(data stored in ACNUC8465 zone)

HOGENOMDNA: BURM1_5

ID   BURM1_5; SV 1; empty ; DNA; empty ; PRO; 919805 BP.
XX
AC   NC_010801;
XX
PR   Project: 58909;
XX
DE   Burkholderia multivorans ATCC 17616 chromosome 3, complete genome.
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RA   Ohtsubo,Y., Yamashita,A., Kurokawa,K., Takami,H., Yuhara,S., Nishiyama,E.,
RA   Endo,R., Miyazaki,R., Ono,A., Yano,K., Ito,M., Sota,M., Yuji,N.,
RA   Hattori,M. and Tsuda,M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished
XX
RN   [2]
RP   1-919805
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-DEC-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-919805
RA   Ohtsubo,Y., Yuji,N. and Tsuda,M.;
RT   "Direct Submission";
RL   Submitted (17-APR-2007) Contact:Yoshiyuki Ohtsubo Tohoku University,
RL   Department of Environmental Life Sciences, Graduate School of Life
RL   Sciences; Katahira 2-1-1, Sendai, Miyagi 980-8577, Japan
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AP009387.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..919805
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="3"
FT                   /db_xref="taxon:395019"
FT   gene            51..764
FT                   /db_xref="GeneID:6357049"
FT                   /locus_tag="BMULJ_05363"
FT   CDS_pept        51..764
FT                   /locus_tag="BMULJ_05363"
FT                   /gene_family="HOG000157121" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="COG0412: Dienelactone hydrolase and related enzymes,
FT                   Ralstonia solanacearum; KEGG, K01061"
FT                   /db_xref="GI:189347994"
FT                   /db_xref="GeneID:6357049"
FT                   /translation="MSQTSGSMITFRRPDGQELQGYLATPEKTDGAPAVVVIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVQYLK
FT                   TRAERVAVTGFCMGGALTLLSLQFADADAGVTWYGFPPLDYLDPSKIKVPVMGHWGTQD
FT                   AFFTIDQVDALEKKLTDAKVDIEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSQFAWD
FT                   RTLTFFGRTLWQKAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001941190.1"
FT   misc_feature    111..740
FT                   /note="Dienelactone hydrolase family; Region: DLH;
FT                   pfam01738"
FT                   /db_xref="CDD:145081"
FT                   /locus_tag="BMULJ_05363"
FT   gene            complement(1001..1954)
FT                   /db_xref="GeneID:6356239"
FT                   /locus_tag="BMULJ_05364"
FT   CDS_pept        complement(1001..1954)
FT                   /locus_tag="BMULJ_05364"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="GI:189347995"
FT                   /db_xref="GeneID:6356239"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILAYIDEAEAEAADAQAKPSGRLHVHATTSFGQ
FT                   AYVVPAVVRYRQRYPSVAVELTLSQHVPDIIDEGYDVSLQLSTAELPDSGLVSQRLGEM
FT                   HSVLCASPAYLKERGTPRTVSDLEGHACLQIVTPIFPRDRWHLDGPNGRETFELPLPDF
FT                   QVNIADALGAGLRAGLGIGALPMSTALPAFASGALVRVLPEYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLAADEAALCAAQDARANA"
FT                   /protein_id="YP_001941191.1"
FT   misc_feature    complement(1073..1954)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="BMULJ_05364"
FT   misc_feature    complement(1766..1945)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BMULJ_05364"
FT   misc_feature    complement(1079..1681)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BMULJ_05364"
FT   misc_feature    complement(order(1142..1144,1223..1225,1274..1276,
FT                   1466..1468,1472..1474,1520..1522,1637..1639,1649..1651))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BMULJ_05364"
FT   misc_feature    complement(order(1247..1249,1256..1261,1280..1294,
FT                   1385..1387,1574..1594,1598..1600,1610..1612,1619..1624,
FT                   1628..1633,1643..1648))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BMULJ_05364"
FT   gene            complement(2213..3511)
FT                   /db_xref="GeneID:6356240"
FT                   /locus_tag="BMULJ_05365"