(data stored in ACNUC8465 zone)

HOGENOMDNA: BURS3_1

ID   BURS3_1; SV 1; empty ; DNA; empty ; PRO; 1395069 BP.
XX
AC   NC_007509;
XX
PR   Project: 58073;
XX
DE   Burkholderia sp. 383 chromosome 3, complete genome.
XX
OS   Burkholderia sp. 383
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1395069
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T.,
RA   Hammon,N., Israni,S., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Kyrpides,N., Lykidis,A. and
RA   Richardson,P.;
RT   "Complete sequence of chromosome 3 of Burkholderia sp. 383";
RL   Unpublished
XX
RN   [2]
RP   1-1395069
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-OCT-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1395069
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T.,
RA   Hammon,N., Israni,S., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Kyrpides,N., Lykidis,A. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (11-OCT-2005) US DOE Joint Genome Institute, 2400 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000150.
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1395069
FT                   /strain="383"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia sp. 383"
FT                   /chromosome="3"
FT                   /db_xref="taxon:269483"
FT   gene            537..845
FT                   /db_xref="GeneID:3733880"
FT                   /locus_tag="Bcep18194_C6524"
FT   CDS_pept        537..845
FT                   /locus_tag="Bcep18194_C6524"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059644"
FT                   /db_xref="GeneID:3733880"
FT                   /translation="MRIQIRKLTLAATAAAFLFGSAVPAFAQTDASAPAAQDAKAAKSQ
FT                   ARKAARAQRKAEHKAARAKNTAELKKLEDAGYKPAANDPNYPQNLQNAQKKAAGAGQ"
FT                   /protein_id="YP_366219.1"
FT   gene            complement(1025..1930)
FT                   /db_xref="GeneID:3733881"
FT                   /locus_tag="Bcep18194_C6525"
FT   CDS_pept        complement(1025..1930)
FT                   /locus_tag="Bcep18194_C6525"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059645"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733881"
FT                   /translation="MARRLPPLNSLRAFEAAARLGSFTLAADELCVTHGAISRHVQQLE
FT                   AWLGRPLFERHNRRVELTDSGRAYLAEVGASFDRIALATAQHFGHAQQRVLRVSAPATF
FT                   SLRWLVPKLSSFQVAHPAIEVRLSTSNEPIDKLRDKVDLIVRGGPQAIDGYVAEEFLSE
FT                   VRLPVCAPKLLEGRPLHTPADLAGFTLLHAATYPGMWPEWLAAAGQPNLVPRHSLTLEH
FT                   FYLTLQGALDGLGVAMGPIALVADDIAEGRLVQPFSEPALPPWRYFTYVASARANDEAV
FT                   RAFKEWLKVTGNAAAPLGPS"
FT                   /protein_id="YP_366220.1"
FT   misc_feature    complement(1067..1927)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:170976"
FT                   /locus_tag="Bcep18194_C6525"
FT   misc_feature    complement(1730..1909)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6525"
FT   misc_feature    complement(1067..1648)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcep18194_C6525"
FT   misc_feature    complement(order(1544..1564,1568..1621,1625..1648))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcep18194_C6525"
FT   misc_feature    complement(order(1202..1204,1262..1270,1619..1621,
FT                   1625..1630))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bcep18194_C6525"
FT   gene            2070..3368
FT                   /db_xref="GeneID:3733882"
FT                   /locus_tag="Bcep18194_C6526"
FT   CDS_pept        2070..3368
FT                   /product="adenylosuccinate synthetase"
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6526"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="GI:78059646"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="GeneID:3733882"
FT                   /translation="MPNVVVVGAQWGDEGKGRVVDWLAAQADLVARYNGGHNAGHTLVV
FT                   GGKTYKLALLPSGVVRGKRGVIGNGVALDPEALLAEIGRMAELGLSVTPDNLSIAENAT
FT                   LVLPIHRAIDQAQERLRREPIGTTLRGIGPAYEDKVGRRGLRVGDLAEPGRLAAKLDVL
FT                   VDHHNAWFRGLGLDEYSRDAMLATLVDLAPRILPFVRPVWADLNDATDRGERILFEGSQ
FT                   AVMLDIDWGTYPFVTSSGTVASAAAAGTGLGASKLGHVLGVTKAYATRVGGGPFLTELS
FT                   DATGETLRARGQEFGVNTGRPRRCGWLDAAQLRQAVRISGIDSLALTKLDVLDGFESIE
FT                   LCVGYEFDGARVDHLPASLDAQSRAKPVYERFDGWRGTVKGVRERAALPRAAQDFIARV
FT                   EAVAGAPVSMITTGAERDDTIVLRNPFDAAAGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_366221.1"
FT   misc_feature    2070..3353
FT                   /note="adenylosuccinate synthetase; Provisional; Region:
FT                   PRK01117"
FT                   /db_xref="CDD:167161"
FT                   /locus_tag="Bcep18194_C6526"
FT   misc_feature    2076..3311
FT                   /note="Adenylosuccinate synthetase (AdSS) catalyzes the
FT                   first step in the de novo biosynthesis of AMP. IMP and
FT                   L-aspartate are conjugated in a two-step reaction
FT                   accompanied by the hydrolysis of GTP to GDP in the presence
FT                   of Mg2+. In the first step, the r-...; Region: AdSS;
FT                   cd03108"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bcep18194_C6526"
FT   misc_feature    order(2106..2108,2112..2120,2187..2195,2199..2201,
FT                   3054..3056,3060..3062,3306..3311)
FT                   /note="GDP-binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bcep18194_C6526"
FT   misc_feature    order(2112..2114,2121..2123,2190..2192)
FT                   /note="ACT binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bcep18194_C6526"
FT   misc_feature    order(2181..2183,2442..2444,2451..2453,2733..2735,
FT                   2778..2780)
FT                   /note="IMP binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Bcep18194_C6526"
FT   gene            3668..4609
FT                   /db_xref="GeneID:3733883"
FT                   /locus_tag="Bcep18194_C6527"
FT   CDS_pept        3668..4609
FT                   /locus_tag="Bcep18194_C6527"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059647"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733883"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILGYIEEAESEAADAQAKPSGRLHVHATTSFGQ
FT                   AYVVPAVVRYRQRYPSVAVELTLSQHVPDIIDEGYDVSLQLSATELPDSGLVSQRLGEV
FT                   HSVLCASPAYLKERGTPRTVRELDGHACLQIVTPVFPRDRWHLDGPDGPETFDLPLPDF
FT                   QVNIADALGAALRAGLGIGSLPMSSALPALASGALVRVLPDYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLATDEAALHASCKS"
FT                   /protein_id="YP_366222.1"
FT   misc_feature    3668..4549
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcep18194_C6527"
FT   misc_feature    3677..3856
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6527"
FT   misc_feature    3941..4543
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6527"
FT   misc_feature    order(3971..3973,3983..3985,4100..4102,4148..4150,
FT                   4154..4156,4346..4348,4397..4399,4478..4480)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6527"
FT   misc_feature    order(3974..3979,3989..3994,3998..4003,4010..4012,
FT                   4022..4024,4028..4048,4235..4237,4328..4342,4361..4366,
FT                   4373..4375)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6527"
FT   gene            4876..5847
FT                   /db_xref="GeneID:3733884"
FT                   /locus_tag="Bcep18194_C6528"
FT   CDS_pept        4876..5847
FT                   /locus_tag="Bcep18194_C6528"
FT                   /gene_family="HOG000164730" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulphonates"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059648"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="GeneID:3733884"
FT                   /translation="MADQHSTTRRRLLHAGLAIAAGAAVHPGFALASTAGVRTLRIGYQ
FT                   KGPLSLLKARGTLQSKLATLGVTVTWTEFPSGPPQLEALNAGSIDFGDVGEAPPIFALA
FT                   AGAPLVYYAQTPAGPAAEALVVAKDSPVKTFADLRGKRIALVKGSNTHFLLVRLLQAAK
FT                   LNYADISPVWLSPSDARAAFENRSVDAWIIWDPFLAVVQQAFGARIVADGTGLVENRGY
FT                   YFASRTYAQHNADVLDVAVSELTAVQRWLDANRAQGAAEFSKLWGIPEPAVALAFRRAR
FT                   FGVEPVTRDTLAYQQRIADVFYQAGVLPKRVDVSLAAPPALA"
FT                   /protein_id="YP_366223.1"
FT   misc_feature    4993..5820
FT                   /note="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
FT                   /db_xref="CDD:130789"
FT                   /locus_tag="Bcep18194_C6528"
FT   misc_feature    5068..5613
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcep18194_C6528"
FT   misc_feature    order(5101..5103,5194..5196,5323..5325,5455..5457)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcep18194_C6528"
FT   misc_feature    order(5404..5406,5416..5418,5434..5436)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcep18194_C6528"
FT   misc_feature    5527..5544
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="Bcep18194_C6528"
FT   gene            complement(5860..7278)
FT                   /db_xref="GeneID:3733885"
FT                   /locus_tag="Bcep18194_C6529"
FT   CDS_pept        complement(5860..7278)
FT                   /locus_tag="Bcep18194_C6529"
FT                   /gene_family="HOG000251262" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="peptidase M20D, amidohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059649"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:3733885"
FT                   /translation="MTSLALDFIDSQRAQFTELSDRIWNLAELRYEEFASTDLHIRMLE
FT                   EAGFRVTRGVADIPTAFVAEAGDGGPVIGILGEYDALSGLSQEAGALTCQPSGEISNGN
FT                   GHGCGHHLLGTAAHLAATAVKAHLERTGQPGTVRFYGCPAEEGGSGKTFMARAGVFDDL
FT                   DAALSWHPHVYTGIFPAGSLANIQAYFRFTGKASHAAASPHLGRSALDAVELMNVGVNY
FT                   LREHMLPEARVHYAVTNTGGLSPNVVQANAEVLYLVRAARNDQAAELFERVKNVARGAA
FT                   MMTDCRLEIVFDKACSNLLENAVLNQVMYRHLQSIGTAGFDADDAALADTYQRQTLTAQ
FT                   DIETSSRSLNQAWRNPKALFDGIDPYEPGKGRPICGSTDVGDVSWVTPTAQCHTSCYAF
FT                   GTPPHSWQWVAQGKTPLAHKGMLLAAKTMAATAIDLLGAPDTLAQAKAELLERRGGRPY
FT                   VCPIPDDVALPFRR"
FT                   /protein_id="YP_366224.1"
FT   misc_feature    complement(6067..7230)
FT                   /note="amidohydrolase; Region: amidohydrolases; TIGR01891"
FT                   /db_xref="CDD:162584"
FT                   /locus_tag="Bcep18194_C6529"
FT   misc_feature    complement(6325..>6876)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Bcep18194_C6529"
FT   gene            complement(7308..8561)
FT                   /db_xref="GeneID:3733861"
FT                   /locus_tag="Bcep18194_C6530"
FT   CDS_pept        complement(7308..8561)
FT                   /locus_tag="Bcep18194_C6530"
FT                   /gene_family="HOG000131033" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="outer membrane protein, (porin)-like"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059650"
FT                   /db_xref="GeneID:3733861"
FT                   /translation="MALPRTPGRLASRRPLNSAPLHSRRRRIPAAPPTIRQQNPRRRRV
FT                   RGRALARLRFARRRSRHHETNVRNSTLMAACCAATCMWAAPARANVQIYGALDSFLQYA
FT                   RIGSQTSVGLMSGGASTSRFGFIGSEDLGGGLRASFRLESGFDLMSGRPQSAASFYNRE
FT                   ANVAIGSADWGTIKLGKQYPAIVPEAADPFYLVGQLSPFASTALIGSDLGRGAASLPGR
FT                   IENAISYKTPTYGGLDVTVLYAFRNAAGASPIASNAGAVANFARGPVMLSGAYNAMWAA
FT                   TSSTPGGAPDGPRTDSVMASASYAFGPTLASFAYTLMRPTAPGTLVAQVYSLGAIWQRG
FT                   PHAIRADLAYRTIAGQASHALGALLGYDYQFSKLTGVYVRLGGFRNTGQSALSFGSAPM
FT                   SAPGMSSTVFALGLRQKF"
FT                   /protein_id="YP_366225.1"
FT   misc_feature    complement(7311..8294)
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcep18194_C6530"
FT   misc_feature    complement(order(7311..7313,7317..7319,7323..7325,
FT                   7437..7439,7446..7451,7887..7892,7896..7898,8022..8030,
FT                   8058..8072,8076..8081,8115..8126,8130..8132,8136..8144,
FT                   8148..8150,8166..8180,8259..8267,8271..8273,8289..8291))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcep18194_C6530"
FT   misc_feature    complement(order(7896..7898,7962..7964,8076..8078,
FT                   8193..8195,8274..8276))
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bcep18194_C6530"
FT   gene            complement(8513..9904)
FT                   /db_xref="GeneID:3733862"
FT                   /locus_tag="Bcep18194_C6531"
FT   CDS_pept        complement(8513..9904)
FT                   /locus_tag="Bcep18194_C6531"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059651"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:3733862"
FT                   /translation="MRPALAGCLTIHAALTIPIPMETSPMQDAATPLVDAPPAPRRRSA
FT                   QTRTIIATSAGNALEMFDFTVFSYFAALIGKTFFPVDSGAGPLLLAMATFGVGFVMRPL
FT                   GGVLIGNYADRAGRRAALTLTIQLMIAGTALIALTPSYAHIGVVAPVLVVIGRLLQGLS
FT                   AGGEIGASTTFLMESGPLSGRGFMVSWQMISQGVAALLGALSGALLSAVLSADALESWG
FT                   WRVPFLLGLLLGPVGFYIRRHLDETHVPTHDADGSAVREVFTRYLGRVVLGTLMIIGGT
FT                   STLYIFVFYMPAYAVRTLHLPMATSLLAGCASGLAMIVAALVSGLWIIDRLPRRKPMIA
FT                   VTWLLSLACVYPAFRLLIAAPSVGLMVAIVTVVMAFATAGSSAFLLLIMEAFPPRVRAT
FT                   ALATIYSFGVTIFGGFAQFNVTWLLHRTGDPMSPAWYVLACGAVSMIALWRFRERPADS
FT                   HHDGR"
FT                   /protein_id="YP_366226.1"
FT   misc_feature    complement(8549..9757)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep18194_C6531"
FT   misc_feature    complement(8576..9739)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="Bcep18194_C6531"
FT   misc_feature    complement(order(8663..8665,8678..8683,8690..8695,
FT                   8702..8707,8738..8740,8747..8752,8762..8764,8771..8776,
FT                   8783..8785,8942..8944,8954..8956,8963..8965,8975..8977,
FT                   8987..8989,9029..9031,9047..9052,9059..9064,9071..9073,
FT                   9284..9286,9326..9331,9338..9343,9377..9379,9386..9391,
FT                   9398..9403,9410..9415,9575..9580,9584..9589,9599..9601,
FT                   9608..9613,9620..9622,9689..9694,9698..9706,9713..9715))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep18194_C6531"
FT   gene            10402..11229
FT                   /db_xref="GeneID:3733863"
FT                   /locus_tag="Bcep18194_C6532"
FT   CDS_pept        10402..11229
FT                   /locus_tag="Bcep18194_C6532"
FT                   /gene_family="HOG000235440" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059652"
FT                   /db_xref="GeneID:3733863"
FT                   /translation="MGQQQDLYDRWKRAKAQLNDLFKKPENTLIVHYSCESFYDQTKAD
FT                   SPRVTSIAVRNLQSGQTHSFSIHFAAERAHALDQIENRYDEFEQAMLTDFFAFARDHQF
FT                   HTWLHWNMRDMNYGFPALEHRAAVLGSQSFHIDEKQLVDLSRVLIAIYGNKYTGHPRIQ
FT                   SLMEKNHITPRDFMVGQSEADAFEQKRFLDMHRSTLSKVDVFANFAERAHSGTLKTNAN
FT                   WFERNGRSFKAGIEKIREHWFWGALIAVGFGAWNYRDQIVQIWGWALKHLGHG"
FT                   /protein_id="YP_366227.1"
FT   gene            11249..12616
FT                   /db_xref="GeneID:3733864"
FT                   /locus_tag="Bcep18194_C6533"
FT   CDS_pept        11249..12616
FT                   /locus_tag="Bcep18194_C6533"
FT                   /gene_family="HOG000001396" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059653"
FT                   /db_xref="GeneID:3733864"
FT                   /translation="MRSAVLLDVLHSSTKQRGMNVRSFNSVVDEARLVASPAETVAKYL
FT                   EDRGVQVAKQPFSDTVDEQFEQALLERHDPLIDLALARWCCYLPTGRALLAANAGDGTH
FT                   ALAIRLSLLSNVAVGASFMSNGPMEFFANSPMDWFPSATDEELTAFFKNPSLSNEFFEA
FT                   FFNGGPSWTCLSEPQRLTALRAVTGNPRMRIPYDQAFADGYAEFLHNKVFEAAWNMATT
FT                   VPNTRVWAFTLGWLFDVLLPVGHGIDDPLTSAARWTPDDDEGIKHGSLSSFQNVRKGLA
FT                   RLALAKNAKRTDEFLTSDDPALRAAVYASSPLSTDQIACAVERDGAMGFDEMVRNTKLW
FT                   REQEHRDALRAASWVVINADSHSDLLPHNLFTRMRERMEHEHPSWFSNVVACDPDDLDL
FT                   PATRADMHRVLETLTGSNTGLGLQQVSASIQALNKRLGWVWWFSLGALLATASHWL"
FT                   /protein_id="YP_366228.1"
FT   gene            complement(12906..14003)
FT                   /db_xref="GeneID:3733865"
FT                   /locus_tag="Bcep18194_C6534"
FT   CDS_pept        complement(12906..14003)
FT                   /locus_tag="Bcep18194_C6534"
FT                   /gene_family="HOG000076239" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059654"
FT                   /db_xref="GeneID:3733865"
FT                   /translation="MAAENIEKLVNVLRQQTRKSTVLQGGTLIDRLTHATGLDAAAIRA
FT                   GFKDMRTRGWIEASSWSGTGNPVGRVKVNLPPLPPPSWAEGWKDALITCERLSDSDRDA
FT                   LFECGASLADMDASEFPKILDGLIRLREDQLALAGSPAYLVSARYLRGSSKMLSKLGAR
FT                   AIKAFGIDLSRFPYHPPYVITAGASNPEAVVLVENPAAFELAVTTSAIEHCAFIATFGF
FT                   GLSKASEDFGNQLAGMVEEYFYSAVTLVREGSRTPSARELLNHPNITFWGDLDIAGMEI
FT                   HERIAKRHSHVRLSALYGPMLEAVLVEDNRHPYVSAVGKSGQAMFRATRSDALAMLRYC
FT                   NEWAADQELVTANQIEEFAGKPLAI"
FT                   /protein_id="YP_366229.1"
FT   gene            complement(14010..19049)
FT                   /db_xref="GeneID:3733866"
FT                   /locus_tag="Bcep18194_C6535"
FT   CDS_pept        complement(14010..19049)
FT                   /locus_tag="Bcep18194_C6535"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059655"
FT                   /db_xref="GeneID:3733866"
FT                   /translation="MISALLYLLSRDTKLKGIALPLFTPRRCGAPSHIRVQLWDLQDDL
FT                   SQTDLNLDEGLLDPKDLPNKNDHHVFGLCAYQGDEPRFYYYRGVLEDCPVFDRTEGGYL
FT                   YHHEAEVQQVVKLVGGTWNISSVHEWRSLITSHIPSRVLAQQVKFHLAGGGDKSAQLHQ
FT                   VEVDGDESFDQAFFRTVIAQELLISTSEPESDPDDPRENFEDLLYAHFSKMASATIKAE
FT                   QEQQVIREQEGIVHDLAGLVIAGEKANEGHGEYQRLIANIARDGALVWHFVRNDPLPGL
FT                   LDVRRQPSGRVGEIVPYIVIDKIYGAMILDAGLEKLTNVEASALNQVSGRQRLLKQEVD
FT                   QTQVIDFACNLDLKTSPKGGGYARKGYTLDTALELVPLLREVGTARLAGATDTLKQAFA
FT                   WVENTADTNSYRTIARRLATEIKQHQEEIRCRASEIVEWEIEVRELSDRITKYDQAKGA
FT                   YEDLATSGHFTSDELNAPELLTDQVKKELRAAEGALSDHDKRVGSLESIFDSHRAFCQK
FT                   NAGIPARTRLEELSARATSTRDDRTHAEQRLERSKAELAQLNVSKVEQEGQYKQNQQQL
FT                   DVLLELQSHQPAYTKWFGDTLPHDIDIRGNIKEITDDEKALAQRREERERFLHTISVLS
FT                   LTVPRYRELFGDADAESIDISGALQNISTQEKALGARRGAADALHTRIQSLKSFVEIFH
FT                   RIFGNTDPTMLDPGQERADLQKDIALTEAVVESLGSQVSRLNLFRDEHPGWTAAAWLAD
FT                   MESQRATRLRQIAQYNQQILTAERQLAELMSDPVARPEDVACAHALLDEAVPFVPLHIF
FT                   VESHCPPTVKQQWLTHFSALLFAPVVESIEEAAEAARILHDGQFMMPVLIASRLRDVME
FT                   SDAPALALEGECAYTWLAGIKTRLVHCLLNPAAVEEERTLAKQRLSELRELLAREEEAL
FT                   GHLSETSPSVLLARDAARAETSNAETELTASSERFKELRKQLPDVLARNSSEALDSIQN
FT                   TREYQSLIRQHGENVAERIEEELHQLDEQADVLRQAREWHEARNSDTVREVIMDMRRYQ
FT                   ALLAEHGVDALQKATQDLQKIAEEAEDLRRSREWYEARDQDDIHAAVSAMRRYRDVDGD
FT                   AEVVRLENVVKVSTEKLSAIATKIVSATHNVNEDENHLSTARDTESNASAAYLENKQYL
FT                   EALVSFSESKDLAFMETHEESRISLEIDKRRADARKSYQSQFPHAQRYVNATRDGQTSE
FT                   QELLTRKASVEIKVTEANRQQEQDRLVVEEKIERRDTLKNYQDALHEAACQLLGEFRAV
FT                   SNSLNEIRAAVTEGAPRFENTALYQHADSIRGKLERADGDPFFLDDIRTISRLAGELGL
FT                   AGQSKDIAQARRLTERLTREYQDRKSSFCTEIITGTRRGLSVLNAEWLLSQDRFDAPLE
FT                   MKTQIEVSLASNRALLQQATTSLEFARDKTTEMLTILAKDAERALSILDEAMTTTPTSR
FT                   FYVNANVITEDKIGDLLDHLYSNIEAEMRRKADSSSLVAEKRHRKRALDELRTEVYRSL
FT                   FSDVSVEFRHPSIWEGGQHPLTSKGLSEGMRTAISLMWIAKLAEFRLRQAIDQAGGMRR
FT                   QNRAALRKERYFVILDGLFSNLSHDDMIDSAMESLRLSAGHFQLIGMIHHPRYINNPKI
FT                   FPAYFVGRPYRANGGKHSWLTVDPHKAPPGSLGVFGSQFSS"
FT                   /protein_id="YP_366230.1"
FT   misc_feature    complement(<17298..>17819)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bcep18194_C6535"
FT   misc_feature    complement(<15300..16163)
FT                   /note="chromosome segregation protein SMC, primarily
FT                   archaeal type; Region: SMC_prok_A; TIGR02169"
FT                   /db_xref="CDD:162740"
FT                   /locus_tag="Bcep18194_C6535"
FT   gene            complement(19216..19998)
FT                   /db_xref="GeneID:3733867"
FT                   /locus_tag="Bcep18194_C6536"
FT   CDS_pept        complement(19216..19998)
FT                   /locus_tag="Bcep18194_C6536"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059656"
FT                   /db_xref="GeneID:3733867"
FT                   /translation="MDTEDIGRVVAYLLQHRIVETRPASGRSSDEERAVAKLLTSMIPD
FT                   ERRSLDRMFAGMRLGFVDFDWDAIPALPKGGRVFLLARDIGKGEPPGVLSPGVVIEAMR
FT                   EKGNEPAREAAAWFVHLWLVHLDLIYTDQERSPSQMQTYPKGMFDFDVFLGRVRSHFED
FT                   LRQGLDRNEVPADAVFKTFEKASHAEGERRCRRFVNLMLDAGLLTTIAKDLYQQTLLSA
FT                   YEIKRNYERGLQQFVTDASSKKYKMATSILTGIDIDSI"
FT                   /protein_id="YP_366231.1"
FT   gene            complement(19998..21377)
FT                   /db_xref="GeneID:3733868"
FT                   /locus_tag="Bcep18194_C6537"
FT   CDS_pept        complement(19998..21377)
FT                   /locus_tag="Bcep18194_C6537"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059657"
FT                   /db_xref="GeneID:3733868"
FT                   /translation="MDWIPLIASTARLIDLHDSNRTAGHAASQYDLYREARTGNQNGLW
FT                   LDVGLTVIEYLRERENEVVGGFVSGTEVREALQKRIAGLTDEDVRFVLSVLTTPAELWF
FT                   VERMDNGGRPINSTKETNLVERSRTADAYRLAPAGRTASGLAANVRDIAYIAGSAKNLL
FT                   TAIKARDFWKITELSAAIIDVLRAFRLEIESRREGGRLNGVQAFFKERGEVIKEQIEEA
FT                   TEILMEASEFLSLQSTRNEFQAWIGAMDRIGKPSFGHGYAIEHLRRVAEQTLKLLESFT
FT                   QLVDESLAVDGPVCQTVSFIDLSTSLAAQPFQERLYFALICSFGPTSLRQPMPCIFDFL
FT                   GIVEPRQIADTREEDVDAHGTEDIGVRAISFVAEHGAAILTELRRGPLSLTDALKHEWI
FT                   RLGSSGMNDLSALIGTYCDPSMLGADLNIVVRLGSGRDVFESDAIGRLTFDNLVMVMEE
FT                   A"
FT                   /protein_id="YP_366232.1"
FT   gene            21510..22316
FT                   /db_xref="GeneID:3733869"
FT                   /locus_tag="Bcep18194_C6538"
FT   CDS_pept        21510..22316
FT                   /locus_tag="Bcep18194_C6538"
FT                   /gene_family="HOG000292109" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059658"
FT                   /db_xref="GeneID:3733869"
FT                   /translation="MSKDISSPAAADLPFTVRQRLEHIERCLLWKGELQRADLVDRFGV
FT                   NPAQAATDFSTYMAVAVGNMDYNKSRKRYLPTPGFKPRFIQPQSLDEFVPMASSLVRVE
FT                   PWPLPQRAASSETLQAVVRAIREKEALEVRYQSMTDPKSSWRWLSPHAFASDGERWHVR
FT                   AFCHKHEEFRDFVLGRIIATRRTRSTDVVADQDTDWQTFATVIVKPNPQLSEEQCAAIA
FT                   AEYNMPRSQKMELRLRRSMLFYLEARFMPKPDWVAEAHQLIVAEIK"
FT                   /protein_id="YP_366233.1"
FT   misc_feature    <21789..>22103
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2378"
FT                   /db_xref="CDD:32525"
FT                   /locus_tag="Bcep18194_C6538"
FT   gene            22618..23097
FT                   /db_xref="GeneID:3733870"
FT                   /locus_tag="Bcep18194_C6539"
FT   CDS_pept        22618..23097
FT                   /locus_tag="Bcep18194_C6539"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="response regulator receiver domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059659"
FT                   /db_xref="InterPro:IPR000874"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:3733870"
FT                   /translation="MENIVRVLVIEDDASIATNLYDHPEGAGYGVDMAMSGPAGRKLAV
FT                   SQTWDAILLGTSLPGMDGLTLCRKLREENHRDTPVLMLMARGTLDDKLDGFGHGADDYL
FT                   VKPFSLKEVGARLGALVKGYRGQVAEIALCWAPGSLMLPGQDACCLAPVVLDQRN"
FT                   /protein_id="YP_366234.1"
FT   misc_feature    22639..22980
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6539"
FT   misc_feature    order(22648..22653,22780..22782,22804..22806,22867..22869,
FT                   22924..22926,22933..22938)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6539"
FT   misc_feature    22780..22782
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6539"
FT   misc_feature    order(22789..22794,22798..22806)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6539"
FT   misc_feature    22933..22941
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6539"
FT   gene            23597..23938
FT                   /db_xref="GeneID:3733871"
FT                   /locus_tag="Bcep18194_C6540"
FT   CDS_pept        23597..23938
FT                   /locus_tag="Bcep18194_C6540"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059660"
FT                   /db_xref="GeneID:3733871"
FT                   /translation="MTQRPWMRTHHIGTIEAMPASLKGPDPNQRLVSLRDVLAFNVRVV
FT                   RVRNMLSQEQLGFAADLDRTFISQVERARINVSLDNIERIARALGVAAYILLQRPDETP
FT                   ALVAETQPK"
FT                   /protein_id="YP_366235.1"
FT   misc_feature    23717..23869
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6540"
FT   misc_feature    order(23723..23725,23735..23737,23810..23812)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6540"
FT   misc_feature    order(23732..23734,23807..23809)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6540"
FT   misc_feature    order(23753..23758,23789..23791,23798..23800,23810..23815)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6540"
FT   gene            24442..24798
FT                   /db_xref="GeneID:3733872"
FT                   /locus_tag="Bcep18194_C6541"
FT   CDS_pept        24442..24798
FT                   /locus_tag="Bcep18194_C6541"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059661"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:3733872"
FT                   /translation="MTPFSNALVYYRKRAGLSQTNVAKQLGVAIQYLWKLERAIKPPPS
FT                   TEQIERIAAVLGMTEADIASLLEAALDSQRRVRLPDDLHSDTLRLINRLVRASTRLNVD
FT                   EVTMLDELVTRLDR"
FT                   /protein_id="YP_366236.1"
FT   misc_feature    24454..24630
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6541"
FT   misc_feature    order(24466..24468,24478..24480,24553..24555)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6541"
FT   misc_feature    order(24475..24477,24550..24552)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6541"
FT   misc_feature    order(24496..24501,24532..24534,24541..24543,24553..24558)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep18194_C6541"
FT   gene            25081..25716
FT                   /db_xref="GeneID:3733873"
FT                   /locus_tag="Bcep18194_C6542"
FT   CDS_pept        25081..25716
FT                   /locus_tag="Bcep18194_C6542"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059662"
FT                   /db_xref="GeneID:3733873"
FT                   /translation="MPSYDTRSGGNFRGFTPSVKNACSMPWYSLAEEASTLLLEFSPDV
FT                   LRFRGAQDRTFLLREAGQTFRYTPDYQIVRRDGSTVFVEAKPAKDLQKPSVQARMARAR
FT                   AVLAEHGYALFIWDERTYICGTRHETLRLLRPWRGRMSAERIREAQWLVEKTHPKTFRN
FT                   LVHLARTRDVALTWIANGAAGIDLDVPLTSDAAIYVAPSEVRHAEIFA"
FT                   /protein_id="YP_366237.1"
FT   misc_feature    <25279..25437
FT                   /note="TnsA endonuclease N terminal; Region: TnsA_N;
FT                   cl07370"
FT                   /db_xref="CDD:174876"
FT                   /locus_tag="Bcep18194_C6542"
FT   gene            25697..27646
FT                   /db_xref="GeneID:3733874"
FT                   /locus_tag="Bcep18194_C6543"
FT   CDS_pept        25697..27646
FT                   /locus_tag="Bcep18194_C6543"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059663"
FT                   /db_xref="GeneID:3733874"
FT                   /translation="MQKFLLKRGVEFQEGEYVWRVQGGLPDGRIEFSSDYNSPIRIPET
FT                   EVWERHSNGRWSVRIESLLETGASPIIVARRDVSTFEEKDIVVMRARLVYLRAVEEAKC
FT                   SRVREVETVIRRVACEVGALTPPNYRTFCRWKKRYQHSRDVMDVVPRHENKGRREILEG
FT                   PLLTLVEDVIETHYLNDQKLNVARLFDRVEEAIALQNERDPENPLPTISRATIYRHVEK
FT                   LNSYLVTAAREGRTEALKRYRPVFRRLKTKRLNERWEIDHTPVDLMCVCERTRMVIVRP
FT                   VLTVIIDAHTRMVMGFHIGARSPGQEEVGWAMRMAMLSKRDLLNRLGMGHLEWRARGVA
FT                   EMVVGDNAWEFHGSAMRAGCDELGISLMYCPKRAPWFKGRVERFMRTISEQLFHTIPGT
FT                   TWSNTTERGEYPSEKLACVSLDELTALVVRWIVECYQHAPHRGLKNKTPLQAWQESARL
FT                   TPIYMPADPDQLSIAFSDDIMRPITNSGVTFDHLSYNSSALQLLRHSIPECEKVKVRYF
FT                   NEQTGYVYVYDTRQKEYFRVDCTDPDYTKDLTRWMHNEVTDGMRNSRIDISSVSLRKAR
FT                   IRLADDIARAELDQKLKKRKWVAQIKGKSSKDPVSGVDGGMGVDDSVRSDQVDPAVVKF
FT                   NSIPEFLVMKRTER"
FT                   /protein_id="YP_366238.1"
FT   misc_feature    26444..26872
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep18194_C6543"
FT   gene            27657..28565
FT                   /db_xref="GeneID:3733875"
FT                   /locus_tag="Bcep18194_C6544"
FT   CDS_pept        27657..28565
FT                   /locus_tag="Bcep18194_C6544"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059664"
FT                   /db_xref="GeneID:3733875"
FT                   /translation="MKRFNVRKSIVEHPDFVAALKSIEDIHQWLRESGEAGCLATVGES
FT                   GAGKSTVLECYRARFPMREEVLRRHVPVLYVIVPAVPTVRSLAEAILIALGELPQAGQS
FT                   SARLTEQIVKLVHGCGVEIIMLDEFQHFVEGDRRSLRQVSNWLKVLLDRLPTAVVLSGL
FT                   PSLLGVLRVNGQLRRRFSRVTEIRPFDVSTQEGAETFIGVMQALAKDMPLPMVDITDKR
FT                   VAMKLYYATAGLVDYICKLLNGACLIAERRGAKNVGLNDFAEAFLIHIWKDAPPARNPF
FT                   DARFKGGPLDKPGEPFAGDVQ"
FT                   /protein_id="YP_366239.1"
FT   misc_feature    27687..28427
FT                   /note="Bacterial TniB protein; Region: TniB; pfam05621"
FT                   /db_xref="CDD:114349"
FT                   /locus_tag="Bcep18194_C6544"
FT   misc_feature    27780..28226
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Bcep18194_C6544"
FT   gene            28562..29530
FT                   /db_xref="GeneID:3733876"
FT                   /locus_tag="Bcep18194_C6545"
FT   CDS_pept        28562..29530
FT                   /locus_tag="Bcep18194_C6545"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059665"
FT                   /db_xref="GeneID:3733876"
FT                   /translation="MTTPLLLSVAPHRGESLSSLLHRVAEVNGLSGPGMVLRRAGVAAV
FT                   RPRFPSDADALARVCRLSPKLVRAITPLTVGAIDRNGTKHVKVGMYGHWVEPSLVMVGE
FT                   NERVCPACIAEHKHVLGVNAYVFATSCAVHGVRLLDRCPNCKRELSCLRLSLTRCQCGS
FT                   DLGSATCQPVEQGEMMIARLIDRRWRMSFERDVPSFPHDAPLDFRALDLGELLRALSFL
FT                   YRTSGATNGSPDKGLRSKAIHELAPRMQKVGRVMLNWPIGFTELVKAERLYRPRSVSRV
FT                   VVARSVEHISLRLFTELPEPKFAFLHTALVDAIDRNVTRAV"
FT                   /protein_id="YP_366240.1"
FT   gene            29622..29897
FT                   /db_xref="GeneID:3733877"
FT                   /locus_tag="Bcep18194_C6546"
FT   CDS_pept        29622..29897
FT                   /locus_tag="Bcep18194_C6546"
FT                   /gene_family="HOG000220273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059666"
FT                   /db_xref="GeneID:3733877"
FT                   /translation="MNACRCGACRSDCMIKRLPDDVWNRLVSLVQQMVDESGEPEGFDA
FT                   RKWLCTWLHEEVPSLGWKKPVAYLDTTDGEALVIATLKSLQSGAYR"
FT                   /protein_id="YP_366241.1"
FT   misc_feature    29748..29888
FT                   /note="Protein of unknown function (DUF2384); Region:
FT                   DUF2384; pfam09722"
FT                   /db_xref="CDD:150402"
FT                   /locus_tag="Bcep18194_C6546"
FT   gene            complement(30528..31769)
FT                   /db_xref="GeneID:3733878"
FT                   /locus_tag="Bcep18194_C6547"
FT   CDS_pept        complement(30528..31769)
FT                   /locus_tag="Bcep18194_C6547"
FT                   /gene_family="HOG000263080" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="CdaR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059667"
FT                   /db_xref="GeneID:3733878"
FT                   /translation="MTTAIPEISPTLRQWTASVAEHNDTFVERVYNTLMNIKPYADLDA
FT                   TTLLDVRDTIVLSSKLWLDSLVSGKMPSEEALEGFRAHGRRRVYQGVPLEALLRAFRLG
FT                   SRELWCVYIGVAGENDALRDELLLRISPYLLEFCDILSQEIAQTFLEEQYKQARWRESL
FT                   RYQLHGIILNFPDDTEGFNKTAAALRLDVAVPRVALAIDIELIDNNSATIRNEIDRIVA
FT                   AAAQCLRLPVDNIFDIWFREQLLMWIPVRPEAMIGANDLQMAKQIASIADTLPEVKAIG
FT                   VGLPGEGASGWAMSADEAGRALSFGRNHLNEERVRLYSEIAVEECIRGTKRAFAYLTSL
FT                   IERLAREPDLLKTLRTYFDQLQRRKATASVLGIHPNTLNYRLERIENILGARLDDVSWI
FT                   SKLDIAIKLGNTVQ"
FT                   /protein_id="YP_366242.1"
FT   misc_feature    complement(30546..>31433)
FT                   /note="Sugar diacid utilization regulator [Transcription /
FT                   Signal transduction mechanisms]; Region: CdaR; COG3835"
FT                   /db_xref="CDD:33627"
FT                   /locus_tag="Bcep18194_C6547"
FT   gene            complement(32033..33310)
FT                   /db_xref="GeneID:3733879"
FT                   /locus_tag="Bcep18194_C6548"
FT   CDS_pept        complement(32033..33310)
FT                   /locus_tag="Bcep18194_C6548"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="cytochrome c, class I"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059668"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR003219"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="GeneID:3733879"
FT                   /translation="MRKSTLTFLLAGCLALPGLVRAADAADPALVKRGEYLAVAGDCMA
FT                   CHTAKGGKPFAGGLGMPIPMLGKIYTSNITPDPETGIGNWSAEDFERAVRHGVSKNGDN
FT                   LYPAMPYVSYAKINDDDVQALYAYFMHGVEPVKQAPPKNEIPALLSMRWPLKIWNWLFL
FT                   KDGAYEPKPAQSAEWNRGSYLVQGLAHCSTCHTPRGIAMQEKSLDETGGSFLSGSVLAG
FT                   WDGYNITSDANAGIGGWTQQQLVQYLRTGSVPGLAQAAGPMAEAVEHSFSKMTEADIGA
FT                   ISTYIRTVPAVASGDAKQSRSSWGKPAEDGLTLRGVALASSGIDPARLYLGNCATCHQM
FT                   QGKGTPDGYYPPLFHNSTVGASNPTNLVQVILNGVERKAGSEDVGMPAFRHELSDAQIA
FT                   ALTNYLTGQFGNPAAKVTEQDVAKLR"
FT                   /protein_id="YP_366243.1"
FT   misc_feature    complement(32447..32896)
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="Bcep18194_C6548"
FT   misc_feature    complement(32087..32332)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="Bcep18194_C6548"
FT   gene            complement(33313..34932)
FT                   /db_xref="GeneID:3734136"
FT                   /locus_tag="Bcep18194_C6549"
FT   CDS_pept        complement(33313..34932)
FT                   /locus_tag="Bcep18194_C6549"
FT                   /gene_family="HOG000178853" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059669"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR000205"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="GeneID:3734136"
FT                   /translation="MADTDTQKADIVVVGSGVAGAIVAHQLAMAGKSVILLEAGPRMPR
FT                   WEIVERFRNQVDKTDFMAPYPSSAWAPHPEYGPPNDYLILKGEHKFNSQYIRAVGGTTW
FT                   HWAASAWRFIPNDFKMKTVYGVGRDWPIQYDDIEHYYQRAEEELGVWGPGPEEDLYSPR
FT                   KEPYPMPPLPLSFNEQTIKSALNGYDPKFHVVTEPVARNSRPYDGRPTCCGNNNCMPIC
FT                   PIGAMYNGIVHVEKAEQAGAKLIDSAVVYKLETGPDKRITAAVYKDKTGADHRVEGKYF
FT                   VIAANGIETPKILLMSANRDFPNGVANSSDMVGRNLMDHPGTGVSFYANEKLWPGRGPQ
FT                   EMTSLIGFRDGPFRANEAAKKIHLSNMSRINQETQKIFKGGKLMKPEELDAQIRDRSAR
FT                   FVQFDCFHEILPQPENRIVPSKTATDAVGIPRPEITYAIDDYVKRGAVHTREVYATAAK
FT                   VLGGTEVVFNDEFAPNNHITGATIMGADARDSVVDKDCRTFDHPNLFISSSSTMPTVGT
FT                   VNVTLTIAALALRMSDTLKKEV"
FT                   /protein_id="YP_366244.1"
FT   misc_feature    complement(33319..34854)
FT                   /note="Choline dehydrogenase and related flavoproteins
FT                   [Amino acid transport and metabolism]; Region: BetA;
FT                   COG2303"
FT                   /db_xref="CDD:32458"
FT                   /locus_tag="Bcep18194_C6549"
FT   misc_feature    complement(33970..34644)
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_N; pfam00732"
FT                   /db_xref="CDD:109776"
FT                   /locus_tag="Bcep18194_C6549"
FT   misc_feature    complement(33343..33702)
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
FT                   /db_xref="CDD:147408"
FT                   /locus_tag="Bcep18194_C6549"
FT   gene            complement(34932..35468)
FT                   /db_xref="GeneID:3734137"
FT                   /locus_tag="Bcep18194_C6550"
FT   CDS_pept        complement(34932..35468)
FT                   /locus_tag="Bcep18194_C6550"
FT                   /gene_family="HOG000198399" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059670"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:3734137"
FT                   /translation="MSYDYLKIPNMTNKTVPHPRRDIDAAVTGITRRQWLQGALALTAA
FT                   GLTGSLALRALADDPGTAPLDTFMTLSEALTGKKGLSRVLGQRFLQALQKGSFKTADSL
FT                   PQLASALASGSLNPDQEALALKILEAWYLGIVDNVVITYEEALMFSVVSDTLVIPSYCP
FT                   NKPGFWAEKPIERQA"
FT                   /protein_id="YP_366245.1"
FT   misc_feature    complement(34935..35384)
FT                   /note="Membrane bound FAD containing D-sorbitol
FT                   dehydrogenase; Region: FAD-SLDH; pfam12318"
FT                   /db_xref="CDD:152753"
FT                   /locus_tag="Bcep18194_C6550"
FT   gene            complement(35483..36490)
FT                   /db_xref="GeneID:3734138"
FT                   /locus_tag="Bcep18194_C6551"
FT   CDS_pept        complement(35483..36490)
FT                   /locus_tag="Bcep18194_C6551"
FT                   /gene_family="HOG000084825" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit II"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059671"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="GeneID:3734138"
FT                   /translation="MQIDLPVVWAAIIGLGVFIYVMLDGFDLGIGLLFPFFDAKAEREV
FT                   MLDTVAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLVLMLVGLIFRGAAFELR
FT                   AKATRTQHMWDLAFIGGSALAAFCQGIVLGSLLQGIKIENNQFAGGPFDWLSPFSLLCG
FT                   IGVLVTYATLGCGWLILKVDGELQRKMRLLMKPLAGVLLAVMGVVSLWTVLGLPAVAHR
FT                   WFGSGNLGWFLPVPILVIACVWGIFHTVKREHEATPLLLMFGLVFLGYTGFVISIWPNI
FT                   VPPSLSIWDASSSHSSQLFALVGTIIILPILLVYNAMQYHVFRGKARETDVTHY"
FT                   /protein_id="YP_366246.1"
FT   misc_feature    complement(35519..36481)
FT                   /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
FT                   pfam02322"
FT                   /db_xref="CDD:145462"
FT                   /locus_tag="Bcep18194_C6551"
FT   misc_feature    complement(35489..36367)
FT                   /note="cytochrome d oxidase, subunit II (cydB); Region:
FT                   cydB; TIGR00203"
FT                   /db_xref="CDD:129307"
FT                   /locus_tag="Bcep18194_C6551"
FT   gene            complement(36494..37894)
FT                   /db_xref="GeneID:3734139"
FT                   /locus_tag="Bcep18194_C6552"
FT   CDS_pept        complement(36494..37894)
FT                   /locus_tag="Bcep18194_C6552"
FT                   /gene_family="HOG000084937" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059672"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="GeneID:3734139"
FT                   /translation="MDIFDAFHLARLQFAFTVSFHIVFPAISIGMASFLAVLEWRYLVT
FT                   GDAVYKSMFQFWSKIFAIGFGMGVVSGVVMAYEFGTNWAGFSRVAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWQRVSPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGYKIEN
FT                   GLVVPVDWFKIVFNPSFPYRLVHMTIAAFIVAGFIVAACGAWHLLKGRRDEPVKRSFSM
FT                   ALWMLLILAPIQIVVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLFGLPDMQAET
FT                   TRYAIQVPHLGSLILTHSWDGEIRGLKEFPPQDRPYSPIVFWTFRIMAGLGMLMLLTAL
FT                   LGLLLRKGGRLYETRWFQWFVVAMGPSGILALLAGWITTEVGRQPWTVYGVLRTVDSVA
FT                   PLSAQQVGVSLLIFVVVYFLVFGTGIYYMMKLMKRGPAAQAGYIELHRHPGLRKSALST
FT                   PLNVTEAE"
FT                   /protein_id="YP_366247.1"
FT   misc_feature    complement(36587..37870)
FT                   /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
FT                   Bac_Ubq_Cox; cl00562"
FT                   /db_xref="CDD:153857"
FT                   /locus_tag="Bcep18194_C6552"
FT   gene            38369..38683
FT                   /db_xref="GeneID:3734140"
FT                   /locus_tag="Bcep18194_C6553"
FT   CDS_pept        38369..38683
FT                   /locus_tag="Bcep18194_C6553"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059673"
FT                   /db_xref="GeneID:3734140"
FT                   /translation="MAAMLPSSVALHIFLMRSSTVLSFISIAASLLLGGCVPAPSVAVF
FT                   GAAFPDWLFCIVVGVLGAGIVHVVLGKRGKRALLAPLAISYPALCALLAMAFWLLFFPH
FT                   "
FT                   /protein_id="YP_366248.1"
FT   gene            38697..39752
FT                   /db_xref="GeneID:3734141"
FT                   /locus_tag="Bcep18194_C6554"
FT   CDS_pept        38697..39752
FT                   /locus_tag="Bcep18194_C6554"
FT                   /gene_family="HOG000112073" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="multidrug resistance protein MdtN"
FT                   /transl_table="11"
FT                   /note="with MdtO and MdtP is involved in resistance to
FT                   puromycin, acriflavine and tetraphenylarsonium chloride"
FT                   /db_xref="GI:78059674"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:3734141"
FT                   /translation="MSDASGASRKKSLPAWLIVVATLVLLGVVVWRLDQALTTDDAYVY
FT                   ADTINVVPEVTGKIVEMPVRDNQPVKRGDLLFRIDPRPYQDALNQARARLVTLERQIGL
FT                   TQRTVNAQQYNADSVKAAVERSRAQAVQAADTLHRMEPLLAPGYMSAEDVDRARTAERA
FT                   AQAELNAAMLQAQQASAAVSGVDALVAQRAEVEAQIAIAELNLEFTEVRAPFDGRVASL
FT                   RTTVGQFASALKPVFTLIDIRHWYVIANFRETDLKGVRAGTSATVYLLSDTGKHFDGEV
FT                   DSISYGVLPDDGGVVQEGLPRVARSINWVHVSQRFPVKIAVRNPNPETFRIGTSAVATL
FT                   RRDASARGAAQ"
FT                   /protein_id="YP_366249.1"
FT   misc_feature    38697..39734
FT                   /note="multidrug resistance protein MdtN; Provisional;
FT                   Region: PRK10476"
FT                   /db_xref="CDD:170470"
FT                   /locus_tag="Bcep18194_C6554"
FT   gene            39724..41850
FT                   /db_xref="GeneID:3734142"
FT                   /locus_tag="Bcep18194_C6555"
FT   CDS_pept        39724..41850
FT                   /locus_tag="Bcep18194_C6555"
FT                   /gene_family="HOG000294560" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="multidrug efflux system protein MdtO"
FT                   /transl_table="11"
FT                   /note="possibly part of a tripartite efflux system composed
FT                   of MdtN, MdtO and MdtP which could be involved in
FT                   resistance to puromycin, acriflavine and
FT                   tetraphenylarsonium chloride"
FT                   /db_xref="GI:78059675"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="GeneID:3734142"
FT                   /translation="MPPPAARLSEHRMSTEQFASSNLQRLAGFIGGEVRPYPGRMNVML
FT                   RCLLTSALVIVTSMALQVPLLPVSLIVVFFVTQSNVVVTRLTGVLFVVGSTIAVGSTIL
FT                   VLKFTYDYPLLRILLAGTLVFLSVYMMRVAKIGVVFFIVGLTVIYGQTFVDSTDQAELL
FT                   VRAELWAWVAVTYAIALTLLINTLFLPVEPMRQLCSAMGGQLKAIDTSLAGLEHWALVA
FT                   SAPGAYEIQVGALTLKKLLRFATMRDAAYRANQALHLARVATVSRLYAATGHLPASSAG
FT                   LTVDAIPVLRDAIQRLADAVEADGQFVAPGALIDLGGDGLPGALAEMRDALLEFSGRSA
FT                   APQGVQSPAEKERLLVPDAVTNPVYAQFALKTLMAAMISYLFYIATDWQGIHTMMLTCL
FT                   IVAQPSLGSSVQRAVLRIGGAAVGSVLALAMVVWVMPHLDGVVGLLMMVLPVIALAAWV
FT                   SAGSEHISYAGTQIMFTFSLAVLEQFGPAINLTEIRDRMIGILFGVAVSAVVHACLWPE
FT                   AEGEALRQRAAKLLRRIGAQLRSDGTGPIPVTLWAELSDSEAMSARVALEPGWQMADGE
FT                   QESLTLRMQTLLARVREILLATDAFGAERNAQKLPGGIATATTAFQAELAGLLDGYASA
FT                   LAERPLTINAPPCASLAALSDCCAAELSTLPTDALRAAYDRLLTRASNLAVQVAGLPAW
FT                   APGSVGTVLTSRAS"
FT                   /protein_id="YP_366250.1"
FT   misc_feature    39724..41847
FT                   /note="Bacterial protein of unknown function (DUF939);
FT                   Region: DUF939; cl12136"
FT                   /db_xref="CDD:175407"
FT                   /locus_tag="Bcep18194_C6555"
FT   misc_feature    39841..41646
FT                   /note="Fusaric acid resistance protein family; Region:
FT                   FUSC; pfam04632"
FT                   /db_xref="CDD:147003"
FT                   /locus_tag="Bcep18194_C6555"
FT   gene            41853..43337
FT                   /db_xref="GeneID:3734143"
FT                   /locus_tag="Bcep18194_C6556"
FT   CDS_pept        41853..43337
FT                   /locus_tag="Bcep18194_C6556"
FT                   /gene_family="HOG000122243" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative outer membrane efflux protein MdtP"
FT                   /transl_table="11"
FT                   /note="part of a multidrug efflux system involved in
FT                   resistance to acriflavin, puromycin, erytjhromycin and
FT                   tetraphenylarsonium chloride; member of the outer membrane
FT                   factor (OMF) family"
FT                   /db_xref="GI:78059676"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:3734143"
FT                   /translation="MTDSLIRSFCLLLRHIAVTALLCGSAACALIHRDVKPSATLDPER
FT                   IRIANDIHLANDGWPSARWWMRYGDPQLDALVDRALADSPTIASAHSRVSQAKADVDLV
FT                   KAGTSLQVSALGSVNRERVSSNGFLSAYSGNQPMLGASGPWYTEGVVGLGASLDVDIWG
FT                   KQRAQVAAALGVHNARVVETSAIELEISADVAQIYYGIQTTYHLIDLLEQLHDIVTFSM
FT                   NAHAARASRGLEPQTQTEIARSQKLATERQIVAARGRIQQLRESLRALIGAGAVDLAEI
FT                   RPVALPTPPSSLPATLSFELLARRPDLQAMRWYVEGSFDKIDAAKAAFYPSFDIKAFFG
FT                   VNALHLGDLFTHASQQINLVPGLYLPIFDGGRLNANLGGARSASNLLILQYNQAILNAV
FT                   RDIATTGSQLQDLDAEAKLQTEKIQATTFSQDSADAQYQRGLASRLTAVEAKQAVILER
FT                   VALLDLDGRRIGQDIALTKALGGGYRSDAPVVLNPR"
FT                   /protein_id="YP_366251.1"
FT   misc_feature    41853..43334
FT                   /note="putative outer membrane efflux protein MdtP;
FT                   Provisional; Region: PRK09915"
FT                   /db_xref="CDD:170156"
FT                   /locus_tag="Bcep18194_C6556"
FT   misc_feature    42069..42668
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcep18194_C6556"
FT   misc_feature    42756..43292
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcep18194_C6556"
FT   gene            43337..43807
FT                   /db_xref="GeneID:3734144"
FT                   /locus_tag="Bcep18194_C6557"
FT   CDS_pept        43337..43807
FT                   /locus_tag="Bcep18194_C6557"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059677"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="GeneID:3734144"
FT                   /translation="MQIMSGESLRPTFCDVPFEADGFRTMQSVQLMIRNVVNQRMLIAL
FT                   GVQFSQGSALVHLARSDTMSCQALANLLGCGTSRLTRLAQDLERRALIVRRRNGQDRRA
FT                   LDLSLTSRGMEIAERVPFVVSEAEQVVLGRLSMEERMILKRFLQRILREIDA"
FT                   /protein_id="YP_366252.1"
FT   misc_feature    43433..43804
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   MarR; COG1846"
FT                   /db_xref="CDD:32031"
FT                   /locus_tag="Bcep18194_C6557"
FT   misc_feature    43454..43756
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6557"
FT   gene            44967..45872
FT                   /db_xref="GeneID:3734145"
FT                   /locus_tag="Bcep18194_C6558"
FT   CDS_pept        44967..45872
FT                   /locus_tag="Bcep18194_C6558"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059678"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3734145"
FT                   /translation="MAALDIVSAMRIFVRVIERGSISMAARDLDMGQSTVSERINRLEE
FT                   YLGIPLLYRHARTLTRTSDGQAFYACCKAALSAVDDALAVAQEHREIRGMFRISAPQSL
FT                   GEIIMPAVLLEIKAQYPDLYIDLDLNDSIVDPVTAGVDISLRLGRPVEGRGAKYRMGHV
FT                   RRKLVAAPSYLARYPEIEDPHGLSQHPFIRVRGVYGDRLLELDDSRGESISISLDLGMT
FT                   VSHWRAARELLLGGAGIGVLQLPACLDALTDGRLQQILPDYTVPGFDLHLILPVTRPIP
FT                   AKTRAILQILEHQLPARLAG"
FT                   /protein_id="YP_366253.1"
FT   misc_feature    44988..45866
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcep18194_C6558"
FT   misc_feature    44991..45164
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6558"
FT   misc_feature    45246..45824
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6558"
FT   misc_feature    order(45276..45278,45288..45290,45405..45407,45447..45449,
FT                   45453..45455,45642..45644,45693..45695,45774..45776)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6558"
FT   misc_feature    order(45279..45284,45294..45299,45303..45308,45315..45317,
FT                   45327..45329,45333..45353,45534..45536,45624..45638,
FT                   45657..45662,45669..45671)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6558"
FT   gene            46230..47144
FT                   /db_xref="GeneID:3734146"
FT                   /locus_tag="Bcep18194_C6559"
FT   CDS_pept        46230..47144
FT                   /locus_tag="Bcep18194_C6559"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059679"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3734146"
FT                   /translation="MRILDILTAMRAFVRVVECGSISDAAHGLGMGQSTVSERLDRLER
FT                   HLGLPLLFRHARTLTCTDDGQIFYERSKRAIALIEIAMGVSREQHDVRGIFKLAAPHAF
FT                   GEIVLAGIMVDIRKRYPELSVELVLEDAVIDPATAGVDLSLRLGQPGVAAQDSYYLGHV
FT                   HRTLVASPVYLAKHAPISEPSELADHPFIRARGIYNARDIELIAADSAMVKVRVNVAFS
FT                   VNHWRPAREHLIAGFGIGILQRRVCAEAIADGRLQQILPEYNVSGLDLHAVLPVARPLP
FT                   PKTRAILSIIEECLPGQLAQARA"
FT                   /protein_id="YP_366254.1"
FT   misc_feature    46248..47114
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcep18194_C6559"
FT   misc_feature    46248..46427
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6559"
FT   misc_feature    46509..47087
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6559"
FT   misc_feature    order(46539..46541,46551..46553,46668..46670,46710..46712,
FT                   46716..46718,46905..46907,46956..46958,47037..47039)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6559"
FT   misc_feature    order(46542..46547,46557..46562,46566..46571,46578..46580,
FT                   46590..46592,46596..46616,46797..46799,46887..46901,
FT                   46920..46925,46932..46934)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6559"
FT   gene            complement(47457..47585)
FT                   /db_xref="GeneID:3734147"
FT                   /locus_tag="Bcep18194_C6560"
FT                   /pseudo
FT   gene            48249..48584
FT                   /db_xref="GeneID:3734148"
FT                   /locus_tag="Bcep18194_C6561"
FT   CDS_pept        48249..48584
FT                   /locus_tag="Bcep18194_C6561"
FT                   /gene_family="HOG000144507" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059680"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:3734148"
FT                   /translation="METNRTIAALAALAHESRLAVFRALVQAGPEGLPAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLLAYLTENCCGGNPCSPVSACP
FT                   TSGTRQS"
FT                   /protein_id="YP_366255.1"
FT   misc_feature    48276..48476
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bcep18194_C6561"
FT   misc_feature    order(48276..48281,48285..48287,48294..48296,48303..48308,
FT                   48315..48320,48327..48329,48426..48428)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bcep18194_C6561"
FT   misc_feature    order(48279..48284,48294..48302,48348..48356,48381..48392,
FT                   48396..48401,48408..48413,48417..48422,48438..48446,
FT                   48459..48467)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bcep18194_C6561"
FT   misc_feature    order(48348..48350,48357..48359)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Bcep18194_C6561"
FT   gene            48596..49102
FT                   /db_xref="GeneID:3734149"
FT                   /locus_tag="Bcep18194_C6562"
FT   CDS_pept        48596..49102
FT                   /product="protein tyrosine phosphatase"
FT                   /gene_family="HOG000273092" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6562"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="GI:78059681"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="GeneID:3734149"
FT                   /translation="MPPPMTTNILILCTHNSARSVLAEGMLNHWAAKLGKDVRAYSAGS
FT                   APSGRLNPFALEALTNAGIDVDGYRSKSWDEFVGDGVPEMRVVITVCDSAAAETCPYWP
FT                   GSPVKVHWGYADPSNAAGGDDGRRLAFELTRQAIGYRMLQLLALPLDRMNDAELQTALI
FT                   EISQN"
FT                   /transl_table="11"
FT                   /protein_id="YP_366256.1"
FT   misc_feature    48614..49036
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bcep18194_C6562"
FT   misc_feature    48614..49036
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Bcep18194_C6562"
FT   misc_feature    order(48632..48634,48638..48643,48647..48655)
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Bcep18194_C6562"
FT   gene            49167..50240
FT                   /db_xref="GeneID:3734150"
FT                   /locus_tag="Bcep18194_C6563"
FT   CDS_pept        49167..50240
FT                   /locus_tag="Bcep18194_C6563"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="putative arsenate-sodium symporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059682"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="GeneID:3734150"
FT                   /translation="MNTSNVAPPGKVVAKPSINFFERYLTVWVALCIVAGIALGQVLPG
FT                   LFQQIGRIEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRRHVKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFTPLVGLLLGMSAITVPWATLLTSVVLYIVIPVILAQIWRKVLLARR
FT                   QAAFDAAMAKIGPWSIAALLATLVLLFAFQGEAILTQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHDIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRT"
FT                   /protein_id="YP_366257.1"
FT   misc_feature    49218..50204
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Bcep18194_C6563"
FT   gene            50262..50684
FT                   /db_xref="GeneID:3734151"
FT                   /locus_tag="Bcep18194_C6564"
FT   CDS_pept        50262..50684
FT                   /product="arsenate reductase"
FT                   /gene_family="HOG000059717" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6564"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="GI:78059683"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:3734151"
FT                   /translation="MTAITIYHNPDCDTSRNTLALIRNSGEEPAVIEYLETPPPRETLV
FT                   KLLADAGLTVREVLREKGTPYAELGLGDPKWTDGQLLDFIEQYPILMNRPVVVTPIGTK
FT                   LCRPSEAVLDILPNPQKGPFTKEDGEVVIRAEGERV"
FT                   /transl_table="11"
FT                   /protein_id="YP_366258.1"
FT   misc_feature    50271..50606
FT                   /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
FT                   arsenic reductases similar to that encoded by arsC on the
FT                   R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
FT                   the reduction of arsenate [As(V)] to arsenite [As(III)],
FT                   the first step in the...; Region: ArsC_ArsC; cd03034"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bcep18194_C6564"
FT   misc_feature    order(50295..50297,50439..50441,50541..50543,50580..50582)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48583"
FT                   /locus_tag="Bcep18194_C6564"
FT   gene            50662..51399
FT                   /db_xref="GeneID:3734152"
FT                   /locus_tag="Bcep18194_C6565"
FT   CDS_pept        50662..51399
FT                   /locus_tag="Bcep18194_C6565"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059684"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="GeneID:3734152"
FT                   /translation="MRRASVSEQLKDLPQLDAALFRVPDAVRLRPASPSTHPPRLLLLY
FT                   GSLRERSFSRLLVEEAGRLLTAMGAEVRVFNPSGLPLPDDAPEHHPKVVELRELVMWSE
FT                   GMAWCSPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRV
FT                   LGRWMRMLTIPNQSSVAKAFAEFDEAGRMKPSSYYDRVVDVMEELVKFTLLTRDIGPYL
FT                   VDRYSERKESAEALSNRVNQRSI"
FT                   /protein_id="YP_366259.1"
FT   misc_feature    50698..51354
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Bcep18194_C6565"
FT   gene            51422..51850
FT                   /db_xref="GeneID:3734153"
FT                   /locus_tag="Bcep18194_C6566"
FT   CDS_pept        51422..51850
FT                   /locus_tag="Bcep18194_C6566"
FT                   /gene_family="HOG000236614" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059685"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:3734153"
FT                   /translation="MEIRPATVDDLASIEALLHQCGLPVIGVSDHLQDFVVAMDGSTMC
FT                   GCGGIERYDDAALLRSIAVAEHARDAGLGQRIVSRLVAACHLLQVRSLVLLTTTAEDYF
FT                   ARLGFVCVARDDVPHLVRTSSKFQGVCPGSAVSMLRVL"
FT                   /protein_id="YP_366260.1"
FT   misc_feature    51422..51847
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Bcep18194_C6566"
FT   gene            52400..52825
FT                   /db_xref="GeneID:3734154"
FT                   /locus_tag="Bcep18194_C6567"
FT   CDS_pept        52400..52825
FT                   /locus_tag="Bcep18194_C6567"
FT                   /gene_family="HOG000221454" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059686"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="GeneID:3734154"
FT                   /translation="MAASNRKAGASATKHDLEQLSEFRYRLRRFLRFSEEILRAEGLTP
FT                   LQYMLMLHTCAFPDRSWATVGEIAERLQASSHGTVALITRCEAAGLVRRQTSEQDRRQA
FT                   EIHLTEKGAECLRKVAALHKSEIQSFGWAFHDVTDIN"
FT                   /protein_id="YP_366261.1"
FT   misc_feature    52517..52789
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6567"
FT   gene            52951..54552
FT                   /db_xref="GeneID:3734155"
FT                   /locus_tag="Bcep18194_C6568"
FT   CDS_pept        52951..54552
FT                   /locus_tag="Bcep18194_C6568"
FT                   /gene_family="HOG000173493" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="putative amino acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059687"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="GeneID:3734155"
FT                   /translation="MSTTSSLNLEGKLRRDAGIIGLLFASTTSMVGSGWLFGAYHASRI
FT                   AGPLSIGSWVLGAIIIMLIALCFAELAAMFPRSGALVHMSHASHGVGLGRIWCGLLFLA
FT                   YVPVPAVEAEAIVTYANNYLPWFIQPGSAGLLTAVGFVACAGLLGIMALLNLMVIRWLL
FT                   SVNSTITWWKILVPLLTIAGLLGASTHWGVMHAAPGSYHVSGMFTALPAAGIVFSYLGF
FT                   RTAIDLGGESANPHRNIPLAVIGAVLLAAVIYILLQVAFIYALAPADLAAGWNNLSFKG
FT                   EMGPFAGLATTLGMGWMATLLYIDAYVSPGGTGLMYVTGGSRILFAAGELDAGPRMLTR
FT                   LNANRIPWVAVLIMWAVGVLFLMPFPAWQQMVSYITSITVLTYGLGPIALLVLRRNVPE
FT                   LQRPFRMSGAGLIAPLAFVCSNLVIYWTGFKTNNFLFSLVAIGFVLYALHHHVVLRRSA
FT                   RDFGWKHIAWLLPWFGGLWLLSWMGGIGGGLGVIGFGWDILLVAAWSVVVLVLAVRSAL
FT                   DAGETLEMMGRMNETS"
FT                   /protein_id="YP_366262.1"
FT   misc_feature    52978..54318
FT                   /note="Amino acid transporters [Amino acid transport and
FT                   metabolism]; Region: PotE; COG0531"
FT                   /db_xref="CDD:30877"
FT                   /locus_tag="Bcep18194_C6568"
FT   misc_feature    52987..54288
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Bcep18194_C6568"
FT   gene            54586..55848
FT                   /db_xref="GeneID:3733925"
FT                   /locus_tag="Bcep18194_C6569"
FT   CDS_pept        54586..55848
FT                   /locus_tag="Bcep18194_C6569"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="Cl- channel, voltage gated"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059688"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="GeneID:3733925"
FT                   /translation="MTSGSTGGEDGAAGELASLRVETGRVQRASQTEDDASPIDMYRLS
FT                   CLGIVVGVVTGIGAVAFRGLIGFVHNAFFLGRFSASYNASEFTPTSVWGAFVILVPVVG
FT                   GLVVTWLVCTFAPEAKGHGVPEVMDAIYFKRGVIRPVVAIVKSLASAFAIGTGAAVGRE
FT                   GPIIQIGSALGSTLGQAVRMTTGQRITLVAAGAGAGIAATFNTPIGGVLFATELMMPEI
FT                   SVNTFLPVALATGTATFVGRLFFGSAPAFLVPAQLGAIPDRPGSVLTLLLYAALGIVTG
FT                   VGAAMLTHGLHVAEDIFERIPGRYARHALGMLLVGVTIYLLMRFAGHYYVEGVGYATIQ
FT                   ALLYGQLGGGLFLITLALCKTLATSISLGSGSSGGVFSPSLFIGAALGAAFAASVQAVS
FT                   ARLRSRWSGWGRWWAGEPVRR"
FT                   /protein_id="YP_366263.1"
FT   misc_feature    54928..>55677
FT                   /note="CLC voltage-gated chloride channel. The ClC chloride
FT                   channels catalyse the selective flow of Cl- ions across
FT                   cell membranes, thereby regulating electrical excitation in
FT                   skeletal muscle and the flow of salt and water across
FT                   epithelial barriers. This...; Region: Voltage_gated_ClC;
FT                   cd00400"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6569"
FT   misc_feature    order(54961..54975,55066..55080)
FT                   /note="Cl- selectivity filter; other site"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6569"
FT   misc_feature    order(54964..54966,54970..54972,55072..55077)
FT                   /note="Cl- binding residues; other site"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6569"
FT   misc_feature    55072..55074
FT                   /note="pore gating glutamate residue; other site"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6569"
FT   misc_feature    order(55207..55209,55234..55236,55279..55281,55300..55302)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6569"
FT   gene            55845..56549
FT                   /db_xref="GeneID:3733926"
FT                   /locus_tag="Bcep18194_C6570"
FT   CDS_pept        55845..56549
FT                   /locus_tag="Bcep18194_C6570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="CBS"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059689"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:3733926"
FT                   /translation="MTAVAMIFEMTRDYDIVLPMIIAVAVSLATRRLLCRESIYTLKLV
FT                   RRGHVIPNALHANMFLVQNAAQVMETDVLVQDAEVLFRDILGNLDGPPFRHVVVTRSGR
FT                   IDGVLRINTGLRRAISHDHPSVTLGMLAQRNFIVVAPGEAAFDVISKLRQKHATMAVVV
FT                   TQPEEEGAMEVVGVIAKEHIADAVASSIRIFPENQRGTQRSLRSGKQHGDSHASTRAEA
FT                   HAGKEGQHETQR"
FT                   /protein_id="YP_366264.1"
FT   misc_feature    <55845..55976
FT                   /note="CLC voltage-gated chloride channel. The ClC chloride
FT                   channels catalyse the selective flow of Cl- ions across
FT                   cell membranes, thereby regulating electrical excitation in
FT                   skeletal muscle and the flow of salt and water across
FT                   epithelial barriers. This...; Region: Voltage_gated_ClC;
FT                   cl02915"
FT                   /db_xref="CDD:174739"
FT                   /locus_tag="Bcep18194_C6570"
FT   misc_feature    order(55845..55847,55869..55871,55905..55907,55926..55931)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:79359"
FT                   /locus_tag="Bcep18194_C6570"
FT   misc_feature    <55851..56267
FT                   /note="putative voltage-gated ClC-type chloride channel
FT                   ClcB; Provisional; Region: PRK01862"
FT                   /db_xref="CDD:167288"
FT                   /locus_tag="Bcep18194_C6570"
FT   gene            complement(56859..57362)
FT                   /db_xref="GeneID:3733927"
FT                   /locus_tag="Bcep18194_C6571"
FT   CDS_pept        complement(56859..57362)
FT                   /locus_tag="Bcep18194_C6571"
FT                   /gene_family="HOG000189913" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="OmpA/MotB family outer membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059690"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:3733927"
FT                   /translation="MKSLTRYAVLLALVLFGGCHSATKTPSTAGMMNQGTANGQAIGTP
FT                   STMADELNNPNSPLAKRSIYFDFDSYEVKPEYQSLLQAHADYLRLHPGRHILIQGNTDE
FT                   RGTSEYNLALGERRSQAVLRTLETLGVPDAQIEAVSFGKEKPVALGHDEASWAQNRRAD
FT                   IVYR"
FT                   /protein_id="YP_366265.1"
FT   misc_feature    complement(56868..57176)
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Bcep18194_C6571"
FT   misc_feature    complement(order(56883..56885,56895..56897,57021..57023,
FT                   57030..57035,57045..57047,57054..57059,57156..57161))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Bcep18194_C6571"
FT   gene            57767..58954
FT                   /db_xref="GeneID:3733928"
FT                   /locus_tag="Bcep18194_C6572"
FT   CDS_pept        57767..58954
FT                   /locus_tag="Bcep18194_C6572"
FT                   /gene_family="HOG000264695" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059691"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:3733928"
FT                   /translation="MSQSSIVSSRMTAPELRATTSLAAIFALRMLGLFMIMPVFSVYAK
FT                   TIPGGDNVLLVGIALGAYGVTQSLFYIFYGWASDKFGRKPVIATGLVIFAIGSFVAASA
FT                   HDITWIIVGRVIQGMGAVSSAVLAFIADLTSEQNRTKAMAMVGGSIGVSFAVAIVGAPI
FT                   VFHWVGMSGLFAIVGVLSILAIGVVLWIVPDAAKPVHVPAPFAEVLHNVELLRLNFGVL
FT                   VLHATQTALFLVVPRLLVDGGLPVAAHWKVYLPVMGLAFVMMVPAIIVAEKRGKMKPVL
FT                   LGGILAILIGQLLLGSAPHTILIVAAVLFVYFLGFNILEASQPSLVSKLAPGSRKGAAT
FT                   GVYNTTQSIGLALGGIVGGWLLKQGGPNMVFLMCAGMVAVWLAIAFGMKPPPRRA"
FT                   /protein_id="YP_366266.1"
FT   misc_feature    57830..58924
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep18194_C6572"
FT   misc_feature    57830..58831
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="Bcep18194_C6572"
FT   misc_feature    order(57863..57865,57872..57880,57884..57889,57944..57946,
FT                   57953..57958,57965..57967,57977..57982,57986..57991,
FT                   58133..58138,58145..58150,58157..58159,58193..58198,
FT                   58205..58210,58226..58228,58439..58441,58448..58453,
FT                   58460..58465,58472..58474,58514..58516,58526..58528,
FT                   58538..58540,58547..58549,58559..58561,58703..58705,
FT                   58712..58717,58724..58726,58736..58741,58748..58750,
FT                   58781..58786,58793..58798,58805..58810,58817..58819)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep18194_C6572"
FT   gene            59012..60331
FT                   /db_xref="GeneID:3733929"
FT                   /locus_tag="Bcep18194_C6573"
FT   CDS_pept        59012..60331
FT                   /locus_tag="Bcep18194_C6573"
FT                   /gene_family="HOG000257545" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="Cl- channel, voltage gated"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059692"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="GeneID:3733929"
FT                   /translation="MIRISALADRRALLHARRLWLHYGVFWLGAVAVGLVAVLYAKLID
FT                   FGYAVFLGYAAEHAWLPLIVTPLIGAVTVWLTRRFFDGAEGSGIPQVIAMLHAPGNTGA
FT                   RLLKFRILIGKILVSFLAILGGFTIGREGPTIHVGAALMFNLRQFYPQRFRAIRPGVLE
FT                   HRLALAGAAAGLSAAFNAPLAGVVFAIEELTRSFEQRTSGVLITAIIFAGIVSLGIQGN
FT                   YVYFGTIDVGAHLPQSLALAVILIGVIAGVMGGIFCWLLLNTRRWMPRRLQDFRAGQPV
FT                   LFGAACGLVVAVVGVATHGHTFGSGYAEARSMLESHTNVSVLYPVFKMVSMIGSYLPGA
FT                   PGGLFAPSLAIGAGIGNTLHTLFSGMQLQMLIALGMVGYLAAVTQSPITAFVIVIEMIN
FT                   GHALVISLMATALIASRVSRFFAPPLYEALSTRYFPADHR"
FT                   /protein_id="YP_366267.1"
FT   misc_feature    59144..60289
FT                   /note="ClC chloride channel family. These protein
FT                   sequences, closely related to the ClC Eric family, are
FT                   putative halogen ion (Cl-, Br- and I-) transport proteins
FT                   found in eubacteria. They belong to the ClC superfamily of
FT                   chloride ion channels, which share a...; Region: EriC_like;
FT                   cd01034"
FT                   /db_xref="CDD:79362"
FT                   /locus_tag="Bcep18194_C6573"
FT   misc_feature    59213..60271
FT                   /note="Voltage gated chloride channel; Region: Voltage_CLC;
FT                   pfam00654"
FT                   /db_xref="CDD:144305"
FT                   /locus_tag="Bcep18194_C6573"
FT   misc_feature    order(59267..59281,59399..59413,60038..60052,60287..60289)
FT                   /note="putative ion selectivity filter; other site"
FT                   /db_xref="CDD:79362"
FT                   /locus_tag="Bcep18194_C6573"
FT   misc_feature    59405..59407
FT                   /note="putative pore gating glutamate residue; other site"
FT                   /db_xref="CDD:79362"
FT                   /locus_tag="Bcep18194_C6573"
FT   misc_feature    59585..59587
FT                   /note="putative H+/Cl- coupling transport residue; other
FT                   site"
FT                   /db_xref="CDD:79362"
FT                   /locus_tag="Bcep18194_C6573"
FT   gene            60495..60743
FT                   /db_xref="GeneID:3733930"
FT                   /locus_tag="Bcep18194_C6574"
FT   CDS_pept        60495..60743
FT                   /locus_tag="Bcep18194_C6574"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059693"
FT                   /db_xref="GeneID:3733930"
FT                   /translation="MTIAAANALIFFATESPVSYGILHFLDAFSSGFGMPVIAVAEMRS
FT                   FTHGHRLSVGQDAHFFVMAAAGAIALVATGSAQSVLP"
FT                   /protein_id="YP_366268.1"
FT   gene            complement(60768..62066)
FT                   /db_xref="GeneID:3733931"
FT                   /locus_tag="Bcep18194_C6575"
FT   CDS_pept        complement(60768..62066)
FT                   /locus_tag="Bcep18194_C6575"
FT                   /gene_family="HOG000152205" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="manganese/iron transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059694"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="GeneID:3733931"
FT                   /translation="MNEAMIQAVVPKTLTEQTCSDIRETLAGRRRGARTVLSFAGPAVV
FT                   ASIAYMDPGNFATNIQAGAGYGYTLLWVVALANVVAMLFQSLSAKLGLVTGRNLAELCR
FT                   DSLPRRWVIAMWGMSEVAAMATDLAEFVGGAIGVSLLLHLPMIPSMLITAAVTYGLLQF
FT                   EKLGFRPLELAIAALIGVIGLSYLAELLIAPVHWPSVALHSVTPSIPDSNALTISVGII
FT                   GATVMPHVLFLHSGLTQNRVRPRNDRECSQLLAFSNVEVVVALGIAGLINMAMVIMASS
FT                   AFHLGHADIASIETAWRTLTPLLGGAAAGLFLTALIASGISSSVVGTMAGQMIMQGFVG
FT                   FRIPVWVRRLVTMAPAFIVVASGVDATRALVLSQVMLSIALPVPMIALVWFTSRRDLMG
FT                   RHMNRRVTTVSAVLGTLLVLALNGVLLVQLALG"
FT                   /protein_id="YP_366269.1"
FT   misc_feature    complement(60852..61985)
FT                   /note="Natural resistance-associated macrophage protein;
FT                   Region: Nramp; cl00836"
FT                   /db_xref="CDD:174415"
FT                   /locus_tag="Bcep18194_C6575"
FT   gene            complement(62157..63134)
FT                   /db_xref="GeneID:3733932"
FT                   /locus_tag="Bcep18194_C6576"
FT   CDS_pept        complement(62157..63134)
FT                   /locus_tag="Bcep18194_C6576"
FT                   /gene_family="HOG000273130" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059695"
FT                   /db_xref="GeneID:3733932"
FT                   /translation="MSDVKTDSSALIDVFDRRVERRLQRRQFFRNAGGLGLGLMGGTLI
FT                   SACGGGSGVDATAAGAPTDAEILNFALNLEYLESQFYTYATTGSGLPAGMVTGVGTPGA
FT                   VIPGQQVPFQDPVVQAYANEIAKDEREHVTFLRTALGSAAVAQPAIDIGGTDPNGAFSV
FT                   AARAAGLVGSGVAFNPYASDNNFLLGAFIFEDVGVTAYKGASPLITNKTFLEAAAGILA
FT                   AEAYHAGLVRTVLFAKGVDMTSLVNAANAISAARASLDQVGNDDQGITGSTPGSSNIVP
FT                   LDSNGLAYSRGYGNVLNIVYLTSTAAMKGGFFPNGVNGSLNMSA"
FT                   /protein_id="YP_366270.1"
FT   misc_feature    complement(<62730..>62945)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Bcep18194_C6576"
FT   gene            63515..64069
FT                   /db_xref="GeneID:3733933"
FT                   /locus_tag="Bcep18194_C6577"
FT   CDS_pept        63515..64069
FT                   /locus_tag="Bcep18194_C6577"
FT                   /gene_family="HOG000246923" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="beta-Ig-H3/fasciclin repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059696"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="GeneID:3733933"
FT                   /translation="MKRTVLFSAVALSVIAINVLAAGGTVMVGGQAMYPTKDIVDNAVN
FT                   SADHTTLVAAVKAAGLVDTLKGAGPFTVFAPTNEAFAALPAGTVDNLVKPENKAILTRI
FT                   LTYHVLPGRYDFRKLDQAIREGGGKAELKTVNGETLVFSENGPHNIVVMDAAGHTADIS
FT                   TYDVYQSNGVIMVVDKVLMPK"
FT                   /protein_id="YP_366271.1"
FT   misc_feature    63515..64066
FT                   /note="Secreted and surface protein containing
FT                   fasciclin-like repeats [Cell envelope biogenesis, outer
FT                   membrane]; Region: COG2335"
FT                   /db_xref="CDD:32486"
FT                   /locus_tag="Bcep18194_C6577"
FT   misc_feature    63656..64063
FT                   /note="Fasciclin domain; Region: Fasciclin; cl02663"
FT                   /db_xref="CDD:155047"
FT                   /locus_tag="Bcep18194_C6577"
FT   gene            complement(64188..65156)
FT                   /db_xref="GeneID:3733934"
FT                   /locus_tag="Bcep18194_C6578"
FT   CDS_pept        complement(64188..65156)
FT                   /locus_tag="Bcep18194_C6578"
FT                   /gene_family="HOG000236235" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="esterase/lipase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059697"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="GeneID:3733934"
FT                   /translation="MRSGWTGRSWRRSLPRKVLTSPCRILTALLLSAVAGARAEPVSLE
FT                   TYLVMHGPTPDTVVHYGPAPSQVVDFFRPPGQGPFPVAILVHGGCWQSRYGGRLQLRVL
FT                   AAQLARQGIAVWNVEYRRIDEPGGGYPGTYQDIGAAVDLLDVQAASLDLDSSRVVAVGH
FT                   SAGAQLAVWAASRARLPRGSALFVPRPLSIPTVVSLGGLLDLRSDANAIRESCGIDIAA
FT                   LTGMPSELRPDVLSDTSPASLVPNDMNVIAITGALDSVAPPGLARRYVALVQRAGGSAR
FT                   AIVVPDANHLDEVIPDSPVWPILDAIVLDALRVPSRQGGHR"
FT                   /protein_id="YP_366272.1"
FT   misc_feature    complement(64287..>64760)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcep18194_C6578"
FT   gene            complement(65651..66238)
FT                   /db_xref="GeneID:3733935"
FT                   /locus_tag="Bcep18194_C6579"
FT   CDS_pept        complement(65651..66238)
FT                   /locus_tag="Bcep18194_C6579"
FT                   /gene_family="HOG000024013" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059698"
FT                   /db_xref="GeneID:3733935"
FT                   /translation="MREPAKTTAVMSGACRPMIRSAAAETAAYLALSQAGWFVCVLSAA
FT                   HGRGWIGTLCAGLLAGAHLLRARAHAREAALMAIVTALGWSWDAVPVATGWLRYPNGVL
FT                   LEGAAPYWIAGLWVLFSTQLNVSLRWLRERWLTAALLGAVAGPLSFRAGATLGAVQIAS
FT                   PAAWVLLGCGWGILLPSAVWLARRLDGTRHEP"
FT                   /protein_id="YP_366273.1"
FT   misc_feature    complement(65702..66133)
FT                   /note="Protein of unknown function (DUF2878); Region:
FT                   DUF2878; pfam11086"
FT                   /db_xref="CDD:151531"
FT                   /locus_tag="Bcep18194_C6579"
FT   gene            complement(66246..66773)
FT                   /db_xref="GeneID:3733936"
FT                   /locus_tag="Bcep18194_C6580"
FT   CDS_pept        complement(66246..66773)
FT                   /locus_tag="Bcep18194_C6580"
FT                   /gene_family="HOG000273553" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059699"
FT                   /db_xref="GeneID:3733936"
FT                   /translation="MARRLAIVVAVAAFATTQVARAGCVDDVAPARLIGSGRFCVLGIC
FT                   LYDAQLWAPRAPAAFDTPFALSLTYRHDVKGERLVSTGMSEIERLAPAPLPAATRDAWR
FT                   ADIARAFTDVLRGDVLCGVYLPGQGARFYTNGRLTADVADPDFARAFFDIWLDPRTRAG
FT                   SLRRQLLGDPGG"
FT                   /protein_id="YP_366274.1"
FT   gene            complement(66763..67992)
FT                   /db_xref="GeneID:3733937"
FT                   /locus_tag="Bcep18194_C6581"
FT   CDS_pept        complement(66763..67992)
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /gene_family="HOG000245193" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6581"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="GI:78059700"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="GeneID:3733937"
FT                   /translation="MTLLHLLSCASQPAMPLSPRLFVALLRRLRHGHLTLVTPDGAQHV
FT                   FGDPHRQPAATLQIHDWRACRAILRAGDIGFAEAYRACRVDTPDLVTLLRLAIRNEPAI
FT                   AQTLTGGRLARVWYALRHRLRMNTRAGSRRNIHAHYDLGNRFYGLWLDDTWTYSSACFD
FT                   GDEQRPLADAQAAKYQRIVESLGLRAGMHVLEIGCGWGGFAMHAARQGIRVHALTISGA
FT                   QYVLAVERIARAGLSDLVTVELRDYRDIDGQYDAIVSIEMFEAVGEAFWPVYFDTLRQR
FT                   LKVGARALIQSITIDDSQFEAYRASSDFIREFIFPGGMLPSPGRFIEAARRAGLAAEPV
FT                   LAFGLDYARTLRAWRAAFEDHLDAVRAQGFDDTFIRTWRLYLAYCEAGFAERRTDVMHF
FT                   VVSSGDRHGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_366275.1"
FT   misc_feature    complement(66787..67638)
FT                   /note="Cyclopropane fatty acid synthase and related
FT                   methyltransferases [Cell envelope biogenesis, outer
FT                   membrane]; Region: Cfa; COG2230"
FT                   /db_xref="CDD:32411"
FT                   /locus_tag="Bcep18194_C6581"
FT   misc_feature    complement(67120..67416)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep18194_C6581"
FT   misc_feature    complement(order(67213..67215,67252..67260,67336..67341,
FT                   67387..67407))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep18194_C6581"
FT   gene            complement(67989..68843)
FT                   /db_xref="GeneID:3733938"
FT                   /locus_tag="Bcep18194_C6582"
FT   CDS_pept        complement(67989..68843)
FT                   /locus_tag="Bcep18194_C6582"
FT                   /gene_family="HOG000246188" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059701"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="GeneID:3733938"
FT                   /translation="MNAPFARDGSAARLLVGYVTHERLRPVRHAFTYPLFQVCCDVERL
FT                   HEIDGRWFGIDRWRPLGLASRDYGPRDGRPLAPWMRARLAEAGIPADGPIWLQTIPRMF
FT                   GHAFNPVSFWYCYDRAGRLRALYADVRNTFGAHHGYLLSAPCHAPIGGGTVLVCRKTFH
FT                   VSPFCDVVGHYAFRVRQCGDRLLVAIDYRDDGGLLLRTALGMRAQPLTAARAWRALTRQ
FT                   PLNALAVVVRIHWQALRLWLKRVPFHGRTPPAQPPSGDAPASPPVQASPPCSPAMSDHE
FT                   VRP"
FT                   /protein_id="YP_366276.1"
FT   misc_feature    complement(68076..68810)
FT                   /note="Protein of unknown function (DUF1365); Region:
FT                   DUF1365; cl01388"
FT                   /db_xref="CDD:154373"
FT                   /locus_tag="Bcep18194_C6582"
FT   gene            complement(68840..70147)
FT                   /db_xref="GeneID:3733939"
FT                   /locus_tag="Bcep18194_C6583"
FT   CDS_pept        complement(68840..70147)
FT                   /locus_tag="Bcep18194_C6583"
FT                   /gene_family="HOG000246199" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059702"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:3733939"
FT                   /translation="MHPHPTASPPGRRIAVVGAGIAGLASAYLLARRHRVTLFEAADYL
FT                   GGHTHTVDIELDGASHPVDTGFLVFNERTYPNLIALLDEIGVAAHPSDMSFSVSVDGGR
FT                   LEWAGSNLNTVFAQRRNLFSPSFLGMLRDILRFNASAQRHLETAHRQRLSVGELLAAGG
FT                   YGTSFQEHYLLPMAAAIWSSNADDILRFPAATFLRFCLNHALLQVNDRPPWRTIAGGAR
FT                   RYVERIAATLDDVRVNTPVRTILRDEHGVTVATDAAGHERFDAVVLACHAPTSLRLLAD
FT                   ASDAERGVLGAVRYRHNVAVLHTDTALLPRRRRVWSAWNYLSRRTAPAAGGASPVCVSY
FT                   LINQLQPLPFRTPVVVTLNPVDAPAPGTQLGSYDYEHPLLDLAAVDAQQRLPALQGRRR
FT                   TWFAGAWTGYGFHEDGLKSALRVVDDFGVKPAWATS"
FT                   /protein_id="YP_366277.1"
FT   misc_feature    complement(<69305..70072)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Bcep18194_C6583"
FT   misc_feature    complement(68873..70069)
FT                   /note="Flavin containing amine oxidoreductase; Region:
FT                   Amino_oxidase; pfam01593"
FT                   /db_xref="CDD:144982"
FT                   /locus_tag="Bcep18194_C6583"
FT   misc_feature    complement(<68936..69358)
FT                   /note="General secretion pathway protein L (GspL); Region:
FT                   GspL; cl11448"
FT                   /db_xref="CDD:175260"
FT                   /locus_tag="Bcep18194_C6583"
FT   gene            complement(70240..70848)
FT                   /db_xref="GeneID:3733940"
FT                   /locus_tag="Bcep18194_C6584"
FT   CDS_pept        complement(70240..70848)
FT                   /locus_tag="Bcep18194_C6584"
FT                   /gene_family="HOG000061523" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="lipocalin-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059703"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="GeneID:3733940"
FT                   /translation="MPYRIVRRVAVLLAPGLALAAAGCPGTPPNPNPRAAVPLSTVPVD
FT                   LPRYMGRWYVIANIPYLAERDYVGSRAEWTLRADGRIDDAFVGRKGGFDQPEKRYRFVD
FT                   SVTPGSAGGEWRVRLFWPVYVTQLTLYVDPGYRYTILGYPGKTLGWIFSRTPTMEDATY
FT                   RALLARLDAMGYDTSRFRRVPQTPGQIGQPGFASPGERD"
FT                   /protein_id="YP_366278.1"
FT   misc_feature    complement(70294..70719)
FT                   /note="Lipocalin / cytosolic fatty-acid binding protein
FT                   family; Region: Lipocalin; cl01150"
FT                   /db_xref="CDD:174555"
FT                   /locus_tag="Bcep18194_C6584"
FT   gene            complement(70857..71957)
FT                   /db_xref="GeneID:3733941"
FT                   /locus_tag="Bcep18194_C6585"
FT   CDS_pept        complement(70857..71957)
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /gene_family="HOG000225436" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6585"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="GI:78059704"
FT                   /db_xref="InterPro:IPR000051"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="GeneID:3733941"
FT                   /translation="MTATASQPSPAGIAAPGDTWLIRCCERGWLPDPLIRAGMRALMRQ
FT                   RLRDEHADDGERRAMAHDTLLRELRASPIAVETQAANTQHYEVPGAFFEAHLGPRLKYS
FT                   CGYYPGGDETLAQAEDAMLGLTARRAELADGQRILDLGCGWGSLALWLAERYPRARIVG
FT                   LSNSHGQRGFIEQCAARRGLTNLRIVTGNVAEFDFASGEAGFDRVLSIEMFEHMKNYGQ
FT                   LLSKIARWMPDDGKLFVHLFAHRLLAYHFTARDGSDWMSRHFFTGGTMPSADLLLHFQD
FT                   DVRIARQWWLDGTHYARTANQWLASLDAARGRVMPMLEAVYGADARVGFQRWRMFYMAV
FT                   AELFGYAGGQEWGVAHYLFDKRPARR"
FT                   /transl_table="11"
FT                   /protein_id="YP_366279.1"
FT   misc_feature    complement(70887..71765)
FT                   /note="Cyclopropane fatty acid synthase and related
FT                   methyltransferases [Cell envelope biogenesis, outer
FT                   membrane]; Region: Cfa; COG2230"
FT                   /db_xref="CDD:32411"
FT                   /locus_tag="Bcep18194_C6585"
FT   misc_feature    complement(71232..71549)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep18194_C6585"
FT   misc_feature    complement(order(71325..71327,71379..71387,71460..71465,
FT                   71517..71537))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep18194_C6585"
FT   gene            complement(71954..72787)
FT                   /db_xref="GeneID:3733942"
FT                   /locus_tag="Bcep18194_C6586"
FT   CDS_pept        complement(71954..72787)
FT                   /locus_tag="Bcep18194_C6586"
FT                   /gene_family="HOG000245961" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059705"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="GeneID:3733942"
FT                   /translation="MPAAAVALAAFVGLILAFTAVWIVQLRSRNAGMIDPVWAATLGGV
FT                   AVLAAGFGTGAELNRALVALGGGLWGLRLARHLWHRNHGQPEDVRYRQFRLQWGDAAAR
FT                   NLFWLFQLQALISMALSVAFFVPAYSAAAPSRFALAAAVAIWFAAVAGETAADRQLKRF
FT                   LADPGQRGQVCRAGWWRYSRHPNYFFECLHWFAYTVLAIGMPWGALALLPPFLMAWLLL
FT                   RVSGLPLLEARLVDTRPGYREYMRTTSALIPWPPARAAPPSRTGPDRPEDRSTRS"
FT                   /protein_id="YP_366280.1"
FT   misc_feature    complement(72044..72724)
FT                   /note="Isoprenylcysteine carboxyl methyltransferase (ICMT)
FT                   family; Region: ICMT; cl00763"
FT                   /db_xref="CDD:174378"
FT                   /locus_tag="Bcep18194_C6586"
FT   gene            complement(72920..73654)
FT                   /db_xref="GeneID:3733943"
FT                   /locus_tag="Bcep18194_C6587"
FT   CDS_pept        complement(72920..73654)
FT                   /locus_tag="Bcep18194_C6587"
FT                   /gene_family="HOG000219592" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059706"
FT                   /db_xref="GeneID:3733943"
FT                   /translation="MNTPADHDPELRCAEYALGLLDADARRALEHAVDADPALKSTLER
FT                   WQRRLAPLAEDIAPVEPPGHVWTRIQRDVGFLLRSSARGAAPTGGWWNSVNLWRWVGIS
FT                   ASAAALGLLAINLVWVREASQRTTAVESNYMVATISRSDGVAHWTATVDLPRARMVVVP
FT                   ADKPTIAVNRSTELWLIPPNAKPISLGVFPPDAPASMTLPPAVVAQLSARAVLAVSIEP
FT                   SGGSPTGQPTGPVLATGTLHAA"
FT                   /protein_id="YP_366281.1"
FT   misc_feature    complement(72932..73471)
FT                   /note="Anti-sigma-K factor rskA; Region: RskA; cl02208"
FT                   /db_xref="CDD:174715"
FT                   /locus_tag="Bcep18194_C6587"
FT   gene            complement(73651..74262)
FT                   /db_xref="GeneID:3733905"
FT                   /locus_tag="Bcep18194_C6588"
FT   CDS_pept        complement(73651..74262)
FT                   /locus_tag="Bcep18194_C6588"
FT                   /gene_family="HOG000094755" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="sigma-24 (FecI-like)"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059707"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="GeneID:3733905"
FT                   /translation="MNDTPDSAERFGSSAPSHDGDADAARRAHLNQVMLQVARGDQAAF
FT                   AELYRLTSSRVFGIVIRMLHDQGEAEDLLQEVYATAWRRADTFDPVRGGAMTWLIALAR
FT                   NRTIDRLRQHREVPLDEEQVLDLPDEAPTPAALAEASQERQRLERCLEWLEPPQRRAVR
FT                   EAFFSGATYSELAVRLRVPLGTMKSWIRRSLMQLKECLEQ"
FT                   /protein_id="YP_366282.1"
FT   misc_feature    complement(73654..74178)
FT                   /note="RNA polymerase sigma factor; Provisional; Region:
FT                   PRK12514"
FT                   /db_xref="CDD:105710"
FT                   /locus_tag="Bcep18194_C6588"
FT   misc_feature    complement(73918..74121)
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Bcep18194_C6588"
FT   misc_feature    complement(73672..73833)
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:174508"
FT                   /locus_tag="Bcep18194_C6588"
FT   gene            complement(74567..75226)
FT                   /db_xref="GeneID:3733906"
FT                   /locus_tag="Bcep18194_C6589"
FT   CDS_pept        complement(74567..75226)
FT                   /product="carbonate dehydratase"
FT                   /gene_family="HOG000125182" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6589"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="GI:78059708"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="GeneID:3733906"
FT                   /translation="MRDVIDGFLRFQRDIYPQRVELFKQLATSQNPKALFVTCSDSRVV
FT                   PELLTQREPGELFVIRNAGNIVPSYGPEPGGVSATVEYAVAVLGVRDIVICGHSDCGAM
FT                   GAISRCTCLDNLPAVANWLRHADAAKVINAAHEYDTPRAKLDGLVRENVIAQLANLRTH
FT                   PSVALALEQGRMNLHGWVYDIETGGIDALDGATRSFVSLAESPTVVAVDSRNRGSI"
FT                   /transl_table="11"
FT                   /protein_id="YP_366283.1"
FT   misc_feature    complement(74651..75208)
FT                   /note="Carbonic anhydrases (CA) are zinc-containing enzymes
FT                   that catalyze the reversible hydration of carbon dioxide in
FT                   a two-step mechanism in which the nucleophilic attack of a
FT                   zinc-bound hydroxide ion on carbon dioxide is followed by
FT                   the regeneration of an...; Region: beta_CA_cladeB; cd00884"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="Bcep18194_C6589"
FT   misc_feature    complement(order(74681..74683,74924..74926,74933..74935,
FT                   74963..74965,74978..74980,75053..75055,75062..75064,
FT                   75098..75106,75110..75112,75131..75133,75137..75139))
FT                   /note="active site clefts"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="Bcep18194_C6589"
FT   misc_feature    complement(order(74924..74926,74933..74935,75104..75106,
FT                   75110..75112))
FT                   /note="zinc binding site; other site"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="Bcep18194_C6589"
FT   misc_feature    complement(order(74660..74662,74666..74668,74672..74677,
FT                   74681..74683,74861..74863,74978..74983,74990..74995,
FT                   75044..75046,75050..75052,75056..75064,75077..75088,
FT                   75092..75094,75098..75109))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="Bcep18194_C6589"
FT   gene            75652..78588
FT                   /db_xref="GeneID:3733907"
FT                   /locus_tag="Bcep18194_C6590"
FT   CDS_pept        75652..78588
FT                   /locus_tag="Bcep18194_C6590"
FT                   /gene_family="HOG000111179" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="transposase Tn3"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059709"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:3733907"
FT                   /translation="MDHWRLAYLGIRQVPRELSEFELATFFTFSKRERVAIDSRRTDLF
FT                   RLAVALHIGFLRMTGRPLGSYKQIPTVLWRHLGRQLNVKPPDLGTLRSLYDGNLKTLSD
FT                   HQRFARDAINFRAVAEHQRRYVIRWLKEQLTGRPERGQLTNDLKRWFYDHRIVIPPERM
FT                   LRQFVVQAVRDIEGQLHGALESAVGMEKLESWARVLAQPHGEHSSLQRWLWAVPLRNST
FT                   HQMSEILDKVNLLTMHEVATRWPVECNDAMVRHYARRCASRPPSISKRIEPQSRRIEAA
FT                   CFMRYSLCIATDQVLEMLRRWVLKVVNDTSREVDAMRMKAADQLREFALAVKALANDET
FT                   LSREQLGEKLCLLADDVLQPHPTSRRSQIRQCLVRKRYYARNLLNRIVQLPFEAEGAHP
FT                   VVDALSLLRVLYRRRAYLLPDGVNIRLGRTWREAIDGYDRLRAMVAFEWATLFALRVAL
FT                   RNGSVFINHSFSFRSQSHMLISPEQWQAKRNNHYGHLGLPQDPNEFLGPILEQLDKRLA
FT                   LLDDAVVNGSIRVDTAVHLDPLAAQDPDAQTDQLRRQIFEAHPPGQFPEIILEIDSATR
FT                   FSWILLGREPRSRTELLMVYSAILAHGTSLTAADISRMVPEVSTEAIRQMMKRLADERM
FT                   LRAAADAVLEFMHEHPIAAHWGRADLASSDMMSLETTRTIWRARADPRRRTASIGMYTH
FT                   VLDRWGIFYDQPIILNERQAGAAIEGVVRQSATKDIAQLAVDTHGYTDFAMGVSRALGF
FT                   DLCPRLSHLRDRRLHVPRSQVVPARLAGVTDRDVRLGLIVDVWDEFVRIAASIRSGQCT
FT                   AVEAIARFGSAARGQAVYDGGVHIGRLFRSIFLIDYFTNASFRSELQHALNRGEAVHTV
FT                   QRAIHIGRIPVELARRQESLAAVSSALTLLSNILMAWNTTHMQRALENIEATRGQPIAA
FT                   EQLRRIAPTHIEGINLRGTFNFPVSLYAKRILPSIAADNPIPSTSRSA"
FT                   /protein_id="YP_366284.1"
FT   misc_feature    75652..78501
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep18194_C6590"
FT   misc_feature    77506..78432
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bcep18194_C6590"
FT   gene            79322..83302
FT                   /db_xref="GeneID:3733908"
FT                   /locus_tag="Bcep18194_C6591"
FT   CDS_pept        79322..83302
FT                   /locus_tag="Bcep18194_C6591"
FT                   /gene_family="HOG000070308" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hemaglutinin/autotransporter like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059710"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="GeneID:3733908"
FT                   /translation="MNKIYRSLWNDALGAWIAVQENGKARGRLGRSSRRGAMLSSIATV
FT                   GMVTASLATAQTTVSGSANNGGSGRTASTDSTCGQNFVNRNNPGNPPSSGSTYMLQSGC
FT                   STAVGNNAKATSAGTALGDRANASVGGVALGVGASSTQNSSVAIGVVALSRGNTSIAIG
FT                   RQSAATADFSTAIGNVAYASGVSGIAMGDSALASGYRSVAIGSADTNLAGNDGISTGAN
FT                   YDPNTQTRASGARTVALGAGAVAAPDDSVALGSNSVGESNAQGPAAFSGDAIPVNGAVS
FT                   VGQAGAERQIKNVAGGTVGTDAVNVNQLTAVSNSAVKYDKNPDGSINYNSVTLNPGGSL
FT                   TTMTNLAAGDISQNSKDAVNGSQLYQTNQTVSTLGNNAASVIGGGASYDPSTGQMTGPT
FT                   FSIAGGKQTNLSDAINALNQGWNVTTGGNTSGASVTAVQPGSTVTFNGGKNIALAQNGA
FT                   DITIATSDTPTFTSVGIDNGGPTLSGSGLNMAGKKITNVATGDVSSSSKDAVNGSQLYQ
FT                   TNQTVSTLGNNAASVIGGGASYDPSTGQMTGPTFSIAGGKQTNLSDAINALNQGWNVTT
FT                   GGNTSGASVTAVQPGSTVTFNGGKNIALAQNGADITIATSDTPTFTSVGIDNGGPTLSG
FT                   SGLNMAGKKITNVAAGEVSSSSADAINGSQLYQVEQAQQQANDQAVKYDKNPDGSINYS
FT                   SVTLNPGGSPTTMTNLAAGNISQNSKDAVNGSQLYQTNQTVSTLGNNAAAVIGGGASYD
FT                   PSTGQMTGPTFSIAGGKQTNLSDAINALNQGWNVTTGGNTSGSSVTAVQPGSTVTFNGG
FT                   KNIALTQNGADITIATSDTPTFTSVGIDNGGPTLSGSGLNMAGKKITNVATGDVSSSST
FT                   DAINGSQLYQVEQAQQQANDQAVKYDKNPDGSINYNSVTLGGTPSTDGGKTGGTKLSNL
FT                   AQGDLSEKSADAVNGAQLYQTNQNVANLGQQVANISNGGGIKYFHANGGTTNSLPDSQA
FT                   VGAGSAAIGPGATAAGDTSVAIGNNASAKRDGDVALGSGSVADRGAEKYTGKYSGAQND
FT                   TAGTVSVGASGQERTISNVADGKEATDAVNLRQLDGAVQAANGYTNQQVKDVQGSVANV
FT                   TNNVQQLQSDMSSVKTGSAGMFQTGQDDATAPRASGKQSTAGGAGAVASGNSSTALGNG
FT                   AKASSNDSVALGARAQASGSNSLALGAGSVADRNNSVSVGAPGHERQITNVAPGTAPTD
FT                   AVNLGQLNVALNQTAGQLQQGINDTARKAYSGVAAATALTMIPDVDKDKVLSVGVGVGS
FT                   YQGYSAVALGATARITENIKMRAGASLGGSGTAIGMGASMQW"
FT                   /protein_id="YP_366285.1"
FT   misc_feature    83069..83299
FT                   /note="YadA-like C-terminal region; Region: YadA;
FT                   pfam03895"
FT                   /db_xref="CDD:146496"
FT                   /locus_tag="Bcep18194_C6591"
FT   gene            83872..84555
FT                   /db_xref="GeneID:3733909"
FT                   /locus_tag="Bcep18194_C6592"
FT   CDS_pept        83872..84555
FT                   /locus_tag="Bcep18194_C6592"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059711"
FT                   /db_xref="GeneID:3733909"
FT                   /translation="MRIAILGPDPVARGFAKEALVRVGHVCQTFSSGNEIIRQLRRETY
FT                   DLLILDWLVTDISGEEVMLWAHKNLPGRVPVIFLSKRGRDEDLVRILAAGADGYLVKPI
FT                   SGDVLAAYVNALARSIAGVDLKGRLSVREFEFDLRRKILLANGACVETTPKEFDIALLF
FT                   FRNLGNSVSRGHLLDIVWRQHPVSVSRTVDTHISNVRTKLNLNPENGYVFKPIYGFGYI
FT                   LDLVR"
FT                   /protein_id="YP_366286.1"
FT   misc_feature    83872..84543
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    83896..84222
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    order(84022..84024,84046..84048,84109..84111,84166..84168,
FT                   84175..84180)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    84022..84024
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    order(84031..84036,84040..84048)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    84175..84183
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    84256..84540
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bcep18194_C6592"
FT   misc_feature    order(84328..84330,84385..84390,84442..84444,84451..84453,
FT                   84475..84480,84514..84516,84529..84531)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bcep18194_C6592"
FT   gene            85335..86042
FT                   /db_xref="GeneID:3733910"
FT                   /locus_tag="Bcep18194_C6593"
FT   CDS_pept        85335..86042
FT                   /locus_tag="Bcep18194_C6593"
FT                   /gene_family="HOG000218576" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="OmpA/MotB family outer membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059712"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:3733910"
FT                   /translation="MTMLKSLVSVALAVSTLAACSSASGPTFNAYAVDLADGSRAFRVE
FT                   CHGLFEPLSACMREAQRVCGDQPVRLLDQQQRLSDPVQKIDDTDAMTFQCGAPPQPVVA
FT                   TPVPVEEKPIVLAADALFAFDEGDVDAINPEGRAELDEIAAKLIAMPAVRHIDVAGYTD
FT                   RLGSKEYNVALSQRRAEVVKWYLTSRGVTAAIDARGHGKVLPGTSCEMHIRAELIRCLS
FT                   PDRRVEIRASHAQ"
FT                   /protein_id="YP_366287.1"
FT   misc_feature    85695..86024
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Bcep18194_C6593"
FT   misc_feature    order(85704..85709,85818..85823,85830..85832,85842..85847,
FT                   85854..85856,85995..85997,86007..86009)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Bcep18194_C6593"
FT   gene            complement(86921..89185)
FT                   /db_xref="GeneID:3733911"
FT                   /locus_tag="Bcep18194_C6594"
FT   CDS_pept        complement(86921..89185)
FT                   /locus_tag="Bcep18194_C6594"
FT                   /gene_family="HOG000061108" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059713"
FT                   /db_xref="GeneID:3733911"
FT                   /translation="MYDLHRLGWNSFQQLCLTIAREVLGQTVQSFLDSNDAGRDGAFAG
FT                   SWTPSSKQHFSGNFVIQCKFSSKPGSLLTKSSIADEIPKVRKLVSDGLCDVYILMTNAG
FT                   VSAKQEAQIKSALSGAGVRDVLICGSTWIEDQIRENTRLRMLVPRVYGLGDLSQILDQR
FT                   AYAQARAVLESLRDDLAKVVITESYRKAVNALDEHGFVLLIGEPAAGKTTIASMLAMAA
FT                   ADKWKSSVLKLADPAKIVERWNVDEPSQFFWIDDAFGVTQYESPLVHGWNHSLAQVKTM
FT                   LRRGAKIVMTSRDYIYNRARHDLKESAFPLLGESQVVIDVHDLSDLEKQQILYNHLKLG
FT                   KQTTEFRVAIRPHLEYMAAHPRFIPETARRIADTLFTKDLYLGKYHLGAFVEKREQLLL
FT                   EVIQGLDASSKAALGLIYMRKDHLESPIMLQGAEQTAIERLGSTLGECIQALDALNGSL
FT                   VTHMHVDDQPVWRFKHPTIGDAYAATLAFSPDLLGIFLSGSSTENLLSQVTCGKVGVEK
FT                   AVIIPKSLFPAMMERLRDFSSSNQYKVEWMSSWGARWTLYRFLANRCSKDFLAAYLEQS
FT                   PDVLQRVAKPGLSLSAVPEVDLAVRLHEFGLLPEEARKAFVETVSTYAVEGEDLYALDD
FT                   PSVRSVFQDSEFDELVEAVRTDLLPKLQDVRINAQSSHLSSDAPDEHMQGILESFGTLK
FT                   KRFGEDEQLVNLIDKEIDLVNKWISETEPPEPKVGPRVLGAVEHSEEKHGTRSIFDDIA
FT                   D"
FT                   /protein_id="YP_366288.1"
FT   gene            complement(89210..91852)
FT                   /db_xref="GeneID:3733912"
FT                   /locus_tag="Bcep18194_C6595"
FT   CDS_pept        complement(89210..91852)
FT                   /locus_tag="Bcep18194_C6595"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059714"
FT                   /db_xref="GeneID:3733912"
FT                   /translation="MAQPTFNIFDALSVWGKTLPTWQHFLLSKLVEDVELPDAVLDDVF
FT                   SEYLIDQNLAGPDAARVAWDPEPPQFQPDAPTVVSTLTTMTGVSGVNALAAGETLSFGP
FT                   KLTVIYGPNGAGKSGYARVLKSACFTRSKDIGILGDVKLVKSKQPKPTAKFSFDDGSAV
FT                   NFVHQEPCQRMRDGFAVFDSTCVSVHLDGRNAFQVMPYLFDVFPRMVAAFTELQTKLRD
FT                   QIMRRTPAADKFVIQNSTSEVATALSALTAKTDLARLQELAVYGDAEAARLSAIEQKLV
FT                   ELRTTDPQEIIKRNEQRIADLKAVHASIGALAQSIQPSLVQGIAEAAARITALVEQRAA
FT                   LSAARFGGEPVQPVGTRAWLDLLAAAITYGEEAYPGAPFPPQTDGARCVLCQQTLDAAS
FT                   ADRLTKFYQTATSDVEAQLAATRRTLKSHSIALGEVGLSFFDEESAARRTVEELDAALT
FT                   AAIVGHVEGFRTVVGVLSNAVATEIGPALSLLAYDAISDRVSALADRLDQDNVKLRQSD
FT                   PQVLIDALLLELQLLKDRQWLAGQYVAVGDAVEDLKWVAKANACLRSLPTIQRDVTSKQ
FT                   KALAKELVAQGFIARFTENCTALQLTLPVQFKFAGEAGTTERKIEIANAGMTGVDPSQV
FT                   LSEGEQTAAALADFLTEVELNGACAGVIFDDPVTSMDHVRKEAIAQRLVTEADRRQVIV
FT                   FTHDILFTNYLATAAEEKGVAFAGRTVWRDDTNSPGVIDRLAFPHEHYEGAAHDRAKGH
FT                   YESSRTLVGDPQRDALEKACGSLRTAYEDFIQKKLFHNVVRRWRENIPYTVNQVYFDEA
FT                   IAARVHDRMVVLSRYIDAHSHSEDFYEMPLTIDSVKSELAYFDAIKSDYKKARTEWEKT
FT                   RPKAGSIFS"
FT                   /protein_id="YP_366289.1"
FT   misc_feature    complement(<91325..91591)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89654..91552)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG4694"
FT                   /db_xref="CDD:34310"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(91499..91522)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(order(91349..91351,91496..91504,91508..91513))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(91349..91360)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89738..>89965)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89918..89947)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89855..89872)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89837..89848)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   misc_feature    complement(89756..89776)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep18194_C6595"
FT   gene            complement(92031..92321)
FT                   /db_xref="GeneID:3733913"
FT                   /locus_tag="Bcep18194_C6596"
FT   CDS_pept        complement(92031..92321)
FT                   /locus_tag="Bcep18194_C6596"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="histone-like nucleoid-structuring protein H-NS"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059715"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:3733913"
FT                   /translation="MATYKELKAKMDALAEQTEAARVAEFQAVVEEIRAKVAEYGVTEK
FT                   DIFGKQRGRSAKAVVDAKYRDPKTGATWSGRGRAPAWIKDAKNRDRFQIQE"
FT                   /protein_id="YP_366290.1"
FT   misc_feature    complement(92046..92309)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep18194_C6596"
FT   misc_feature    complement(<92064..92162)
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:175028"
FT                   /locus_tag="Bcep18194_C6596"
FT   gene            complement(92384..92767)
FT                   /db_xref="GeneID:3733914"
FT                   /locus_tag="Bcep18194_C6597"
FT   CDS_pept        complement(92384..92767)
FT                   /locus_tag="Bcep18194_C6597"
FT                   /gene_family="HOG000109660" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="nucleotide-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059716"
FT                   /db_xref="GeneID:3733914"
FT                   /translation="MRTRFATLPKDILHEQANQGHTILEKIDAYSDVSFAVVLLTPDDE
FT                   GCVKGGHPQPRVRQNVLLELGFFIGRLGREKVCALKRGDPEIPSDYLGVIWHSMNVGDW
FT                   KSALCRELDAMGFEIDWKKAMQA"
FT                   /protein_id="YP_366291.1"
FT   misc_feature    complement(92456..>92737)
FT                   /note="Predicted nucleotide-binding protein containing
FT                   TIR-like domain; Region: TIR-like; cl01740"
FT                   /db_xref="CDD:154562"
FT                   /locus_tag="Bcep18194_C6597"
FT   gene            93189..96365
FT                   /db_xref="GeneID:3733915"
FT                   /locus_tag="Bcep18194_C6598"
FT   CDS_pept        93189..96365
FT                   /locus_tag="Bcep18194_C6598"
FT                   /gene_family="HOG000061222" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059717"
FT                   /db_xref="GeneID:3733915"
FT                   /translation="MYLRSALHRQMDVRILSCTQIDHRGQMQFRAKQIAPPKEWGTFED
FT                   LCHALFKRVWRDPFAQKNGRRGQAQHGVDVFGSPGGDRSSYWGVQCKGKDCNYGSKAEW
FT                   SEVLLEVAKAEKFSPRLEKWIFATTAPTDALLQKAARELSVARRAEGLFSVDVLGWEEI
FT                   QALMADVPGVITEFYPEHADHLPQVIEALRAVPLLEAKVVDLVERIEATLLKPPNLHGS
FT                   AVWEAVTFDGDRGLGPALMGYALGPSDAVACPCLIEVGTVQAQLRVAYSARLIGEPGAG
FT                   KSICSYQAARELASGGFEVLRLLDPQADSIALEAVLPDKPRLYLIDDAHLLKPHILSRI
FT                   ENQACPSRLVLSTHNVVGRLGHRGAITLDAKRAVKTIAAALRADLPKTLEAVRLADDDV
FT                   GERMLDADLGERLEHAEAVADRPWQFCFVLGGGWRRSKQAADSARLAAADLVLAAVAMR
FT                   QMVSRDARAMPAEIMEVCERVGINSSVVEQGLEWLERERLIVGATDCRTPHQRFASVVL
FT                   KRILEGQDTSGRDKIARMIESVLCDSHYPFAGLRVLIHELSFGDRYSWTHLLGQPAVEA
FT                   AVARCWIAAGSDRNFAALALSDLWDFMGGGAAAVVGPHVSTLAKWISSPSDSAYGLGHL
FT                   LNALTRINQEVAEKVIAKVDSVAIAAAYSNANPETAYGLADLLCAVANVKVDDVNAKIR
FT                   AAIDRNRLRELAKHEGFLEDAFVFSKFCASVVWWEEDLALEMAELFVPTAQQVLSKDPV
FT                   EGFEQLSQDFASTVLRVFDVLGVYVGKWRPTRRQWAIARRICEKIDPKQAAEHISTVRP
FT                   RNFQSAGFFLHFLFQSAPRKYETVLQQIDWDKLDLAIGDDWRDMPHDTEVLLSTLYSGT
FT                   LAQQLVQNFISTRSNRIVHFPPRLLLMAPEVGFTHLANGGLLRLAQLDHVNWTDGGIAL
FT                   VLIAETHPELTERAVTPFIDVIAHGLMKYNRDFTGPAEGFVRVVIEHAPATWRAVLGKL
FT                   DPVTIEKNFAECLKGNADHRRTVAAVIESAIVLDDPVGHAARRIRARFPKASTAPTDTP
FT                   HFGRSRRRSG"
FT                   /protein_id="YP_366292.1"
FT   gene            97139..98206
FT                   /db_xref="GeneID:3733916"
FT                   /locus_tag="Bcep18194_C6599"
FT   CDS_pept        97139..98206
FT                   /locus_tag="Bcep18194_C6599"
FT                   /gene_family="HOG000277927" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059718"
FT                   /db_xref="GeneID:3733916"
FT                   /translation="MHDLLLGFEKFKNISLGDPFFDSLKSDYDEFGEWFLKKSEHQAYT
FT                   FRNKAGLLDGFLYLKQEDGPVLDSTPPLPGARRLKIGTFKINPHGTRLGERFIKRAFDV
FT                   AVHARVDAIYVTIFAKHKALVDLFFRYGFLQKAIKQTANGQELVLERRLDLVFKDVVLD
FT                   YPRIPIGTGRHFVLSLYPQWHSRLLPDSLLRTESSSILQDISHTNSIHKIYLAAMSGVE
FT                   QLRRGDTLLIYRTAEGGSAYYTSVVTSLCVVEELTNVKNFATVEQFLAYCAPYSIFSEL
FT                   ELRNFYKSRRYPWVIRFTYNLALSRRPNRKALVEQVGMNPGMYWGFFQISTLQLKHILQ
FT                   LSSDYEKASSLVYSS"
FT                   /protein_id="YP_366293.1"
FT   gene            98172..98546
FT                   /db_xref="GeneID:3733917"
FT                   /locus_tag="Bcep18194_C6600"
FT   CDS_pept        98172..98546
FT                   /locus_tag="Bcep18194_C6600"
FT                   /gene_family="HOG000232240" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059719"
FT                   /db_xref="GeneID:3733917"
FT                   /translation="MKKRVLLSIHPEYANAIFAGEKGFEFRRVIFKEDVSEVVVYATSP
FT                   ISRVIGCFKIEEIYQDTPGELWVKTEARAGVTREMFDSYFKDRVKAFAIKVSEPTRFSR
FT                   PQPLSKYLPSNTPPQSFCYI"
FT                   /protein_id="YP_366294.1"
FT   misc_feature    98190..98543
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4933"
FT                   /db_xref="CDD:34541"
FT                   /locus_tag="Bcep18194_C6600"
FT   gene            98552..99730
FT                   /db_xref="GeneID:3733918"
FT                   /locus_tag="Bcep18194_C6601"
FT   CDS_pept        98552..99730
FT                   /locus_tag="Bcep18194_C6601"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059720"
FT                   /db_xref="GeneID:3733918"
FT                   /translation="MATSYATSTFGLLCFARGGQPPSTPAAAHPPSTATLPELHLNIWE
FT                   RDPDRHSKNPDSFLDVGLMLDLGEHADSIELVLPQKMPVTSIVDLSPTIAQAQAIPAIF
FT                   NESWAIAHVGSQGSDSVVYDPANGDRSFAVVSITGAITETRHAGHDALSISVSELILRA
FT                   NAVAQLTGRDIERVYVRFRLLEFKKQYYCVGAGERANAWWQPSWQRTEDIDFRLNVRRG
FT                   APPRLESQIGRFLEFSKVHLFLMRSRDKDIVFQDKLFKASRSLEDEEFWAQYSIYGTQL
FT                   SRDDSLKRVQNSLGYHWKAAGSEPVKEFGTLARFKIVEFGVGKFVAVAMIVGAMGSMLW
FT                   DGTKGLYGLVTSHGSERATMTSSVEVGTAGRAANQRPAASGVKLPTERKEGG"
FT                   /protein_id="YP_366295.1"
FT   gene            99727..100290
FT                   /db_xref="GeneID:3733919"
FT                   /locus_tag="Bcep18194_C6602"
FT   CDS_pept        99727..100290
FT                   /locus_tag="Bcep18194_C6602"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059721"
FT                   /db_xref="GeneID:3733919"
FT                   /translation="MSYLITKASLEQSPWLLDEALRLASEDVEFLRFSYPQFDHWFATK
FT                   VIPGIHDGERTLLLERRGSVTVGFLIVKHTAVEKKLCTLRVRPDFVSKGLGVRLFQTAF
FT                   HLLETEQPLLSVSAPAAPKFERLFRYFGFAQEAVYQGRYLPDVDEYSYNGLLDPAYMFH
FT                   DQRANSEDRALPSIHDRQHLACRL"
FT                   /protein_id="YP_366296.1"
FT   misc_feature    <99895..100173
FT                   /note="ribosomal-protein-alanine acetyltransferase; Region:
FT                   rimI; TIGR01575"
FT                   /db_xref="CDD:162430"
FT                   /locus_tag="Bcep18194_C6602"
FT   gene            complement(100665..101069)
FT                   /db_xref="GeneID:3733920"
FT                   /locus_tag="Bcep18194_C6603"
FT   CDS_pept        complement(100665..101069)
FT                   /locus_tag="Bcep18194_C6603"
FT                   /gene_family="HOG000236813" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059722"
FT                   /db_xref="GeneID:3733920"
FT                   /translation="MNHDLAPNSTPPLDFDQFMASLRDSESVAPIVSARRFAAALHIDM
FT                   QTLARLAHVHRNTVSRLAGSESVQKYLREAIRIIRAANDTSGDIQSTLFWYRNEPLPTF
FT                   DYKTAEELVSEGRVDDVLRYVVSLEAGAAG"
FT                   /protein_id="YP_366297.1"
FT   gene            101352..102299
FT                   /db_xref="GeneID:3733921"
FT                   /locus_tag="Bcep18194_C6604"
FT   CDS_pept        101352..102299
FT                   /locus_tag="Bcep18194_C6604"
FT                   /gene_family="HOG000233526" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059723"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733921"
FT                   /translation="MKLHQLRALVAVARSGSIHEAARTLHLTQPAVTRSLRDLEDELGL
FT                   MLVARSSSGVTLTDAGRAMLRRAELVVNEVARTEEEMAQLRENRQGRLAIGMTPLAGIT
FT                   VLPAAYNRFRRAMPDVQLEFVEGSPSQLVEQLKNGALDFALGAGADAQDFTSVRCEHLD
FT                   SFPMWFAVSRKGKLAGATSLADLQDAEWLHTGPSTEFRAFLAELFAQAGLPAPRRVTRC
FT                   ASQTLFYALAVNSDVVTAWTQLALRGEDASDTLKTLDLVGQPPARNLYLLFRDSAVLTA
FT                   SAEYFVRCIDEAVQAERANAGGTKRGTRSRAPRA"
FT                   /protein_id="YP_366298.1"
FT   misc_feature    101352..102215
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK09791"
FT                   /db_xref="CDD:170097"
FT                   /locus_tag="Bcep18194_C6604"
FT   misc_feature    101358..101537
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6604"
FT   misc_feature    101625..102221
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep18194_C6604"
FT   misc_feature    order(101670..101675,101679..101684,101691..101693,
FT                   101703..101705,101709..101729,102006..102023,
FT                   102039..102044,102048..102053)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep18194_C6604"
FT   gene            complement(102309..103373)
FT                   /db_xref="GeneID:3733922"
FT                   /locus_tag="Bcep18194_C6605"
FT   CDS_pept        complement(102309..103373)
FT                   /locus_tag="Bcep18194_C6605"
FT                   /gene_family="HOG000203205" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059724"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="GeneID:3733922"
FT                   /translation="MPAPPAGTPTRNHSRAPCTDHSAIRSRIMEIDARTPPLQRITPDH
FT                   DTQSPARAPTARLAALIAAYAPHDGMFDLPVRGMRIARASASPPHWNHGVLHACLSIVG
FT                   QGAKSTQVGDDTYVIDESRMLVATADLPVTGRVTRASPAEPFLYAQLELDPARIVALTP
FT                   RVFPLGLPKAVDCSALDTHDAQPEIVDAVVRLMQLIAQPDDIDLLAPLIVDEILIRLLR
FT                   GPSGARVAQIGLADSTTQRISRAVAWIRDHYLDPMTVESLARQVDMSPSTFHHHFRAVT
FT                   SMSPLQCQKVLRLQEARRLMCVSAMDARQACRSVGYVSASQFSREYARLFGDAPGRDVL
FT                   KLRDEAVPLSRVAP"
FT                   /protein_id="YP_366299.1"
FT   misc_feature    complement(102687..103151)
FT                   /note="AraC-type transcriptional regulator N-terminus;
FT                   Region: AraC_N; pfam06719"
FT                   /db_xref="CDD:148365"
FT                   /locus_tag="Bcep18194_C6605"
FT   misc_feature    complement(102333..102683)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bcep18194_C6605"
FT   misc_feature    complement(102513..102629)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcep18194_C6605"
FT   gene            103886..104770
FT                   /db_xref="GeneID:3733923"
FT                   /locus_tag="Bcep18194_C6606"
FT   CDS_pept        103886..104770
FT                   /locus_tag="Bcep18194_C6606"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059725"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733923"
FT                   /translation="MDQLQSIRAFVTVAREGGFRRAATRLRVSTAMASRLVDALETRLG
FT                   ARLLQRSTCHQSLTEIGELYLARVERILGAIDEIDGRVVAMGSKPEGELRIAAPVAFGL
FT                   SQLSALLDRFVNRFPDVRPTVTLTDAHVDLTSEDIDVAFLTDGMPVTGAHALHTLAAYE
FT                   SVRVAAPSYVDAHGGAAASGDWPDITAVRLDLPATGEDDAAAFRPDTTPGGSPGVGHLD
FT                   MARRLAVAGMGAAVLPAYLVDADLVAGTLVRVAQIRPLAPVTLKLAHARTAHLPAAARV
FT                   FIEFAGAAFRPAS"
FT                   /protein_id="YP_366300.1"
FT   misc_feature    103895..104074
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6606"
FT   misc_feature    104159..104647
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep18194_C6606"
FT   misc_feature    order(104207..104212,104216..104221,104228..104230,
FT                   104240..104242,104246..104266,104528..104545,
FT                   104561..104566,104570..104575)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep18194_C6606"
FT   gene            105003..106259
FT                   /db_xref="GeneID:3733924"
FT                   /locus_tag="Bcep18194_C6607"
FT   CDS_pept        105003..106259
FT                   /locus_tag="Bcep18194_C6607"
FT                   /gene_family="HOG000158247" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="HlyD family secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059726"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:3733924"
FT                   /translation="MRVERVPYRLITAATAAVFLAACGKKESAPPPQTPEVGVVTVQPQ
FT                   AVPAVTELPGRTSAFLVAQVRARVDGIVLRREFTEGTDVKAGQRLYKIDPAPYVAALNS
FT                   AKATLARAQANLVTQNALVARYKVLVAANAVSKQDYDNAVATQGQAAADVAAGKAAVDT
FT                   AQINLGYTDVVSPVSGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLDGLK
FT                   LRQDVQSGKLKTSGPGAAKVSLILEDGKTYSEPGKLQFSDVTVDQTTGSVTIRAIFPNP
FT                   GRVLLPGMFVRARIEEGVNENAFLVPQIGVTHDQKGQAIALVVNAANKVETRPLTTAGT
FT                   YGQDWVVEGGLEAGDHVIVQGVDKVRPGATVKTVAAQLAPAPDAASGTPASAANASGVA
FT                   PASNAANAAARSTAASTAQ"
FT                   /protein_id="YP_366301.1"
FT   misc_feature    105102..106124
FT                   /note="multidrug efflux system protein MdtE; Provisional;
FT                   Region: PRK09859"
FT                   /db_xref="CDD:137559"
FT                   /locus_tag="Bcep18194_C6607"
FT   gene            106275..109466
FT                   /db_xref="GeneID:3733886"
FT                   /locus_tag="Bcep18194_C6608"
FT   CDS_pept        106275..109466
FT                   /locus_tag="Bcep18194_C6608"
FT                   /gene_family="HOG000158129" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hydrophobe/amphiphile efflux-1 pump, HAE1"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059727"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="GeneID:3733886"
FT                   /translation="MAKFFIDRPIFAWVIAIVLMLAGVASIFKMPIAQYPTIAPPTIQI
FT                   QANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGNATITLTFSPGTNPDVAQ
FT                   VQVQNKLSLATPNLPQVVQQLGMQVTKSSSNWLMWFAFNSDDGSMSKEDLTNYVASHVL
FT                   DPLSRVNGVGQTLLLGSQFSMRIWLDPVKLTNYSLTPTDVSAAITQQNVQIAGGQIGGT
FT                   PAKPGTMLQATITESTLLRTPEQFGNILLKVNQDGSQVRLKDVGRAALGSENYTFDTKY
FT                   MGQPTAGLGIQLATGANALATATALRAKIDELSKYFPHGLVVHYPYDTTPFVRLSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMGVAGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPKEATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVSAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNR
FT                   TFDRSRDRYTGGVNHVIRRSGRWLVIYLAVFIAVGVMFVRLPKSFLPDEDQGYMFMIVQ
FT                   TPSGSTQETTGKTLDNINTYLTTTEKDVVDSVFTVNGFSFAGRGQNAGLVFVKLKPYEH
FT                   RQRSDQKVQALIGRTFAHYSQYKDAMVIPFNPPSIPELGTAAGFDFELTDNAGLGHEAL
FT                   MAARGQLLGMAAKDPALALVRPNGLNDTPQYKVDIDREKANALGVTAAAIDQTFSIAWA
FT                   SQYVNNFLDMDGRIKKVYVQSDAPFRMTPEDMNIWYVRNSAGGMVPFSAFSTGHWSYGS
FT                   PKLERYNGVSSIEIQGQAAEGKSTGQAMAAMEALASKLPEGIGYSWTGLSFQEIQSGSQ
FT                   APILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVVGALLATMLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQTRENMGPVRAAIEAARLRLRPILMTSLAFMLGVLPLA
FT                   ISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVRVRAIFSGETENVDDAWRLVQG
FT                   DLQRGHDDAHDSKGQ"
FT                   /protein_id="YP_366302.1"
FT   misc_feature    106275..109400
FT                   /note="The (Largely Gram-negative Bacterial)
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
FT                   2A0602; TIGR00915"
FT                   /db_xref="CDD:162104"
FT                   /locus_tag="Bcep18194_C6608"
FT   misc_feature    <107280..>107564
FT                   /note="Protein export membrane protein; Region: SecD_SecF;
FT                   cl14618"
FT                   /db_xref="CDD:176628"
FT                   /locus_tag="Bcep18194_C6608"
FT   gene            109469..111001
FT                   /db_xref="GeneID:3733887"
FT                   /locus_tag="Bcep18194_C6609"
FT   CDS_pept        109469..111001
FT                   /locus_tag="Bcep18194_C6609"
FT                   /gene_family="HOG000111955" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059728"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:3733887"
FT                   /translation="MQKHALTATAAALAAALFATGCTMAPHYKRPDAPVAQTYPAGGVY
FT                   ATQPGATGARSANGQAATAIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQY
FT                   QITRAGLFPTLDGIGTGSRQRLPNALTSVSGRNITTTYNVGLSASWELDLFGRVQSLKD
FT                   QALAQYLSTSYARQAQEISLVSQVADQYLTLLSSDDLLKVTEDTLKSAQASYNLTKLKF
FT                   DNGTGSELDLRQAQTVVETALASQQSQARDRAQALNYLVLLIGEPLPDDLPAGMPLDAQ
FT                   NLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIGAARAAFFPKISLTAAFGTASPTL
FT                   GGLFKAGTAAWSFAPNIALPIFEGGSNLANLDLAHVQKRIEIASYEKAIQSAFREVSDG
FT                   LAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDSYLSVLTAQTDLYNAQQSLISA
FT                   RLARWTNLVTLYRALGGGWVERAGETPRAPDAPVDYDRAAAPAPASAVATNG"
FT                   /protein_id="YP_366303.1"
FT   misc_feature    109529..110896
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="Bcep18194_C6609"
FT   misc_feature    109694..110176
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcep18194_C6609"
FT   misc_feature    110354..110890
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Bcep18194_C6609"
FT   gene            complement(111143..111856)
FT                   /db_xref="GeneID:3733888"
FT                   /locus_tag="Bcep18194_C6610"
FT   CDS_pept        complement(111143..111856)
FT                   /product="carboxymethylenebutenolidase"
FT                   /gene_family="HOG000157121" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6610"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="GI:78059729"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="GeneID:3733888"
FT                   /translation="MSQTSGSMITFRRPDGQELQGYLATPAKTEGAPAVVVIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVTHLK
FT                   TLASRVAVTGYCMGGALTLLSLQFADADAGVTWYGFPPLDYLDPAKLKVPLMGHWATQD
FT                   AFFAIDQVDALEKKLTDAKVNVEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSQTAWD
FT                   RTLTFFGRTLWEKQG"
FT                   /transl_table="11"
FT                   /protein_id="YP_366304.1"
FT   misc_feature    complement(111167..111796)
FT                   /note="Dienelactone hydrolase family; Region: DLH;
FT                   pfam01738"
FT                   /db_xref="CDD:145081"
FT                   /locus_tag="Bcep18194_C6610"
FT   gene            complement(112180..112491)
FT                   /db_xref="GeneID:3733889"
FT                   /locus_tag="Bcep18194_C6611"
FT   CDS_pept        complement(112180..112491)
FT                   /locus_tag="Bcep18194_C6611"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059730"
FT                   /db_xref="GeneID:3733889"
FT                   /translation="MKSFIYAVVAATALSASYGAFAQSNPSGQLTRAQVRAELVQLEQA
FT                   GYKPEVSDQYYPRALQTAQARVTNADETGYGAQAAAGVRAGRAIAVKQDGRDSVYFGQ"
FT                   /protein_id="YP_366305.1"
FT   gene            complement(112808..113833)
FT                   /db_xref="GeneID:3733890"
FT                   /locus_tag="Bcep18194_C6612"
FT   CDS_pept        complement(112808..113833)
FT                   /locus_tag="Bcep18194_C6612"
FT                   /gene_family="HOG000063189" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059731"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="GeneID:3733890"
FT                   /translation="MRRWRLYTATRHVRHAMQSIMPKVVGIFAVPGVQLLDVSAPLDVF
FT                   AQANAECGKPFYTLRIIASESGPIRSSSGAQLLPDWIVPDIPERIDTLLVAGAPSAGRI
FT                   ALRTDVLAWLRAAAVQSKRYGSICTGAFILAATGLLKGRHLTTHWAAADALAEAYPSLA
FT                   VDADALYVRDGKLRTGAGVTAGLDLALALVEEDLGREIARRVAAQLVMFFKRPGGQLQF
FT                   SRKGEARPAGRSVLQEVQRWIAANPELEHSVAEMAKHAGMSPRHFARLFRAEVGMTPAA
FT                   WVEATRISAARHLLENGHDTPKQVAAKCGFANVDTLRRSFTRHVGITPAEYRKRQAVVV
FT                   E"
FT                   /protein_id="YP_366306.1"
FT   misc_feature    complement(112820..113791)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="Bcep18194_C6612"
FT   misc_feature    complement(113198..113761)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_1; cd03137"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="Bcep18194_C6612"
FT   misc_feature    complement(113450..113452)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="Bcep18194_C6612"
FT   misc_feature    complement(112988..113107)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcep18194_C6612"
FT   misc_feature    complement(112832..>112927)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcep18194_C6612"
FT   gene            113988..114629
FT                   /db_xref="GeneID:3733891"
FT                   /locus_tag="Bcep18194_C6613"
FT   CDS_pept        113988..114629
FT                   /locus_tag="Bcep18194_C6613"
FT                   /gene_family="HOG000267517" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059732"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:3733891"
FT                   /translation="MTENVAGITIPDSQLTREITELVRDTASPLLFHHSSRVFYFAALA
FT                   GQRRGLKYDPELLYCGCMFHDMGLTHKHSSACERFEVDGANAARDFLKGKGISQQDIDV
FT                   VWTSIALHTTPGIPQHMHPVIALVTAGVEMDVLGLTYPEYSDVEREAVVRAHPRTPHFK
FT                   EDIIQAFYDGIKHKPDTTFGNVKADVLADKDPHFHAGNFCSVIRSSAWAG"
FT                   /protein_id="YP_366307.1"
FT   misc_feature    114000..114461
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Bcep18194_C6613"
FT   gene            complement(114823..115209)
FT                   /db_xref="GeneID:3733892"
FT                   /locus_tag="Bcep18194_C6614"
FT   CDS_pept        complement(114823..115209)
FT                   /locus_tag="Bcep18194_C6614"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059733"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:3733892"
FT                   /translation="MDTILMQKWLTIGALSQHTGASVRSIRHYDEHGLLASVRASNGYR
FT                   MFPDKAVTQVRQIQRMIATGFTIDDIRGFPDCMLLIEGARSCDQVTEVQQQRLAAIERQ
FT                   LADLERRRARLIQTLSEGRIPPVD"
FT                   /protein_id="YP_366308.1"
FT   misc_feature    complement(114847..115182)
FT                   /note="Predicted transcriptional regulators
FT                   [Transcription]; Region: SoxR; COG0789"
FT                   /db_xref="CDD:31132"
FT                   /locus_tag="Bcep18194_C6614"
FT   misc_feature    complement(114865..115182)
FT                   /note="Helix-Turn-Helix DNA binding domain of putative
FT                   transcription regulators from the MerR superfamily; Region:
FT                   HTH_MerR-like_sg3; cd01282"
FT                   /db_xref="CDD:133388"
FT                   /locus_tag="Bcep18194_C6614"
FT   misc_feature    complement(order(115075..115083,115129..115131,
FT                   115171..115179))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133388"
FT                   /locus_tag="Bcep18194_C6614"
FT   misc_feature    complement(order(114874..114879,114886..114888,
FT                   114898..114900,114916..114918,114928..114930,
FT                   114988..114990,115015..115020,115030..115032,
FT                   115039..115041))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:133388"
FT                   /locus_tag="Bcep18194_C6614"
FT   gene            115297..116205
FT                   /db_xref="GeneID:3733893"
FT                   /locus_tag="Bcep18194_C6615"
FT   CDS_pept        115297..116205
FT                   /product="Alpha/beta hydrolase"
FT                   /gene_family="HOG000028068" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6615"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="GI:78059734"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000379"
FT                   /db_xref="GeneID:3733893"
FT                   /translation="MRIRSLIDLLNAVVTAAILITSVPSAVAAPKSYMVTSKDGVRLAV
FT                   QEDGNPDGRPVILIHGLLGSRLDWDGQVQSAELRHYRIITYDLRGHGLSDKPSGAAPYR
FT                   DGRRWADDLDAVVKGAHARKPVVVGWSLGGVVISNYLAAYGDRDVAGAVFVDGVVELAP
FT                   GQIVDHPEVYRDMNSPDLKTHLDGERRFLEFCFNHRPGAETFSRLLANAAMASWDMQRA
FT                   IPTMTVSAAEGLGAARVPLRFVYGGHDALVDTRKTLARAITLNSRIATKVYADSGHAPF
FT                   IEEPDRFNYDLAAFVRSASGR"
FT                   /transl_table="11"
FT                   /protein_id="YP_366309.1"
FT   misc_feature    115399..>115674
FT                   /note="short chain dehydrogenase; Validated; Region:
FT                   PRK05855"
FT                   /db_xref="CDD:168274"
FT                   /locus_tag="Bcep18194_C6615"
FT   misc_feature    115537..116178
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcep18194_C6615"
FT   gene            116603..117073
FT                   /db_xref="GeneID:3733894"
FT                   /locus_tag="Bcep18194_C6616"
FT   CDS_pept        116603..117073
FT                   /locus_tag="Bcep18194_C6616"
FT                   /gene_family="HOG000267528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059735"
FT                   /db_xref="GeneID:3733894"
FT                   /translation="MPGEVMSTIAFHPSGVAHPRQAEFTILEQLLAIRVRSGADLAELA
FT                   SARVDVSVIDRLSERGLKSDELAFIIPRRTLSHRRQAHERLSQEESDKAIRLARIVAQA
FT                   TATFGDQDKAMAWLRNGLQRFGGRTSLDMASTEHGARLVEEVLTQIDEGYFA"
FT                   /protein_id="YP_366310.1"
FT   misc_feature    116687..117070
FT                   /note="putative toxin-antitoxin system antitoxin component,
FT                   TIGR02293 family; Region: TAS_TIGR02293"
FT                   /db_xref="CDD:131346"
FT                   /locus_tag="Bcep18194_C6616"
FT   misc_feature    116903..117061
FT                   /note="Protein of unknown function (DUF2384); Region:
FT                   DUF2384; pfam09722"
FT                   /db_xref="CDD:150402"
FT                   /locus_tag="Bcep18194_C6616"
FT   gene            117070..117549
FT                   /db_xref="GeneID:3733895"
FT                   /locus_tag="Bcep18194_C6617"
FT   CDS_pept        117070..117549
FT                   /locus_tag="Bcep18194_C6617"
FT                   /gene_family="HOG000267539" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059736"
FT                   /db_xref="GeneID:3733895"
FT                   /translation="MTTLWRISNFADLKGIGGLRAGGRWHFAGQPVVYLAEHPALALLE
FT                   TLVHFEIATVAQLPSGYQLLRVEVADSVDIAEIAEGDAPDDWRTNIDWTRSAGTEWLHT
FT                   QPSALLRVPSVVVPHAHNFLLNPLHPAASEARVAEVMQSPYDTRILRLIQSKQGE"
FT                   /protein_id="YP_366311.1"
FT   misc_feature    117076..117507
FT                   /note="RES domain; Region: RES; cl02411"
FT                   /db_xref="CDD:154895"
FT                   /locus_tag="Bcep18194_C6617"
FT   gene            complement(117591..118529)
FT                   /db_xref="GeneID:3733896"
FT                   /locus_tag="Bcep18194_C6618"
FT   CDS_pept        complement(117591..118529)
FT                   /locus_tag="Bcep18194_C6618"
FT                   /gene_family="HOG000267540" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="Phage integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059737"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="GeneID:3733896"
FT                   /translation="MDTNRWIHDPVGAFRAWQETAATGADRRPFAPRSVVQHVAMFERF
FT                   LRYLIAQRVSLATFGPDHVAAFLAELERTCAPGTSTRVRYAKLIDRLSRHLVEAGVRTL
FT                   HPAGRTTRDLAWPDGEPEPCYLPPDADTALQRHVQPRAGDTPADCRNRAIVALLLASGI
FT                   TSAEIRATTCGAPDLDARPPALSVPRDRARPARRIALAEFALAPLAAWRVRSPDAPASA
FT                   LLFPAPRGGGAMNDMFLLLVVRDALTAIGFHAADLSPRVLRNTYARRQLLAGHAHADVS
FT                   AMLGLVSTRTVTRIRQTLPPDAAADRAAHER"
FT                   /protein_id="YP_366312.1"
FT   misc_feature    complement(117648..118109)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep18194_C6618"
FT   misc_feature    complement(order(117672..117674,117741..117743,
FT                   117750..117752,117957..117959,118038..118040))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep18194_C6618"
FT   misc_feature    complement(order(117672..117674,117741..117743,
FT                   117750..117752,118038..118040))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep18194_C6618"
FT   misc_feature    complement(order(117741..117743,118038..118040))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep18194_C6618"
FT   misc_feature    complement(order(117750..117755,117957..117959,
FT                   118035..118040))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep18194_C6618"
FT   gene            complement(118611..119084)
FT                   /db_xref="GeneID:3733897"
FT                   /locus_tag="Bcep18194_C6619"
FT   CDS_pept        complement(118611..119084)
FT                   /locus_tag="Bcep18194_C6619"
FT                   /gene_family="HOG000267558" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="small integral membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059738"
FT                   /db_xref="GeneID:3733897"
FT                   /translation="MAFFASLVAFGNITDYATNFAFVHHVFLMDTTFPGNGIMYRAIGT
FT                   TWVHHVGYIGIISMEALTAVLCWIGGARLLRARRTGDAAFRAAKAYAIAGLTLGFLTWQ
FT                   VAFMSVGGEWFGMWMSKQWNGVPDAFRFFITLLLVLVYLTMNNDGIDDTRTAH"
FT                   /protein_id="YP_366313.1"
FT   misc_feature    complement(118644..119084)
FT                   /note="Predicted small integral membrane protein (DUF2165);
FT                   Region: DUF2165; cl02290"
FT                   /db_xref="CDD:154840"
FT                   /locus_tag="Bcep18194_C6619"
FT   gene            complement(119409..120764)
FT                   /db_xref="GeneID:3733898"
FT                   /locus_tag="Bcep18194_C6620"
FT   CDS_pept        complement(119409..120764)
FT                   /locus_tag="Bcep18194_C6620"
FT                   /gene_family="HOG000038199" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="xanthine/uracil/vitamin C transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059739"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="GeneID:3733898"
FT                   /translation="MSHDPTSTPVDARLPAWQLVLFGLQHVLSMAASPITAVFLIAKVL
FT                   ALPAELTVQLIGATFFACGIGTLLQSLGAGPIGARMPFVMVPGGAPTMLFAGIAAQSGL
FT                   PTAAGAALLASAFYWVLLPVFTRCLRLFPRIVVGAMLLLVSVNLIRIYATIVVGQPGSA
FT                   DFAQPRALGLALATIVATVVVAGTFRGTLGRLAVLIGLMAGATLGWALDAMPALADVWR
FT                   GPLFTHPVWLPFGMPRFDVLAALPLLIFTAISMAEATAQTVAVGETCGKPISLSRDVPK
FT                   TIRGDALASFAGALFGTPLIVTSAENIGVVQTTGVRSRYVTAAAGAILIVIALFAPLAR
FT                   LAYAIPAAVVGGTALVVFAMIGVMGIRLLASVDLHARANQYTLAAALVVGLAPILVPNL
FT                   YRHFGTPVQIVLGNGMAAGTLAAIATQLAFAALARTRGQAGTVAATAPSRDA"
FT                   /protein_id="YP_366314.1"
FT   misc_feature    complement(119511..120698)
FT                   /note="Permease family; Region: Xan_ur_permease; cl00967"
FT                   /db_xref="CDD:176823"
FT                   /locus_tag="Bcep18194_C6620"
FT   gene            complement(120823..121947)
FT                   /db_xref="GeneID:3733899"
FT                   /locus_tag="Bcep18194_C6621"
FT   CDS_pept        complement(120823..121947)
FT                   /locus_tag="Bcep18194_C6621"
FT                   /gene_family="HOG000267569" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059740"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:3733899"
FT                   /translation="METAVTTVDQITQRRRGVGLIAHDPALSAGGYTLIAPQTADGNVY
FT                   LVGIDGEVAHQWKMPVRPGRHAVILANGNLGYNGNHPQSESRYAPWSMWHGGDFYEVTP
FT                   QGETVWRYEDPAHHHDAQWLPNGNLLYAACEPVDAAFARRVPGGTPHGDDEVMYSDVIR
FT                   EVNRAGQIVWEWHARDHLRPEDFPIAAGFGRYHWPLVNGLAVDANGRVLMSLRTTSGII
FT                   GVDRATGRVDLRIGPDVVSHQHAPVPLANGNILAFDNGNFRHGTHVVFSRVVEIDPATQ
FT                   RVVWSYADDVVNLFYTPFMGNAQRLPNGNTHVTESSTGRLFEVTPAGEVVWEYVIPWFA
FT                   EYPDEAARKTGPGQLNSVFQTFRYSAAQLPWLRD"
FT                   /protein_id="YP_366315.1"
FT   misc_feature    complement(121015..>121887)
FT                   /note="Arylsulfotransferase (ASST); Region: Arylsulfotrans;
FT                   pfam05935"
FT                   /db_xref="CDD:147858"
FT                   /locus_tag="Bcep18194_C6621"
FT   gene            122050..123006
FT                   /db_xref="GeneID:3733900"
FT                   /locus_tag="Bcep18194_C6622"
FT   CDS_pept        122050..123006
FT                   /locus_tag="Bcep18194_C6622"
FT                   /gene_family="HOG000203650" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059741"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733900"
FT                   /translation="MRSISQTFRCFDEVARRGSIRKAADALHLTAAAVHQQIRNLEEQV
FT                   GVPLFDRLPRGMQLTLAGEIVIAAVRRGQRDFDNALTQVEDLRALRRGHVNLAVPASTA
FT                   EKLVPDAILAAMQRYPGVTYSVRSGNGESIVRWVETGEADIGYALRRRTSAGVVEVRAF
FT                   AQPLGVVTAPGHPLAASGGKVRMRDCFAHPLILMTPDTELRAMFDQIDARQPRNVRPLV
FT                   ETGSVPMVRRLVAEGAGVGFLIAENVAEDVAAGRLAWTPLADAGARSFSCIYQRADMSA
FT                   TVAMTMFLAFFSETIEAMESGFAPDGRAAGKRRRAAK"
FT                   /protein_id="YP_366316.1"
FT   misc_feature    122071..122943
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcep18194_C6622"
FT   misc_feature    122071..122241
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6622"
FT   misc_feature    122329..122922
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep18194_C6622"
FT   misc_feature    order(122374..122379,122383..122388,122395..122397,
FT                   122407..122409,122413..122433,122710..122727,
FT                   122743..122748,122752..122757)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep18194_C6622"
FT   gene            123156..125231
FT                   /db_xref="GeneID:3733901"
FT                   /locus_tag="Bcep18194_C6623"
FT   CDS_pept        123156..125231
FT                   /product="gamma-glutamyltransferase 1"
FT                   /gene_family="HOG000175619" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6623"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="GI:78059742"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:3733901"
FT                   /translation="MGLSNALPAHRGGRRQRDVHRNDLQEHRQTMNRTAIFPYASALLA
FT                   AALLTACGGDVENEAARTPTPSTDASCLAVDNSGATVVVGSNQPGDPSLPEASSGYRTG
FT                   MKPVYAKTYLVATSNAYASAAGCAVLKKGGTAADAAVAVQAVLGLTVPEATGLGSGGVL
FT                   LYYDARGKTLQAYDGRETAPAAATENYLRYVDDATDQSAPLPNARASGRSIGTIGVPRL
FT                   IEALQQDHGRLPWQNLFGDAITLATNGFPIGGRLADAIAANAANLKRDPEAAAYFLNAD
FT                   GSPKTLGTVLKNPAYAHTLTLMAQSGANALYTGQIAQDIVAKIATTKGADGSTLTPGKT
FT                   TVADLAAYQAKRRTPVCTTYRSYWVCGMPPPSSGGIAVASALGILENYDLKSLKPTAID
FT                   LEGGKPTVAGVHLVTEAERLAYADRDKYVADTDFVPLPGGTWDTLLNKPYLKSRAALID
FT                   PTKSMGTAQPGNLGAVPLGVDTTLIEHGTNQFTIVDGDGNVLSATTTVESSMGSFHMTN
FT                   GFLLNNQLTDFSANPVDSAGNPVANRLQPGKRPRSSMAPTIVFGQAADGSRGDFVMATG
FT                   SPGGGTIPQYVVKTLVGALDWGLDAQQSAGLVDFGASNSPTTTIGGEHPNVNTANNGAN
FT                   DPLITGLLALGHKVSTSAQASGVNTVMRVTVGQSPALQGGTDPRREGVVLGDTFRP"
FT                   /transl_table="11"
FT                   /protein_id="YP_366317.1"
FT   misc_feature    123474..125216
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:174918"
FT                   /locus_tag="Bcep18194_C6623"
FT   misc_feature    123540..125201
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="Bcep18194_C6623"
FT   gene            125311..125679
FT                   /db_xref="GeneID:3733902"
FT                   /locus_tag="Bcep18194_C6624"
FT   CDS_pept        125311..125679
FT                   /locus_tag="Bcep18194_C6624"
FT                   /gene_family="HOG000055593" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059743"
FT                   /db_xref="GeneID:3733902"
FT                   /translation="MTNAHLLEMDAILSVPGFFDFLGDLDCDRALDSRDAEPFDTQWMT
FT                   SFDEVDDDPGAAVDRPAVSVLREKAFKLAFGASGNAAVAACVSDDIELIARSRLSGSID
FT                   GWPTHVLWHAYRSGRFPC"
FT                   /protein_id="YP_366318.1"
FT   gene            125981..126523
FT                   /db_xref="GeneID:3733903"
FT                   /locus_tag="Bcep18194_C6625"
FT   CDS_pept        125981..126523
FT                   /locus_tag="Bcep18194_C6625"
FT                   /gene_family="HOG000257935" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059744"
FT                   /db_xref="GeneID:3733903"
FT                   /translation="MNKIRTILVGAALTAMATSAAFAQTAQTGAQGSAGVGAQVQTPLL
FT                   GGGVGVQAGAGANAAGSGSGAGNAVGGALNGVGKTVGGVGSAAGNAVGGATHAVGSAAG
FT                   TAKDAAASAVHSTKSHVKHVAGTAKSHAQGAVSTAGDVAGGAKAKAGEALEGATNSVQG
FT                   GASVGVKGSASAQGGAL"
FT                   /protein_id="YP_366319.1"
FT   gene            complement(126731..127402)
FT                   /db_xref="GeneID:3733904"
FT                   /locus_tag="Bcep18194_C6626"
FT   CDS_pept        complement(126731..127402)
FT                   /locus_tag="Bcep18194_C6626"
FT                   /gene_family="HOG000220777" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="toluene tolerance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059745"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="GeneID:3733904"
FT                   /translation="MRNHSRKLIVCCSLVLGSMACPAICSASDSGNYVHIEDQTDPGVL
FT                   IQTATEKVQDELRKRAIDPADTSRIMDIVNRDILPYTDIRRTTRLATGRHWREATPAQQ
FT                   DELTAQFQRLLIHTYSGALGLLTPDQKFQYPGTHGDANRADTVVRTVAIYNGQPVEIDY
FT                   RLYRTANGWRVYDLNLLGVWLVQIYRQQFSDEIGKHGIDGLIALLTARNADMANHGGSV
FT                   R"
FT                   /protein_id="YP_366320.1"
FT   misc_feature    complement(126767..127306)
FT                   /note="ABC-type transport system involved in resistance to
FT                   organic solvents, auxiliary component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: Ttg2D; cl01074"
FT                   /db_xref="CDD:163950"
FT                   /locus_tag="Bcep18194_C6626"
FT   misc_feature    complement(126767..127267)
FT                   /note="Toluene tolerance, Ttg2; Region: Tol_Tol_Ttg2;
FT                   pfam05494"
FT                   /db_xref="CDD:147591"
FT                   /locus_tag="Bcep18194_C6626"
FT   gene            complement(127807..128733)
FT                   /db_xref="GeneID:3733944"
FT                   /locus_tag="Bcep18194_C6627"
FT   CDS_pept        complement(127807..128733)
FT                   /locus_tag="Bcep18194_C6627"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059746"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:3733944"
FT                   /translation="MKAFVRVAEEGSFTGAASRMNTTTSYVSRAISALETHLRARLFNR
FT                   STRRIALTEAGERYMRRCEQIFASIDEAEAEAADAQARPSGRLRVHSPTSFGQSYVVPA
FT                   VVAFRKQHPAVSVDLTLSQKVPDMLEEGYDVSLQLTATTLPDSGLISQRLGVLHSVLCA
FT                   SPSYLARHGLPRSVADLDGHQCVPIVSSLFPHDLWHFDGPHGDEPFRLPPASFLVNGAD
FT                   ALATALREEAGIGAVPMPTALPAMRSGALVRVLPEHTLQPLTAHVLYPSRQYLDAKIKT
FT                   FIEALHALIPRALEADSAALAALSGNG"
FT                   /protein_id="YP_366321.1"
FT   misc_feature    complement(127876..128733)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="Bcep18194_C6627"
FT   misc_feature    complement(128563..128733)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep18194_C6627"
FT   misc_feature    complement(127876..128478)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6627"
FT   misc_feature    complement(order(127939..127941,128020..128022,
FT                   128071..128073,128263..128265,128269..128271,
FT                   128317..128319,128434..128436,128446..128448))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6627"
FT   misc_feature    complement(order(128044..128046,128053..128058,
FT                   128077..128088,128092..128094,128182..128184,
FT                   128371..128391,128395..128397,128407..128409,
FT                   128416..128421,128425..128430,128440..128445))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="Bcep18194_C6627"
FT   gene            129062..129679
FT                   /db_xref="GeneID:3733945"
FT                   /locus_tag="Bcep18194_C6628"
FT   CDS_pept        129062..129679
FT                   /locus_tag="Bcep18194_C6628"
FT                   /gene_family="HOG000131032" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="HAD family hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059747"
FT                   /db_xref="InterPro:IPR005833"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="GeneID:3733945"
FT                   /translation="MIKAIFFDYDGVLTTDRTGSVTTIRYLSGQFGVEYDILRNAFARH
FT                   NADLLLGKTTHNAIWRAVCESVRHELDFGWLEAAFLSTPANAGMFDLARRLEPFYALGI
FT                   ITDNKKDRIDCLRKAQRLDDLFDPIVVSAERGSGKEGAAVFEYALGCLDVKPEEAIFID
FT                   NTPENLIAPRQLGMHAILHDDSRNDIDGLIATLTTEFDLRLS"
FT                   /protein_id="YP_366322.1"
FT   misc_feature    129065..129589
FT                   /note="haloacid dehalogenase-like hydrolase; Region:
FT                   Hydrolase; pfam00702"
FT                   /db_xref="CDD:144342"
FT                   /locus_tag="Bcep18194_C6628"
FT   misc_feature    129071..129607
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Bcep18194_C6628"
FT   gene            129953..130723
FT                   /db_xref="GeneID:3733946"
FT                   /locus_tag="Bcep18194_C6629"
FT   CDS_pept        129953..130723
FT                   /locus_tag="Bcep18194_C6629"
FT                   /gene_family="HOG000124437" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059748"
FT                   /db_xref="GeneID:3733946"
FT                   /translation="MTILFRLLALACALWLAACAAPPPPPASTSASAAAPDASERRGLG
FT                   TAWGESVRSETRQVDFERADPAKPTDLASVYYNDALPGHPAASQVRRLPTRVALANGDI
FT                   ALSFTDEKGAPLRLARSDGRWHMAGVEGSRYMIVLRNQGRRTFEVVSSVDGLDVLSGRP
FT                   GSYTNGGYVLYPGRTLTIEGFRKSRDEVAAFRFAAVPDSYVANSKYGDAANVGVIGVAV
FT                   FAQKESEEEALRRNANPFPGNDNGYAPPPVPRGE"
FT                   /protein_id="YP_366323.1"
FT   gene            130692..131480
FT                   /db_xref="GeneID:3733947"
FT                   /locus_tag="Bcep18194_C6630"
FT   CDS_pept        130692..131480
FT                   /locus_tag="Bcep18194_C6630"
FT                   /gene_family="HOG000024007" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059749"
FT                   /db_xref="GeneID:3733947"
FT                   /translation="MRRRRCRAASDGASWISRVRRDERCTRCAPDSGLPERHARACDEL
FT                   HDNPARFMRTRINPTKSVALKLAALALLASNAVVACAETPAPESVRLANGHEIEWVRPG
FT                   LVDVDAARHQKSALIVPAALRRVLRDASSLAFPSDHAKRIDGKDYLLVVVNRSSNSKPT
FT                   GYCGAGEEGALYVLELHRARAVSRFSLPVQSCVDSISLDTHDGAQSPYLAIAWREDPIG
FT                   IDIRWEYLAHGGATHRVYRFVNGTFVEAEVPQSRGRAAAQ"
FT                   /protein_id="YP_366324.1"
FT   gene            131535..132077
FT                   /db_xref="GeneID:3733948"
FT                   /locus_tag="Bcep18194_C6631"
FT   CDS_pept        131535..132077
FT                   /locus_tag="Bcep18194_C6631"
FT                   /gene_family="HOG000296529" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059750"
FT                   /db_xref="InterPro:IPR005363"
FT                   /db_xref="GeneID:3733948"
FT                   /translation="MSLPAFRYHPDPLATGSAIRSDARCACCGVARGYVYAGPVYAVDE
FT                   YEQCICPWCIADGSAHARFDAIFTDTDGIGGGEWDEVPDAVVDEIACRTPGFQGWQQER
FT                   WWTHCGDGGQFIGRAGAGELTTLGPQAVASIRESAGLDEGAEWERFFAALDKDGSPTAY
FT                   MFRCIHCGELGGYQDCD"
FT                   /protein_id="YP_366325.1"
FT   misc_feature    131538..132074
FT                   /note="Uncharacterized protein family (UPF0167); Region:
FT                   UPF0167; cl01252"
FT                   /db_xref="CDD:154294"
FT                   /locus_tag="Bcep18194_C6631"
FT   gene            132142..133392
FT                   /db_xref="GeneID:3733949"
FT                   /locus_tag="Bcep18194_C6632"
FT   CDS_pept        132142..133392
FT                   /locus_tag="Bcep18194_C6632"
FT                   /gene_family="HOG000061512" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059751"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:3733949"
FT                   /translation="MKFIHAADIHLDSPLHGLSAYPDAPAAQLRNASREALRQLVDRAI
FT                   EEEVAFLVIAGDLYDGDWKDHNTGIFFGQQMGRLRKAGIRAFVLGGNHDAESEMTKKLT
FT                   LPDNVTVFGHRKAETHKLPEFDVALHGQSFKDKAVVDNLAIGYPDPVPGYYNIGVLHTA
FT                   LEGYAAHANYAPCTLAELHAKGYDYWALGHVHEFQQWSGPSTVVFPGNLQGRHIRETGR
FT                   RGAVLVTVEQGRTQVERLYLDVLRWEAVSVDASDCFTVADLSRKIGQSLEALLTVDGHV
FT                   PRAVRVTVTGRTPAHGLFFGRAPQLRAEVLNQIGIIGNERLWLEKVRLATSAADHQPGE
FT                   SEQLEALEDLKQILADAARDPDFLELLERDLKPFVGKVRSDVKEEVPLLTMARAGELTA
FT                   LVEQVGPALLARLARGE"
FT                   /protein_id="YP_366326.1"
FT   misc_feature    132142..133194
FT                   /note="DNA repair exonuclease [DNA replication,
FT                   recombination, and repair]; Region: SbcD; COG0420"
FT                   /db_xref="CDD:30769"
FT                   /locus_tag="Bcep18194_C6632"
FT   misc_feature    132145..132795
FT                   /note="Mre11 nuclease, N-terminal metallophosphatase
FT                   domain; Region: MPP_Mre11_N; cd00840"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bcep18194_C6632"
FT   misc_feature    order(132163..132165,132169..132171,132310..132312,
FT                   132415..132420,132622..132624,132718..132726)
FT                   /note="active site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bcep18194_C6632"
FT   misc_feature    order(132163..132165,132169..132171,132310..132312,
FT                   132415..132417,132622..132624,132718..132720,
FT                   132724..132726)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bcep18194_C6632"
FT   misc_feature    order(132175..132195,132319..132321,132424..132426,
FT                   132430..132435,132544..132549)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Bcep18194_C6632"
FT   gene            133396..136866
FT                   /db_xref="GeneID:3733950"
FT                   /locus_tag="Bcep18194_C6633"
FT   CDS_pept        133396..136866
FT                   /locus_tag="Bcep18194_C6633"
FT                   /gene_family="HOG000267580" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059752"
FT                   /db_xref="GeneID:3733950"
FT                   /translation="MRINQLDLIKYGKFTDETLRFPSSGEDFHVIVGPNEAGKSTIRTA
FT                   VSELLFGMKLQTPLDFLHSTPELRIGGVLGSGTGELAFHRARGRSPLRTPADDKLPDDF
FT                   LAAVLDGATREFFEQMFGLDHGRLVDGGRSILDASDKLGQVLFESAAGVGSLGPVREEL
FT                   DARSVELWAPRRSGSAFALAETSFNEAVTELKTVQVRTRDWVERKDAREAVEQQIEQAR
FT                   AEQRRLEALRSKLERVRRLAPYLKELTVKDAALVELGAVVELPPTAYADLLKAQGDLAA
FT                   EQKVLEERRADLLAKRQTRDAIDADADTLALEADIEALDRLRGACMNHAQDLLLLGADV
FT                   ERHLAAAFAAAAQLDWPTDEASLRASLPTALSLKTVANLLREHGALHQALAGARESLDE
FT                   RTRELAQVQEQQARLSTVDVPEALRAALADAQGFRNSGQREQALEHEIAAAERTLSGAL
FT                   DALGQWRMPVDALRALDVPSAARLGTLLKEDSERASAVAAARDARDGTLEELERLELQE
FT                   KHFAENHKVVTTADVLAARARRDGAWGDIRSGAVDLATGAPAVDDAIRLADELVDAQLG
FT                   ATQAAATLQSLRQQVESARAGVTRRQAALDEREHELAAHRDAWAALATTAAVPGMPLAA
FT                   MGDWLAKRDAVFAAQADLDRQRREFDTIRAARAGAETTLRAALRTVSRGGESDGLTALV
FT                   AIAETFVQSAEKALAQQDSLEDRAREAERGCATAQSRAGHAQTAYDAWHAQWRDALADA
FT                   KLSTSAATLAAAEGALGLANAVTTELADADAPRNRIAAIRAELAALEAGARRLAEALAP
FT                   EWLTSGDWPDVARRLTMRLSSAREIARAIGRADEAVRQADGKVADAAAAVAGADARIQP
FT                   LLQLAGVASIDAALPLAERSDRQRQLRQSVDAAHEALVRDGDGLSRSAVEAEVAEQDIA
FT                   DVPAHLEAVKQSLGDVGKRLNELAQQQVVADQAFGAIDGQANAAVAESKRQEALAAMGD
FT                   AAEQYLEAATASRLLKWATDRYRDQKQGPMLRRAGEIFAGLTLGEFARLTVDTERTPPA
FT                   LYARRSKGASVEVAGLSEGTRDQLFLALRIAALELQLGSRTALPFVADDLFINFDDARA
FT                   KAGLDALRDLSTRTQVLFLTHHDHLLPLVRDVFGARVNVVELQRAPVGA"
FT                   /protein_id="YP_366327.1"
FT   misc_feature    133396..>133917
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4717"
FT                   /db_xref="CDD:34333"
FT                   /locus_tag="Bcep18194_C6633"
FT   misc_feature    <135997..136791
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4717"
FT                   /db_xref="CDD:34333"
FT                   /locus_tag="Bcep18194_C6633"
FT   gene            136988..137512
FT                   /db_xref="GeneID:3733951"
FT                   /locus_tag="Bcep18194_C6634"
FT   CDS_pept        136988..137512
FT                   /product="metal dependent phosphohydrolase"
FT                   /gene_family="HOG000265510" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /locus_tag="Bcep18194_C6634"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="GI:78059753"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:3733951"
FT                   /translation="MKKLVAAIAFAADKHRNQRRKDEEASPYINHPIALADVLANEAGV
FT                   EDERVIVAAVLHDTVEDTETTEQELLRLFGKDVADIVMEVTDDKSLPKEERKRLQVEHA
FT                   STISRRAKLVKLADKICNLRDIARHPPADWPLERKQAYFDWAKSVVDPMRGVHPGLEAI
FT                   FDTAYDARPAD"
FT                   /transl_table="11"
FT                   /protein_id="YP_366328.1"
FT   misc_feature    137006..>137380
FT                   /note="(p)ppGpp synthetase, RelA/SpoT family; Region:
FT                   spoT_relA; TIGR00691"
FT                   /db_xref="CDD:129774"
FT                   /locus_tag="Bcep18194_C6634"
FT   gene            137522..138208
FT                   /db_xref="GeneID:3733952"
FT                   /locus_tag="Bcep18194_C6635"
FT   CDS_pept        137522..138208
FT                   /locus_tag="Bcep18194_C6635"
FT                   /gene_family="HOG000267591" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059754"
FT                   /db_xref="GeneID:3733952"
FT                   /translation="MRSARSIESAARQSLAVAGVDVGGEKKQCDLVILRGQAVVCREAR
FT                   IAPEAVPALCLAHDVVAVGVDAPSLWWTGSGRRAAEQALARERISCFPTPSREQAVAST
FT                   SGFFDWMFMGERVYRALADAYPLLTDACYAGGRASFETYPYAITCAMLGRDVASAKQKR
FT                   NQRRQLLERLGVDVSTLKSVDARDATLCALTAQCVIDGNAHAYGDAEGGYIRVPIVNET
FT                   IVLDAL"
FT                   /protein_id="YP_366329.1"
FT   misc_feature    137576..138160
FT                   /note="Protein of unknown function (DUF429); Region:
FT                   DUF429; cl12046"
FT                   /db_xref="CDD:159706"
FT                   /locus_tag="Bcep18194_C6635"
FT   gene            complement(138381..138851)
FT                   /db_xref="GeneID:3733953"
FT                   /locus_tag="Bcep18194_C6636"
FT   CDS_pept        complement(138381..138851)
FT                   /locus_tag="Bcep18194_C6636"
FT                   /gene_family="HOG000267602" [ FAMILY / ALN / TREE ]
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:78059755"
FT                   /db_xref="GeneID:3733953"
FT                   /translation="MPRPNHALISTMDSTTQPGDADLRDEYAALRERAIILEEQAPPLL
FT                   QRISDVLPRISGESELADEHRERLVGARNAAMVSIENYQQAIPFLQTADSIIEQLDKTP
FT                   ERDEDIEWRESLLQRLDELIDVAVVMINDADGYFEQAQACDLSSVPKAILED"
FT                   /protein_id="YP_366330.1"
FT   gene            139518..140997
FT                   /db_xref="GeneID:3733954"
FT                   /locus_tag="Bcep18194_CR0084"
FT   rRNA            139518..140997
FT                   /db_xref="GeneID:3733954"
FT                   /locus_tag="Bcep18194_CR0084"
FT                   /product="16S ribosomal RNA"
FT   gene            141061..141134
FT                   /db_xref="GeneID:3733955"
FT                   /locus_tag="Bcep18194_CR0085"