(data stored in ACNUC7421 zone)

HOGENOMDNA: BURM1_7

ID   BURM1_7; SV 1; empty ; DNA; empty ; PRO; 3448421 BP.
XX
AC   NC_010804;
XX
PR   Project: 58909;
XX
DE   Burkholderia multivorans ATCC 17616 chromosome chromosome 1, complete
DE   sequence.
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RA   Ohtsubo,Y., Yamashita,A., Kurokawa,K., Takami,H., Yuhara,S., Nishiyama,E.,
RA   Endo,R., Miyazaki,R., Ono,A., Yano,K., Ito,M., Sota,M., Yuji,N.,
RA   Hattori,M. and Tsuda,M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished
XX
RN   [2]
RP   1-3448421
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (04-JUN-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3448421
RA   Ohtsubo,Y., Yuji,N. and Tsuda,M.;
RT   "Direct Submission";
RL   Submitted (17-APR-2007) Contact:Yoshiyuki Ohtsubo Tohoku University,
RL   Department of Environmental Life Sciences, Graduate School of Life
RL   Sciences; Katahira 2-1-1, Sendai, Miyagi 980-8577, Japan
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AP009385.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3448421
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="1"
FT                   /db_xref="taxon:395019"
FT   gene            complement(493..1608)
FT                   /db_xref="GeneID:6357188"
FT                   /locus_tag="BMULJ_00001"
FT   CDS_pept        complement(493..1608)
FT                   /locus_tag="BMULJ_00001"
FT                   /gene_family="HOG000220942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxylate-amine ligase"
FT                   /transl_table="11"
FT                   /note="ATP-dependent; carboxylate-amine ligase with weak
FT                   glutamate--cysteine ligase activity"
FT                   /db_xref="GI:189348894"
FT                   /db_xref="GeneID:6357188"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHTHEQALGELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFALTWHDFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLIDRPLTLTEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAELGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT                   /protein_id="YP_001944522.1"
FT   misc_feature    complement(496..1608)
FT                   /note="Glutamate-cysteine ligase family 2(GCS2); Region:
FT                   GCS2; cl00954"
FT                   /db_xref="CDD:174478"
FT                   /locus_tag="BMULJ_00001"
FT   misc_feature    complement(727..1572)
FT                   /note="uncharacterized enzyme; Region: gshA_cyan_rel;
FT                   TIGR02050"
FT                   /db_xref="CDD:162674"
FT                   /locus_tag="BMULJ_00001"
FT   gene            complement(1626..2840)
FT                   /db_xref="GeneID:6357189"
FT                   /locus_tag="BMULJ_00002"
FT   CDS_pept        complement(1626..2840)
FT                   /locus_tag="BMULJ_00002"
FT                   /gene_family="HOG000253763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:189348895"
FT                   /db_xref="GeneID:6357189"
FT                   /translation="MKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDSSTDETSRLLINVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPVYLLVGSFIVAYLVARSCNYLFRH
FT                   MTSTMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWSDIAIGGLFAIVLIVTRLVAKLGGVVAFAKPSGIGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCTIVILQLVSPFVVYRCLSAVGE
FT                   RSDGN"
FT                   /protein_id="YP_001944523.1"
FT   misc_feature    complement(1770..2723)
FT                   /note="Sodium/hydrogen exchanger family; Region:
FT                   Na_H_Exchanger; pfam00999"
FT                   /db_xref="CDD:144551"
FT                   /locus_tag="BMULJ_00002"
FT   gene            complement(3515..5488)
FT                   /db_xref="GeneID:6357190"
FT                   /locus_tag="BMULJ_00003"