(data stored in ACNUC7421 zone)

HOGENOMDNA: BURMS_2

ID   BURMS_2; SV 1; empty ; DNA; empty ; PRO; 3497479 BP.
XX
AC   NC_008785;
XX
PR   Project: 58387;
XX
DE   Burkholderia mallei SAVP1 chromosome I, complete genome.
XX
OS   Burkholderia mallei SAVP1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3497479
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-JAN-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [2]
RP   1-3497479
RA   DeShazer,D., Woods,D.E. and Nierman,W.C.;
RT   "Direct Submission";
RL   Submitted (18-DEC-2006) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000526.
CC   Source DNA and bacteria available from David DeShazer
CC   (david.deshazer@det.amedd.army.mil).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3497479
FT                   /strain="SAVP1"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia mallei SAVP1"
FT                   /chromosome="I"
FT                   /db_xref="taxon:320388"
FT   gene            complement(join(<3494644..3497479,1..746))
FT                   /db_xref="GeneID:4679732"
FT                   /locus_tag="BMASAVP1_A0001"
FT   CDS_pept        complement(join(3494644..3497479,1..746))
FT                   /locus_tag="BMASAVP1_A0001"
FT                   /gene_family="HOG000254915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="Catalyzes the ferredoxin-dependent oxidative
FT                   decarboxylation of arylpyruvates"
FT                   /db_xref="GI:121598938"
FT                   /db_xref="GeneID:4679732"
FT                   /translation="MNAPLDAGQRASLEAALQSVTLDDKYTLERGRAYMSGIQALVRLP
FT                   MLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKRHLAAHRIVFQPGINEDLAATA
FT                   VWGSQQVNLYPGAKYDGVFSMWYGKGPGVDRTGDVFKHANSAGSAPHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVES
FT                   SASVDIDPHRTQIVLPTDFVMPDGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLD
FT                   RIEIDSPHARFGIVTGGKAYLDVRQALVDLGLDDDTCARIGIRLYKVGCVWPLEAQGAQ
FT                   AFARGLDEILVVEEKRQILEYAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARIAVIEAKETALAKPHVSAERKP
FT                   WFCSGCPHNTSTTVPEGSRAIAGIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAIRAAIASKANITYKILYNDAVAMTGGQPVDGVLTVPQITH
FT                   QLAAEGAKRIVIVTDEPRKYDGHTSQLAPGVTIHHRDQLDDVQRTLREIEGTTILIYDQ
FT                   TCATEKRRRRKRGAYPDPAKRVVINEAVCEGCGDCSVQSNCLSVEPRETEFGTKRQINQ
FT                   STCNKDFSCVKGFCPSFVTVEGGRLRKPKAVSADASALPPMPEPVLPAIDRAYGVLVTG
FT                   VGGTGVVTIGALLGMAAHLEGKGVTVLDVTGLAQKGGAVMSHVQIAHAPADIHATRIAM
FT                   GEADLVIGCDAIVTAGDECTSRMRHGTTRVVVNSAQTPTAEFIKNPKWTFPGASAELDI
FT                   RAAAGDAVDLVDANHFAVALLGDAIYTNPFVLGYAWQRGWLPLAYASLVRAIELNGVQI
FT                   EQNRAAFEWGRRAAFDPASVRAAAADDAQAGATVIALHTKKAVDALIATRVEHLNAYQN
FT                   AAYAARFSAVVSQARAAERALGADTAQEPLTEAVARNLCKLMAYKDEYEVARLHAAPAF
FT                   VAKLAEQFEGDWKLSFHLAPPLFAKKDARGRPVKQQYGPWLMPVFRVLAKLKFLRGTAF
FT                   DVFGRTEERRTERALIGEYEALVQELTGSRLTRDTLPLAVELASLPDGIRGYGHVKENN
FT                   LRAVRAKWAQLLAQWRSPEGGQTRNVA"
FT                   /transl_table="11"
FT                   /protein_id="YP_991357.1"
FT   misc_feature    complement(join(3494647..3497479,1..725))
FT                   /note="indolepyruvate ferredoxin oxidoreductase; Validated;
FT                   Region: PRK09193"
FT                   /db_xref="CDD:169705"
FT   misc_feature    complement(96..590)
FT                   /note="Pyrimidine (PYR) binding domain of pyruvate
FT                   ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin
FT                   oxidoreductase alpha subunit (IOR-alpha), and related
FT                   proteins; Region: TPP_PYR_PFOR_IOR-alpha_like; cd07034"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(order(207..212,258..263,309..311,321..323,
FT                   330..332,381..383,414..416,423..431,435..440,462..473,
FT                   519..521,528..530,540..542,558..563))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(order(321..323,330..332,381..383,414..416,
FT                   423..431,435..440,462..473,519..524,540..542,546..551,
FT                   558..563))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(order(453..455,546..548))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(order(267..269,540..542))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(3496315..3496860)
FT                   /note="TPP-binding module; composed of proteins similar to
FT                   indolepyruvate ferredoxin oxidoreductase (IOR) alpha
FT                   subunit. IOR catalyzes the oxidative decarboxylation of
FT                   arylpyruvates, such as indolepyruvate or phenylpyruvate,
FT                   which are generated by the...; Region: TPP_IOR_alpha;
FT                   cd02008"
FT                   /db_xref="CDD:48171"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(order(3496558..3496560,3496564..3496566,
FT                   3496642..3496653,3496723..3496725))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48171"
FT                   /locus_tag="BMASAVP1_A0001"
FT   misc_feature    complement(3495400..3495924)
FT                   /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   Region: POR; cl00546"
FT                   /db_xref="CDD:176928"
FT                   /locus_tag="BMASAVP1_A0001"
FT   gene            1066..1263
FT                   /db_xref="GeneID:4680017"
FT                   /locus_tag="BMASAVP1_A0002"
FT   CDS_pept        1066..1263
FT                   /locus_tag="BMASAVP1_A0002"
FT                   /gene_family="HOG000227121" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative outer membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:121601251"
FT                   /db_xref="GeneID:4680017"
FT                   /translation="MKTRNIQNFLMVSAAFFAMSGPARSEGAGVLATASTQMLQLAAAA
FT                   GADAPTFAGVATNGRGAMQK"
FT                   /protein_id="YP_991358.1"
FT   gene            complement(1499..2596)
FT                   /db_xref="GeneID:4679636"
FT                   /locus_tag="BMASAVP1_A0003"