FT                   /locus_tag="Bmul_5704"
FT   misc_feature    order(412592..412594,412601..412603,412610..412615,
FT                   412619..412621,412826..412828,412832..412834,
FT                   413255..413257)
FT                   /note="[3Fe-4S] binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5704"
FT   misc_feature    order(412832..412834,413042..413044,413117..413122,
FT                   413228..413236,413243..413251,413360..413371,
FT                   413444..413446,413450..413452,413684..413692,
FT                   413699..413701,413798..413800,413900..413908,
FT                   413918..413920,414074..414082,414125..414130,
FT                   414224..414226)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:73323"
FT                   /locus_tag="Bmul_5704"
FT   misc_feature    414614..414955
FT                   /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
FT                   of the MopB superfamily of proteins, a  large, diverse,
FT                   heterogeneous superfamily of enzymes that, in general, bind
FT                   molybdopterin as a cofactor. The MopB domain is found in a
FT                   wide variety of molybdenum-; Region: MopB_CT; cl09929"
FT                   /db_xref="CDD:158784"
FT                   /locus_tag="Bmul_5704"
FT   misc_feature    order(414641..414646,414650..414661,414854..414856,
FT                   414878..414880,414923..414928)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30307"
FT                   /locus_tag="Bmul_5704"
FT   gene            415163..415504
FT                   /db_xref="GeneID:5770796"
FT                   /locus_tag="Bmul_5705"
FT   CDS_pept        415163..415504
FT                   /locus_tag="Bmul_5705"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bch:Bcen2424_3194 transcriptional regulator, ArsR family"
FT                   /db_xref="GI:161522733"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5770796"
FT                   /translation="METNSVVRALGALAQESRLAVFRLLVEAGPGGLPAGQIAERLGIA
FT                   PSSLSFHMKELTYANLVTVEQRGRFMIYSANYAAMNDLLGFLTENCCGGNPCTPIGAGG
FT                   CKPSKENAS"
FT                   /protein_id="YP_001585662.1"
FT   misc_feature    415196..415390
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5705"
FT   misc_feature    order(415196..415198,415208..415216,415262..415270,
FT                   415295..415306,415310..415315,415322..415327,
FT                   415331..415336,415352..415360,415373..415381)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5705"
FT   misc_feature    order(415199..415201,415208..415210,415217..415222,
FT                   415229..415234,415241..415243,415340..415342)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5705"
FT   misc_feature    order(415262..415264,415271..415273)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bmul_5705"
FT   gene            415501..415980
FT                   /db_xref="GeneID:5770788"
FT                   /locus_tag="Bmul_5706"
FT   CDS_pept        415501..415980
FT                   /locus_tag="Bmul_5706"
FT                   /gene_family="HOG000050259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bpm:BURPS1710b_A0455 glyoxalase
FT                   family protein family"
FT                   /db_xref="GI:161522734"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:5770788"
FT                   /translation="MKRLHIHLSVEDLTASIRFYSALFASQPTVEKVDYAKWMLDDPRV
FT                   NFAISQRGAAPGLDHLGVQVENEAELAEMHARLSGAAVPVDEQIGTACCYARSDKYWAV
FT                   DPQGIAWETYQTLGDVPTFGESRNSQSAESNAEASACCSPARGKPIGVPVKSSCC"
FT                   /protein_id="YP_001585663.1"
FT   misc_feature    415504..415857
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_20; cd07254"
FT                   /db_xref="CDD:176677"
FT                   /locus_tag="Bmul_5706"
FT   misc_feature    order(415513..415515,415678..415680,415834..415836)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:176677"
FT                   /locus_tag="Bmul_5706"
FT   gene            415990..416484
FT                   /db_xref="GeneID:5770789"
FT                   /locus_tag="Bmul_5707"
FT   CDS_pept        415990..416484
FT                   /locus_tag="Bmul_5707"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: har:HEAR1963 arsenate reductase"
FT                   /db_xref="GI:161522735"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:5770789"
FT                   /translation="MSDKPYNVLFICTGNSARSILSEGLMNQLGNGRFVAFSAGSHPKG
FT                   EVNPFALRELARWHLPTDGYRSKNWDEFAAPGAPTLDFVFTVCDKAAGEVCPIWPGQPI
FT                   IAHWGVPDPAEVEGSDEQKQQAMHDAALTLKRRIDLLLSLPITELDNVALQKSVREIGQ
FT                   Q"
FT                   /protein_id="YP_001585664.1"
FT   misc_feature    416005..416415
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bmul_5707"
FT   misc_feature    416005..416331
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cl00105"
FT                   /db_xref="CDD:185794"
FT                   /locus_tag="Bmul_5707"
FT   misc_feature    order(416023..416025,416029..416034,416038..416046)
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5707"
FT   gene            416501..416995
FT                   /db_xref="GeneID:5770790"
FT                   /locus_tag="Bmul_5708"
FT   CDS_pept        416501..416995
FT                   /locus_tag="Bmul_5708"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bur:Bcep18194_C6562 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="GI:161522736"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:5770790"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKDVRAYSAGSAPSG
FT                   RLNPFALEALTNAGVDVDGYRSKSSDEFVGDGAPEMRVVITVCDSAAAETCPYWPGSPV
FT                   NVHWGYADPSNATGGDEGKRLAFELTRQAIGYRMLQLLALPLDRMSNAGLQTALIEISQ
FT                   N"
FT                   /protein_id="YP_001585665.1"
FT   misc_feature    416507..416929
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5708"
FT   misc_feature    416507..416929
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bmul_5708"
FT   misc_feature    order(416525..416527,416531..416536,416540..416548)
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bmul_5708"
FT   gene            417060..418133
FT                   /db_xref="GeneID:5770722"
FT                   /locus_tag="Bmul_5709"
FT   CDS_pept        417060..418133
FT                   /locus_tag="Bmul_5709"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical-resistance protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bur:Bcep18194_C6563 putative
FT                   arsenate-sodium symporter"
FT                   /db_xref="GI:161522737"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="GeneID:5770722"
FT                   /translation="MNTSNVAPPGKAVAKPAINFFERYLTVWVALCIVAGIALGQVLPG
FT                   LFQQIGRMEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRQHVKGIGVTLIVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVILAQIWRKVLLAKG
FT                   QAAFDAAMAKIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRA"
FT                   /protein_id="YP_001585666.1"
FT   misc_feature    417111..418097
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Bmul_5709"
FT   gene            418155..418577
FT                   /db_xref="GeneID:5770723"
FT                   /locus_tag="Bmul_5710"
FT   CDS_pept        418155..418577
FT                   /locus_tag="Bmul_5710"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenate reductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: bur:Bcep18194_C6564 arsenate
FT                   reductase"
FT                   /db_xref="GI:161522738"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:5770723"
FT                   /translation="MTDITIYHNPNCGTSRNTLALIRNSGEEPIIIEYLKTPPSRETLV
FT                   KLLADAGLTVREVLREKGTPYAELGLDDPKWTDEQLLDLIGQHPILMNRPIVVTPIGTK
FT                   LCRPSEAVLDILPNPQKGSFTKEDGEVVINAEGKRV"
FT                   /protein_id="YP_001585667.1"
FT   misc_feature    418164..418499
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_5710"
FT   misc_feature    order(418188..418190,418332..418334,418434..418436,
FT                   418473..418475)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bmul_5710"
FT   gene            418555..419292
FT                   /db_xref="GeneID:5770724"
FT                   /locus_tag="Bmul_5711"
FT   CDS_pept        418555..419292
FT                   /locus_tag="Bmul_5711"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arsenical resistance protein ArsH"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase; KEGG: bur:Bcep18194_C6565
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="GI:161522739"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="GeneID:5770724"
FT                   /translation="MRRASVSEQLKDLSQLDATHFRVPDAAELRPAAPSTHPPRLLLLY
FT                   GSLRERSFSRLLVEEAERLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELRELVMWSE
FT                   GMVWCSPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRV
FT                   LGRWMRMLTIPNQSSVAKAFAEFDEAGRMKPSSYYDRVVDVMEELVKFTLLTRDIGPYL
FT                   VDRYSERKESAEELSKRVNQRSI"
FT                   /protein_id="YP_001585668.1"
FT   misc_feature    418591..419247
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="Bmul_5711"
FT   gene            419315..419743
FT                   /db_xref="GeneID:5770881"
FT                   /locus_tag="Bmul_5712"
FT   CDS_pept        419315..419743
FT                   /locus_tag="Bmul_5712"
FT                   /gene_family="HOG000236614" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C6566 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:161522740"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:5770881"
FT                   /translation="MEIRPATVDDLASIETLLHQCGLPVVGVSDHLQDFVVAMEGSTMC
FT                   GCGGIEHYRDAALLRSIAVAEHARGSGVGQRIVSQLVAACHSLQVRSLVLLTTTAENYF
FT                   TRQGFVRVARDDVPPLVLASSQFQGVCPGSAASMLRVL"
FT                   /protein_id="YP_001585669.1"
FT   misc_feature    419315..419740
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:185998"
FT                   /locus_tag="Bmul_5712"
FT   gene            complement(419883..420320)
FT                   /db_xref="GeneID:5770882"
FT                   /locus_tag="Bmul_5713"
FT   CDS_pept        complement(419883..420320)
FT                   /locus_tag="Bmul_5713"
FT                   /gene_family="HOG000024005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_1146 TetR family transcriptional
FT                   regulator-like protein"
FT                   /db_xref="GI:161522741"
FT                   /db_xref="GeneID:5770882"
FT                   /translation="MSTRAGTTPAEPQTESAPRRRSRGKTREELQLAMLRVKNKGLKLS
FT                   ISAVATEAGVSAGLIHNTYPDIAEEIRAQVGRGTRQQRDAKVAEVKEVRGRLKALRMER
FT                   DAALADVARLASINETLRQEVAMLRAAASGKMVVLPPQMDV"
FT                   /protein_id="YP_001585670.1"
FT   gene            complement(420317..422269)
FT                   /db_xref="GeneID:5770883"
FT                   /locus_tag="Bmul_5714"
FT   CDS_pept        complement(420317..422269)
FT                   /locus_tag="Bmul_5714"
FT                   /gene_family="HOG000296359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pap:PSPA7_0097 site-specific recombinase,
FT                   phage integrase family protein"
FT                   /db_xref="GI:161522742"
FT                   /db_xref="GeneID:5770883"
FT                   /translation="MSHTSALVLGTPQEHAEDLVVPVGSMPAPRALRAFELLAAQPISL
FT                   VGIPPAERDAIVVTAVADAAGHEHPVSRFGDRVWDLASEVEAKNRKGSASKIVWPDDVP
FT                   NALVDDAKAALYCAQRRGPRGRQWSGSSIAEIGHRAVQVLRHLAQLGLGDFSQVRALHL
FT                   SDHITDLRRTLKPMSVHKRLQIIDLVWSFHMEVLHPLPEHPWMGLALWDVCGGNEGDRG
FT                   PSGRTGMTPVIPRSVQRILFAHCEASLAQAEDLFWARDAGEVGAPNRAALTAIRNAVLY
FT                   LLQISSGMRNSESTGVTSGCWRTEQRNGVTYHWVRTREIKTTGGAEVDFLVPPEAISAL
FT                   EILQRYAEPLQARLADEARWLEDVLAQGPDLTGHLSNGMKMAEAAHRLNHVRGIGRHLV
FT                   LGLNVKASDHLGTGSRVEVLSSTSCAYQLKQLAVAAGTEWDLANHQCRRTFAYNVANSR
FT                   LGRMGLVFLKWQLKHASMSWTQLYAASPYQDHALYREFEEEMFEARLGLLEGWAHPDAL
FT                   LSGGAGKKIMQTRARAARDLKQLLRQTAESVELRSTGHAWCISGTHGCHGQGVYDPSMC
FT                   GGCSQAIIDQGQASAWQMIHLDNLRLAAITDCGPVVADKARRAVERSKQVLHNLGCALP
FT                   TDDQAQAYTAAREGA"
FT                   /protein_id="YP_001585671.1"
FT   misc_feature    complement(420821..>421021)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5714"
FT   misc_feature    complement(order(420824..420826,420938..420946))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5714"
FT   misc_feature    complement(order(420824..420826,420851..420853,
FT                   420929..420931,420938..420940))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5714"
FT   misc_feature    complement(order(420824..420826,420851..420853,
FT                   420929..420931,420938..420940))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5714"
FT   gene            complement(422266..423240)
FT                   /db_xref="GeneID:5770258"
FT                   /locus_tag="Bmul_5715"
FT   CDS_pept        complement(422266..423240)
FT                   /locus_tag="Bmul_5715"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_7152 hypothetical protein"
FT                   /db_xref="GI:161522743"
FT                   /db_xref="GeneID:5770258"
FT                   /translation="MFDARHRELVCEAPPALKQRIWLYRAEASAGSIKRGNITCLDSRS
FT                   LRRAIQGVIQRHNLLGDDGLPLRLNLSRLRKSRFDRALRTADGDIATTANLMGNTPRVA
FT                   GANYPSMNAARKAEAASFMNGDYTALMRTEGQAPRGPEIQPVQVRPFRLGKDGASALPT
FT                   PTPVSACSDSISGEHAPNDGHSHCDRYVMCLFCSSFAIVGTVDELWRLFSFQMFAQAEL
FT                   DYLDEALGPERTADGLLEDLRDRYRVAIPYIDDFTQRQFARSGVAQARARTASGLHPYW
FT                   QHQMTMSSRARSRVLAPEPHDDASQSVAVGLQARRTRRAGPRA"
FT                   /protein_id="YP_001585672.1"
FT   gene            423422..424936
FT                   /db_xref="GeneID:5770259"
FT                   /locus_tag="Bmul_5716"
FT   CDS_pept        423422..424936
FT                   /locus_tag="Bmul_5716"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bxe:Bxe_B0125 integrase, catalytic region"
FT                   /db_xref="GI:161522744"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770259"
FT                   /translation="MPGRHINDHQMRLYMKYRLKEGPPQAAARAGFSAATGYRIEEDPR
FT                   LPSQKKAPRGRRRADPLAAIFDTEIVPLLQSAPGIRPIAVLDEMLRRHPDLPGNVRRTL
FT                   ERRIRDWRALHGEEHDVMFRQVHQPGQLGLSDFTEMDSLGVTVAGVTLDHRLYHFRLAC
FT                   SGFEHAHVILGGESYVALAEGLQNAIWALGGAPREHRSDSLSAAFRNLDADARKDLTTR
FT                   YDALCAHYGMQPTRNNRGVAHENGSIESPHGHLKSAVRDALLLRGSHDFDDLGSYRRFI
FT                   DEIVGRINARNGKRIEVERALLQPLPVQRTCDYEETRVYVTTTCGFVLRKVFYTVPSRL
FT                   IGHHLRVRLYDDRLELFLGGTALMTLQRGRAGPNGKHGHVINYRHVIHALRRKPMALLN
FT                   LVYRDQVFPREAYRLSFDRLLEQLPERQACRTMVELLSLAHEHNCEAQLAEALQQCLDD
FT                   GQLPDLDALCSRFEAKPTSSMPEVNIQLAALSDYEALLDMATEVAA"
FT                   /protein_id="YP_001585673.1"
FT   misc_feature    423794..424189
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5716"
FT   gene            424933..425784
FT                   /db_xref="GeneID:5770260"
FT                   /locus_tag="Bmul_5717"
FT   CDS_pept        424933..425784
FT                   /locus_tag="Bmul_5717"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B0126 putative
FT                   transposase-associated ATP-binding protein"
FT                   /db_xref="GI:161522745"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:5770260"
FT                   /translation="MSLDIDVTRLSLLLNDLRLPAIKQIWSSFAERSDAEGWPAARLLM
FT                   ALAEHEIAERDRRRVERHLKDAKLLPGKTLENFDFDAVPMVSRAHVSALCAGDGWLRNG
FT                   TNLILLGPSGGGKSHLSSAIGLSLLEKGWKVLFARTTDLVQRLQVARRELALESAINRL
FT                   DRFDLVVLDDFAYVSKDQAETSVLFELISARYERRSLCITANQPFGEWDKVFPDRAMTV
FT                   AAVDRLVHHSTIFELNVESYRRRTALQRKQQGPGRPASRATPKNVGVPPTQEDQHGIDL
FT                   TE"
FT                   /protein_id="YP_001585674.1"
FT   misc_feature    424945..425730
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Bmul_5717"
FT   misc_feature    425101..425637
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bmul_5717"
FT   gene            425886..426088
FT                   /db_xref="GeneID:5770289"
FT                   /locus_tag="Bmul_5718"
FT                   /pseudo
FT   gene            complement(426089..427060)
FT                   /db_xref="GeneID:5770290"
FT                   /locus_tag="Bmul_5719"
FT   CDS_pept        complement(426089..427060)
FT                   /locus_tag="Bmul_5719"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_6215 hypothetical protein"
FT                   /db_xref="GI:161522746"
FT                   /db_xref="GeneID:5770290"
FT                   /translation="MGRTKNYNVSENRAAPVGATSASRESPRASADDTCIDMATLLGRE
FT                   ARFPQRIKTLDLRDWLGRGIDDWVCTSGFCLKAMLLSGARATASVTTYFGQLHYLFEYL
FT                   TGSSQTSVPPRPKLPSDLSPQHVQHFIGWLQKRAQAADWRPSSTRNTYRAVKTVLTEMF
FT                   VQGFIEGEPSRFFRHSALPWSCEDSLQTSLSDAEQERLAKAIKSDLVDVHHGRLPLKQG
FT                   AVQGLRLLLVAHRQGLNPTPLLEMCRDALAPGFLPGTIRMRTAKHRSKKVRSSIGRAAL
FT                   ERQASTQPSEPPAEQDLCFDLSEGAVLQQAIASTRDVARQSG"
FT                   /protein_id="YP_001585675.1"
FT   gene            complement(427075..428253)
FT                   /db_xref="GeneID:5770291"
FT                   /locus_tag="Bmul_5720"
FT   CDS_pept        complement(427075..428253)
FT                   /locus_tag="Bmul_5720"
FT                   /gene_family="HOG000225764" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: psp:PSPPH_1149
FT                   site-specific recombinase, phage integrase family"
FT                   /db_xref="GI:161522747"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:5770291"
FT                   /translation="MRYVRATEEFVFAGRPRPGFPLILDDSMTPAQPFHDYLLYRLLER
FT                   GKTLDPKTWEAYGRRLWDFARFLQANDWSWNDPFMSVGQSVVRVYRDWQAQDLKLDPAT
FT                   VNDRLRLVAAMYQWAHERGRIDRLPFGCSDIAVYGIEHDLAHVTGGRKTLSRPAVLLNE
FT                   WDKEPAFLTVDQLKIARQSIRSASQRLLFDLMARVGLRSVEARTFPLSYVFDPSAQKAL
FT                   KPGTFIEVRLDPRDMEIKLNKARVVHVPYSLMEDMYAYTTYERNGLVGAAERKELVLTI
FT                   HGQRYSKEAAVKVCTDLSNRVGFRVRPLMLRHSYAIHTLLLLRSRPEIKLEPLMYVRDR
FT                   LGHASVQTTMVYLQQIERLLGAEALAMMDEFDRLYGVSKALASAPQVSTVDP"
FT                   /protein_id="YP_001585676.1"
FT   misc_feature    complement(427192..428148)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Bmul_5720"
FT   misc_feature    complement(427198..428148)
FT                   /note="Site-specific recombinase XerD [DNA replication,
FT                   recombination, and repair]; Region: XerD; COG4974"
FT                   /db_xref="CDD:34580"
FT                   /locus_tag="Bmul_5720"
FT   misc_feature    complement(order(427198..427200,427327..427335,
FT                   427534..427536,427648..427653))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5720"
FT   misc_feature    complement(order(427198..427200,427225..427227,
FT                   427318..427320,427327..427329,427534..427536,
FT                   427651..427653))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5720"
FT   misc_feature    complement(order(427198..427200,427225..427227,
FT                   427318..427320,427327..427329,427651..427653))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bmul_5720"
FT   gene            complement(428250..428549)
FT                   /db_xref="GeneID:5770520"
FT                   /locus_tag="Bmul_5721"
FT   CDS_pept        complement(428250..428549)
FT                   /locus_tag="Bmul_5721"
FT                   /gene_family="HOG000024006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: net:Neut_2619 hypothetical protein"
FT                   /db_xref="GI:161522748"
FT                   /db_xref="GeneID:5770520"
FT                   /translation="MRPVDNSELERLRGLAVLDVLHLMAEHTKLDRDFAPVRAFNTRRV
FT                   HVTAAGADWELLVDGARFFDTRERKGGGGAVDLVMHLWRVPFKQAVKMLREAGA"
FT                   /protein_id="YP_001585677.1"
FT   gene            complement(428793..429335)
FT                   /db_xref="GeneID:5770521"
FT                   /locus_tag="Bmul_5722"
FT   CDS_pept        complement(428793..429335)
FT                   /locus_tag="Bmul_5722"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522749"
FT                   /db_xref="GeneID:5770521"
FT                   /translation="MDSFVALDRWRGFAAGEDALAACAEERPVGPSHPFQSGDWMVSDA
FT                   KREPMLAPGGTLTDLRVRRERKPALEVHAGNHAELPRGTIERHDAAALEHDEPARIVRR
FT                   RRHRGQNFKVDAADTRRSGLTRWFNKIGEGYKGTNSAVSPAGPRRFTNVTSTPSRFSAS
FT                   VSREGAGDVSCTAAADA"
FT                   /protein_id="YP_001585678.1"
FT   gene            complement(429339..429725)
FT                   /db_xref="GeneID:5770522"
FT                   /locus_tag="Bmul_5723"
FT   CDS_pept        complement(429339..429725)
FT                   /locus_tag="Bmul_5723"
FT                   /gene_family="HOG000024007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C6630 hypothetical protein"
FT                   /db_xref="GI:161522750"
FT                   /db_xref="GeneID:5770522"
FT                   /translation="MMSSSSVAFPAARSSVIDGHEFVMVVINQSSSDNPTGYCGAGEEG
FT                   TLYVLRLDGKHAEPVYSTLVQSCLKNIDLFTDSGNKSPYLAIAWTDGGDGFRIHWENYA
FT                   KPESLTRQYRYANGRFTVDSERPN"
FT                   /protein_id="YP_001585679.1"
FT   gene            complement(429913..430293)
FT                   /db_xref="GeneID:5770295"
FT                   /locus_tag="Bmul_5724"
FT   CDS_pept        complement(429913..430293)
FT                   /locus_tag="Bmul_5724"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:161522751"
FT                   /db_xref="GeneID:5770295"
FT                   /translation="MWNWKENIKVGIKLYQEKQGYAKKDLAGHPYTEDQLIRATFSRWN
FT                   GSVYYRWDEASNAWVPNGTIMCDPDTSNIGWDMSKDANKDKTVEELHKRDKDTYKSGKS
FT                   GRSDEHAWIYSGICYADHMANN"
FT                   /protein_id="YP_001585680.1"
FT   gene            complement(430351..431262)
FT                   /db_xref="GeneID:5770296"
FT                   /locus_tag="Bmul_5725"
FT   CDS_pept        complement(430351..431262)
FT                   /locus_tag="Bmul_5725"
FT                   /gene_family="HOG000023134" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: ajs:Ajs_0907
FT                   integrase, catalytic region"
FT                   /db_xref="GI:161522752"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5770296"
FT                   /translation="MKAYIDRYRDAYGVEPICKVLQIAPSCYRRHAARLRNPALRCKRA
FT                   QRDDALIPDIERIWHANWQVYGADKVWKQMNREGIRVARCTVERLMKRQGLQGVRRGKV
FT                   VRTTTPDTSAPCPLDRVQRVFKAERPNQLWVSDFTYVSTWQGWLYVAFVIDVYARRIVG
FT                   WRVSSTMRTDFVLDALEQALYDRQPASDTLVHHSDRGSQYLSIRYTERLAEAGIEPSVG
FT                   SRGDSYDNALAETINGLYKAELIHRRAPWKSRESVELATLQWVHWFNHIRLLEPIGYIP
FT                   PAEAEANYWRQLASETIALVST"
FT                   /protein_id="YP_001585681.1"
FT   misc_feature    complement(430366..431202)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:177368"
FT                   /locus_tag="Bmul_5725"
FT   misc_feature    complement(430531..430887)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bmul_5725"
FT   gene            431314..431712
FT                   /db_xref="GeneID:5770297"
FT                   /locus_tag="Bmul_5726"
FT   CDS_pept        431314..431712
FT                   /locus_tag="Bmul_5726"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gox:GOX2598 DNA polymerase III alpha subunit"
FT                   /db_xref="GI:161522753"
FT                   /db_xref="GeneID:5770297"
FT                   /translation="MRISLARRSSLTSRSSALRRSRSLLLRPSRCPLSTSSRLTQSSSV
FT                   CGTQPILGAMDSTAAHSEGYSPRCSCTMRTARSRTSGENLFVLFIAPFSQELEPPRIPG
FT                   RFRLVIWVIPYPLSNATTGSLSALMKFL"
FT                   /protein_id="YP_001585682.1"
FT   sig_peptide     431314..431457
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.390 at
FT                   residue 48"
FT                   /locus_tag="Bmul_5726"
FT                   /product="hypothetical protein"
FT   gene            431930..433015
FT                   /db_xref="GeneID:5770304"
FT                   /locus_tag="Bmul_5727"
FT