(data stored in ACNUC8465 zone)

HOGENOMDNA: BURSC_2

ID   BURSC_2; SV 1; empty ; DNA; empty ; PRO; 2593966 BP.
XX
AC   NC_014118;
XX
PR   Project: 42523;
XX
DE   Burkholderia sp. CCGE1002 chromosome chromosome 2, complete sequence.
XX
OS   Burkholderia sp. CCGE1002
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-2593966
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Ovchinnikova,G., Martinez-Romero,E.,
RA   Hernandez,M.A.R., Tiedje,J.M. and Woyke,T.;
RT   "Complete sequence of chromosome2 of Burkholderia sp. CCGE1002";
RL   Unpublished
XX
RN   [2]
RP   1-2593966
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-MAY-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2593966
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Ovchinnikova,G., Martinez-Romero,E.,
RA   Hernandez,M.A.R., Tiedje,J.M. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (19-APR-2010) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002014.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085555
CC   Source DNA and organism available from Esperanza Martinez-Romero
CC   (Centro de Ciencias Genomicas--http://ccg.unam.mx)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Burkholderia sp. CCGE1002 is a mimosa occidentalis nodule isolate
CC   from Nayarit, Tepic, Mexico. Site of isolation is Latitude: 21.604,
CC   Longitude: -104.952. Additionally, it forms nodules in Phaseolus
CC   vulgaris beans. It contributes to Nitrogen fixation and CO2
CC   fixation in the tropics.
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2593966
FT                   /strain="CCGE1002"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia sp. CCGE1002"
FT                   /chromosome="2"
FT                   /db_xref="taxon:640511"
FT   gene            39..563
FT                   /db_xref="GeneID:9114826"
FT                   /locus_tag="BC1002_3186"
FT   CDS_pept        39..563
FT                   /locus_tag="BC1002_3186"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00959"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 24"
FT                   /transl_table="11"
FT                   /note="KEGG: pay:PAU_03330 phage related lysozyme; manually
FT                   curated; PFAM: glycoside hydrolase family 24"
FT                   /db_xref="GI:295698849"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="GeneID:9114826"
FT                   /translation="MAVQSGRLCKPWHVSPEGLSFTAVWESGVLNGVYQGHQVTEGFIL
FT                   KAYLDNVGIPTVGCGHRIIVADHIEVGQVISLERAREFRRRNVAEVERRLNSGIHVPLF
FT                   QYEYDALVSIVYNSGPGRGADGIIGKINAGNYRNMHDFILTYRIGGNRGVRNRRVGEAR
FT                   LFSSGVYDASH"
FT                   /protein_id="YP_003606742.1"
FT   misc_feature    78..479
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:176812"
FT                   /locus_tag="BC1002_3186"
FT   misc_feature    114..116
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29558"
FT                   /locus_tag="BC1002_3186"
FT   gene            592..990
FT                   /db_xref="GeneID:9112490"
FT                   /locus_tag="BC1002_3187"
FT   CDS_pept        592..990
FT                   /locus_tag="BC1002_3187"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ara:Arad_7761 urease-associated protein"
FT                   /db_xref="GI:295698850"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="GeneID:9112490"
FT                   /translation="MLFPIFATAKSNYDFSVTISNSDCLQHLGGGYGDVECYSELQKKL
FT                   VADSQILYKKLRATIPKGNIHAKLLDEYMATQNASVKYCELPRNAGAEWETEHGGSMFP
FT                   ALQAECIYNLRKTQNEFLKGLLDMADGK"
FT                   /protein_id="YP_003606743.1"
FT   gene            complement(1173..3554)
FT                   /db_xref="GeneID:9112491"
FT                   /locus_tag="BC1002_3188"
FT   CDS_pept        complement(1173..3554)
FT                   /locus_tag="BC1002_3188"
FT                   /gene_family="HOG000217969" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /codon_start="1"
FT                   /product="TonB-dependent receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: bxe:Bxe_B2473 putative TonB-dependent
FT                   siderophore receptor"
FT                   /db_xref="GI:295698851"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:9112491"
FT                   /translation="MSMRSQARRQRRLQRRAGITFCVGGALAGLSTSVWAQAQAEPPVA
FT                   ASAPASASSAAPSRAPDDSANSNTTPTTTLAPIVVVGTTPLLGIGTPLTQVPANVQTVH
FT                   AADIQRQGRQTLTDFLAANLPSVTISDAQGNPYQMNLFYRGFTASPLLGTPQGLSVFVD
FT                   GVRVNEPFGDVVNWDLIPQQAIDTMQLIPGSNPTFGFNTLGGALAITTKNGKDNPVGEA
FT                   EIQGGSWGRKAAQIEQGGTIGQNLDYYFTANAANDNGWAEQNESRIRQAFGKLRYTDAD
FT                   TTLSLSAGGADNDLHGVQTIPRSFLNNPKQPYTYPDRNQNSVGYLTLSGDHYFNDNVEL
FT                   SGNAYYRHFRNSNTSSNVNENFGEIEGDGDVDTLQATNLQSVVSTDSYGASLQLTLLGK
FT                   LGGMKNQFIAGMAVDAANSHFTQSSQDAAFTDSRATVGIGNFEPQTNANTHNTNYGIYL
FT                   TDTLSLTPQWSLTLSGRYNWADATIGDESGTQPQLNGHHTFSRFNPAVGINWNPTPAFT
FT                   AYATYNEGMRSPTAIELACADPNAPCSLPNDFISDPPLQPVISKTYEVGARGRIGGNTT
FT                   WSAAAYSTTLDNDIQFISSNGAGSSQGFFQNVGRTRRQGVELAGQTKYGPLTVTGSYSY
FT                   VNATYQSTWVESSPSNSSADANGNITVHPGDHIPSIPATTVKLRLDYAATSKWRIGTNL
FT                   TWRGSIYAQGDENNQDVNGKISGYLLIDMDTSYQVTKQLQVFASVSNLLDKRYASFGAL
FT                   GANFFTGPGNTFNGASPVNEQFVGPGAPRGFWVGMRYAWE"
FT                   /protein_id="YP_003606744.1"
FT   misc_feature    complement(1239..3269)
FT                   /note="TonB-dependent siderophore receptor; Region:
FT                   TonB-siderophor; TIGR01783"
FT                   /db_xref="CDD:162535"
FT                   /locus_tag="BC1002_3188"
FT   misc_feature    complement(1179..3260)
FT                   /note="TonB dependent/Ligand-Gated channels are created by
FT                   a monomeric 22 strand (22,24) anti-parallel beta-barrel.
FT                   Ligands apparently bind to the large extracellular loops.
FT                   The N-terminal 150-200 residues form a plug from the
FT                   periplasmic end of barrel...; Region: ligand_gated_channel;
FT                   cd01347"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="BC1002_3188"
FT   misc_feature    complement(order(2922..2948,2979..3011,3054..3077,
FT                   3117..3134,3171..3197,3201..3203,3231..3260))
FT                   /note="N-terminal plug; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="BC1002_3188"
FT   misc_feature    complement(order(2421..2423,2502..2504))
FT                   /note="ligand-binding site; other site"
FT                   /db_xref="CDD:73259"
FT                   /locus_tag="BC1002_3188"
FT   gene            3734..4732
FT                   /db_xref="GeneID:9112492"
FT                   /locus_tag="BC1002_3189"
FT   CDS_pept        3734..4732
FT                   /locus_tag="BC1002_3189"
FT                   /gene_family="HOG000121727" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2472 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="GI:295698852"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="GeneID:9112492"
FT                   /translation="MSSEPIHSSSAGRAPPSSPIWRDLGWVVAVTALAAALGAAFDLSE
FT                   KIYRFTRGVERFQLDELPGTLFVLSIALAWFAWRRYSDARREARHRRMLEEQAEQLLAD
FT                   NRRLASQALQAQELERRHMARELHDELGQYLNAMSLDAVRIRDLSGEREPEIHRIALGL
FT                   IQSATHVYREIGGMIRRLRPIGLDEFGLPTALEHCVDGWRERLPEASFSVTIEGDFSGL
FT                   SDALTITLYRLVQEGLTNVSKFARRSRVELFMVRAPREHDGTQIDEIVVTMADDGPGTD
FT                   LTGPRSGLGLIGMRERVEALGGEFHVASEPQRGFLFCARLSAHAGLAEPVN"
FT                   /protein_id="YP_003606745.1"
FT   misc_feature    4088..4279
FT                   /note="Histidine kinase; Region: HisKA_3; pfam07730"
FT                   /db_xref="CDD:149021"
FT                   /locus_tag="BC1002_3189"
FT   misc_feature    4415..4696
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="BC1002_3189"
FT   gene            complement(4702..5364)
FT                   /db_xref="GeneID:9112493"
FT                   /locus_tag="BC1002_3190"
FT   CDS_pept        complement(4702..5364)
FT                   /locus_tag="BC1002_3190"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2471 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="GI:295698853"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:9112493"
FT                   /translation="MSADTISVLLVDDHAVVREGYRRLLELNDDVEVCGEAADAAQAYQ
FT                   RFCALRPDVVVMDVSLPGASGIEAMRRMLAREPDARVLIFSVHEESIFVRRALDAGALG
FT                   YVTKASAPDVLVEAVRSIARRAGYLSPDISQALALRTAFNEGPPGRQLSAREFEVLRLL
FT                   VQGYTLPSIAEKLGLSQKTVANHQSVIRQKFGADNGVQLAQMASRLGLQFTGSASPA"
FT                   /protein_id="YP_003606746.1"
FT   misc_feature    complement(4732..5349)
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(4996..5340)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(order(5038..5043,5050..5052,5107..5109,
FT                   5167..5169,5191..5193,5326..5331))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(5191..5193)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(order(5167..5175,5179..5184))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(5035..5043)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(4741..4911)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(order(4768..4770,4801..4815,4819..4824,
FT                   4828..4833,4855..4863,4900..4908))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3190"
FT   misc_feature    complement(order(4741..4746,4753..4755,4762..4770,
FT                   4861..4863,4867..4869,4873..4875))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3190"
FT   gene            complement(5361..6599)
FT                   /db_xref="GeneID:9112494"
FT                   /locus_tag="BC1002_3191"
FT   CDS_pept        complement(5361..6599)
FT                   /locus_tag="BC1002_3191"
FT                   /gene_family="HOG000217923" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02109"
FT                   /codon_start="1"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein E; PFAM:
FT                   Radical SAM domain protein; KEGG: bxe:Bxe_B2470
FT                   pyrroloquinoline quinone biosynthesis protein PqqE; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="GI:295698854"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="GeneID:9112494"
FT                   /translation="MTDLSQPGSQSGAQPQTSTAAAVPPPLWLLAELTYRCPLHCAFCY
FT                   NPLDYTDHNRELTTGQWLDVLREARALGAVQLGFSGGEPLVRDDVEVLVEEAHRLGFYT
FT                   NLITSGVGLTDQRLGDLKAAGLDHIQLSFQDSTQQLNDFLSSTRTFELKQRVAAALKRH
FT                   GFPMVMNCVLHRYNLPHVDKIIEMALALGAEYLELANTQYYGWARENQAQLMPTREQLE
FT                   EAEAVVARYRRTHGERCKIFFVVPDYFERRPKRCMNGWGAVFLGVAPDGAALPCHAARG
FT                   LPGLTLPNVKDMPLHEIWYESDAFNRFRGLQWMKEPCRSCDEKEHDLGGCRCQAFLLTG
FT                   DAANADPVCDKSPFHENVVKIVRQAASQTEATVAAREQPILFRNDANSRKLAAAAREPG
FT                   AAGDNRASPGAQS"
FT                   /protein_id="YP_003606747.1"
FT   misc_feature    complement(5430..6500)
FT                   /note="pyrroloquinoline quinone biosynthesis protein PqqE;
FT                   Provisional; Region: PRK05301"
FT                   /db_xref="CDD:167968"
FT                   /locus_tag="BC1002_3191"
FT   misc_feature    complement(<6048..6500)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_3191"
FT   misc_feature    complement(order(6084..6086,6204..6206,6273..6281,
FT                   6351..6356,6360..6362,6465..6473,6477..6479,6483..6485,
FT                   6489..6491))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_3191"
FT   gene            complement(6604..6882)
FT                   /db_xref="GeneID:9112495"
FT                   /locus_tag="BC1002_3192"
FT   CDS_pept        complement(6604..6882)
FT                   /locus_tag="BC1002_3192"
FT                   /gene_family="HOG000217936" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05402"
FT                   /codon_start="1"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /transl_table="11"
FT                   /note="PFAM: coenzyme PQQ synthesis D; KEGG: bxe:Bxe_B2469
FT                   pyrroloquinoline quinone synthesis D"
FT                   /db_xref="GI:295698855"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="GeneID:9112495"
FT                   /translation="MNDTTRAQPATPLAIAKPFRLQWEPAQNAHVLLYPEGMVKLNQSA
FT                   GEILKRCDGTRDIDTLIAELEQAFNATGIGNEVRAFIADAHGRGWLE"
FT                   /protein_id="YP_003606748.1"
FT   misc_feature    complement(6607..6861)
FT                   /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
FT                   PqqD; cl05126"
FT                   /db_xref="CDD:174835"
FT                   /locus_tag="BC1002_3192"
FT   gene            complement(6879..7637)
FT                   /db_xref="GeneID:9112496"
FT                   /locus_tag="BC1002_3193"
FT   CDS_pept        complement(6879..7637)
FT                   /locus_tag="BC1002_3193"
FT                   /gene_family="HOG000217947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02111"
FT                   /codon_start="1"
FT                   /EC_number="1.3.3.11"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein C; KEGG:
FT                   bxe:Bxe_B2468 pyrroloquinoline quinone biosynthesis protein
FT                   PqqC; PFAM: TENA/THI-4 domain protein"
FT                   /db_xref="GI:295698856"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="GeneID:9112496"
FT                   /translation="MNAKDIQDTTPTRDASAAGTQVIDRPAWSREEFEAQLRAKGTAYH
FT                   IHHPFNVKMNSGGCSREQIRGWVANRFYYQINIPLKDAAVLSNCPDRATRRRWVLRILD
FT                   HDGYEGSEGGIETWARLGDAVGLTRDELWSLEHVTPGVRFAVDAYVNFARRAPWQEAVC
FT                   SSLTEMFAPQVHRDRLASWPEHYPWIEPEGLAYFRSRISLAQRDVQHGLEVTLAHFTRR
FT                   DQQERALEILQFKLDILWTMLDSIEKAFPQ"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /protein_id="YP_003606749.1"
FT   misc_feature    complement(6882..7568)
FT                   /note="TENA/THI-4/PQQC family; Region: TENA_THI-4; cl00527"
FT                   /db_xref="CDD:174266"
FT                   /locus_tag="BC1002_3193"
FT   gene            complement(7714..8628)
FT                   /db_xref="GeneID:9112497"
FT                   /locus_tag="BC1002_3194"
FT   CDS_pept        complement(7714..8628)
FT                   /locus_tag="BC1002_3194"
FT                   /gene_family="HOG000217958" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02108"
FT                   /codon_start="1"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B; KEGG:
FT                   bxe:Bxe_B2467 pyrroloquinoline quinone biosynthesis protein
FT                   PqqB"
FT                   /db_xref="GI:295698857"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="GeneID:9112497"
FT                   /translation="MKIKVLGSSAGGGFPQWNCNCRNCDGVRRGTVKATRRTQSSIAVS
FT                   ANGEDWLLVNASPDLLAQIAAHPELQPARRARDSGIAAVLVIDAQIDHVTGLLMLRERD
FT                   TPLPLYATDAVWQDLRSGFPVAPILSHYCGVEHRRIALDGAPLAVDALPGIRIDALPLS
FT                   SKAPPYSPHREAPERGDNIGLVLTNLQSGQRVFYAPGLGVIEPHVLAAMREADLLLVDG
FT                   TLWTGDEMIRLGLSKKTSADMGHLPQSGAGGMIETLDSLNAKRKVLIHINNTNPILIED
FT                   GPERRMLGEHGIEVAYDGMSFEL"
FT                   /protein_id="YP_003606750.1"
FT   misc_feature    complement(7717..8628)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="BC1002_3194"
FT   gene            complement(8625..9662)
FT                   /db_xref="GeneID:9112498"
FT                   /locus_tag="BC1002_3195"
FT   CDS_pept        complement(8625..9662)
FT                   /locus_tag="BC1002_3195"
FT                   /gene_family="HOG000171480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.4.11.5"
FT                   /codon_start="1"
FT                   /EC_number="3.4.11.5"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2466 prolyl aminopeptidase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="GI:295698858"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="GeneID:9112498"
FT                   /translation="MTMRSSSHHTQAAAALEVHTLRTRDGHRVWYALAGARDGVPVAVL
FT                   HGGPGSGSQPGVLRLFDLRRFRVVLIDQRGTGASTPHGSVRHNRTDYLIADLEAIRARL
FT                   GFARWGVLGGSWGAALALAYAGQCPQSVTGVVVRGLFLTSAREVRGLFIASRKRAPRAW
FT                   SRLRAAARCEQPATLAARCGSGLQYGANEARQRSLALAWRGYENAVLASASPRGSAAQQ
FT                   RGVQRNTHESQRHARKLIGKYRIQAHYLAHRCWLGETRLLSLARRAAAAGVPIAAVHGA
FT                   RDPVCPHGNLRRLSRAVPSARVESVSAAGHLASDPALHARVAQVLAAMFTPTIDEERSS
FT                   MRHAA"
FT                   /product="Prolyl aminopeptidase"
FT                   /protein_id="YP_003606751.1"
FT   misc_feature    complement(8676..9602)
FT                   /note="proline iminopeptidase, Neisseria-type subfamily;
FT                   Region: pro_imino_pep_1; TIGR01249"
FT                   /db_xref="CDD:130316"
FT                   /locus_tag="BC1002_3195"
FT   gene            complement(9659..10315)
FT                   /db_xref="GeneID:9112499"
FT                   /locus_tag="BC1002_3196"
FT   CDS_pept        complement(9659..10315)
FT                   /locus_tag="BC1002_3196"
FT                   /gene_family="HOG000110384" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /codon_start="1"
FT                   /product="cytochrome B561"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome B561; KEGG: bxe:Bxe_B2465 putative
FT                   cytochrome b561"
FT                   /db_xref="GI:295698859"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="GeneID:9112499"
FT                   /translation="MSARTETVFGKKETSRHDVAWRQGMTTADSRNAKPDIDVNATASA
FT                   GGPRYAGLLMALHWLIALGIIGLLALGLYMVGLPKGLPVKATLINLHKSLGLTVFLLVL
FT                   LRIVARVVLHRPPLPPMPTWQRAAARTTQGLLYVCMVAMPLAGYLGSSFNRYGTRFWGI
FT                   LLPKWGWDDAHLRELFFGLHQAIGYALIALIVLHVAGAFKHQWIDRDNLLARMLP"
FT                   /protein_id="YP_003606752.1"
FT   misc_feature    complement(9662..10096)
FT                   /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
FT                   a subunit of cytochrome bc1, an 11-subunit mitochondrial
FT                   respiratory enzyme. Cytochrome b spans the mitochondrial
FT                   membrane with 8 transmembrane helices (A-H) in eukaryotes.
FT                   In plants and cyanobacteria; Region: Cytochrome_b_N;
FT                   cl00859"
FT                   /db_xref="CDD:174425"
FT                   /locus_tag="BC1002_3196"
FT   gene            complement(10325..11161)
FT                   /db_xref="GeneID:9112500"
FT                   /locus_tag="BC1002_3197"
FT   CDS_pept        complement(10325..11161)
FT                   /locus_tag="BC1002_3197"
FT                   /gene_family="HOG000228463" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03122"
FT                   /codon_start="1"
FT                   /EC_number="1.2.99.5"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: formylmethanofuran dehydrogenase subunit C;
FT                   KEGG: bxe:Bxe_B2464 formylmethanofuran dehydrogenase,
FT                   subunit C; PFAM: glutamate synthase alpha subunit domain
FT                   protein"
FT                   /db_xref="GI:295698860"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="GeneID:9112500"
FT                   /translation="MSTTTLRVKTPPGFRVDAAALSPAALASMSVAEVERIVLPAGNER
FT                   CVVGDVFEVSRDDAPASGDDMATLLIDGAARWLDRLGAQMDGGRLVARGAVGDYSGFRM
FT                   SGGLLEIDGDARHFTGCEMRGGRVTVRGDSGDFAAGALTGDMEGMSGGTLTIHGNAGAR
FT                   LADRMRRGLVLVGGNAGDFAASRLVAGTVGVAGQLGAHYAYAMRRGTLLLGQRPEGLPP
FT                   PTFTGGGHGFDVFWSLLIRSLAAEIAPFSQWRADRLPVRFTGDLAVDGRGEILIAG"
FT                   /product="formylmethanofuran dehydrogenase subunit C"
FT                   /protein_id="YP_003606753.1"
FT   misc_feature    complement(10514..11029)
FT                   /note="FwdC/FmdC. This domain of unknown function is found
FT                   in the subunit C of formylmethanofuran dehydrogenase, an
FT                   enzyme that catalyzes the first step in methane formation
FT                   from CO2 in methanogenic archaea, hyperthermophiles and
FT                   bacteria. There are two...; Region: FwdC/FmdC; cd00980"
FT                   /db_xref="CDD:29609"
FT                   /locus_tag="BC1002_3197"
FT   misc_feature    complement(order(10541..10543,10550..10552,10559..10561,
FT                   10598..10600,10604..10609,10622..10630,10655..10657,
FT                   10661..10666,10673..10687,10712..10714,10721..10723,
FT                   10730..10732,10739..10744,10790..10792,10799..10801,
FT                   10814..10822,10853..10855,10865..10870,10877..10879,
FT                   10910..10915))
FT                   /note="putative subunit interface; other site"
FT                   /db_xref="CDD:29609"
FT                   /locus_tag="BC1002_3197"
FT   gene            complement(11158..12129)
FT                   /db_xref="GeneID:9112501"
FT                   /locus_tag="BC1002_3198"
FT   CDS_pept        complement(11158..12129)
FT                   /locus_tag="BC1002_3198"
FT                   /gene_family="HOG000230959" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03119"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.101"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: formylmethanofuran/tetrahydromethanopterin
FT                   N-formyltransferase; KEGG: bxe:Bxe_B2463
FT                   formylmethanofuran--tetrahydromethanopterin
FT                   formyltransferase; PFAM: formylmethanofuran:
FT                   tetrahydromethanopterin formyltransferase (Ftr)"
FT                   /db_xref="GI:295698861"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="GeneID:9112501"
FT                   /translation="MNAPAPLEINGTAIDATFAEAFPMKATRLVITAHTPTWAMHAANS
FT                   LSGFATSVIGCGCEAGIERTLAPEATPDGRPGVAVLLFAVSTKELAKQIGRRVGQCVLT
FT                   CPSTAVYSGIDPATSRAPLSDPAPLGSGLRFFGDGWQIAKMIDTGNGPTRYWRVPVMDG
FT                   EFVCEDTAATVKAVGGGNLLLLARDQGAALAAAEAAVAAMRRLPNVIMPFPGGIVRSGS
FT                   KIGSKYAGATASTNDAFCPSLIGLASRSELSADVGRVLEIVIDGLTDADVGAAMTAGIG
FT                   AATGLGRAAGVLRISAGNYGGKLGPYHFHLHELAAGLNGGRA"
FT                   /product="formylmethanofuran/tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /protein_id="YP_003606754.1"
FT   misc_feature    complement(11182..12111)
FT                   /note="formylmethanofuran--tetrahydromethanopterin
FT                   formyltransferase; Provisional; Region: PRK02114"
FT                   /db_xref="CDD:167315"
FT                   /locus_tag="BC1002_3198"
FT   misc_feature    complement(11650..12111)
FT                   /note="lobe; Region: FTR; pfam01913"
FT                   /db_xref="CDD:145206"
FT                   /locus_tag="BC1002_3198"
FT   misc_feature    complement(11188..11646)
FT                   /note="FTR, proximal lobe; Region: FTR_C; pfam02741"
FT                   /db_xref="CDD:145736"
FT                   /locus_tag="BC1002_3198"
FT   gene            complement(12140..13864)
FT                   /db_xref="GeneID:9112502"
FT                   /locus_tag="BC1002_3199"
FT   CDS_pept        complement(12140..13864)
FT                   /locus_tag="BC1002_3199"
FT                   /gene_family="HOG000228452" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03121"
FT                   /codon_start="1"
FT                   /product="formylmethanofuran dehydrogenase subunit A"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2462 formylmethanofuran
FT                   dehydrogenase, subunit A; TIGRFAM: formylmethanofuran
FT                   dehydrogenase subunit A; PFAM: Amidohydrolase 3"
FT                   /db_xref="GI:295698862"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="GeneID:9112502"
FT                   /translation="MTLVRLKGGTLFDPINNVNGERRDLTFRDGRIVDVPATTPVDREY
FT                   DATCMIVMAGGIDLHSHIGGGKTNLSRLLLPEDHRADAPGAVAPGAVAPREAAYEAARD
FT                   DNGRYLRLPSCGVCTPGTLATGYRYAEMGYTAAFEPAMMPSNARHTHLEMGDTPIIDHG
FT                   AYVMLGNDELFLQMLAARDDFERLRDYVGWTINASKALGVKVVNPGGISAFKFNQRSLD
FT                   VDEPHAHYGITPREVLRTLTRALTELRVPHPLHVHTSNLGVPGNLASTIATMDAADGLP
FT                   IHLTHIQFHSYGTEGSRKFSSGARQIAEAVNARPNVSIDVGQIIFGQTVTASGDTMMQF
FT                   RNAPLARPHKWVVGDIECDAGCGVLPFRYREQSYVNALQWIIGLEIFLLVDDPWRVAMT
FT                   TDHPNGGPFTSYPHLIRLLMDKTFRDEQLAKLHPEAQVASALPELKREFSLYEIAIITR
FT                   AGPARLLGLRDRGHLGAGAAADIAVYRDEPDRERMFTSPAYVFKDGELVARDGTLVATP
FT                   TGGIHFVAPEFDRGIERTLRAYSDANLASNFAHAAISDDEACRCCRGGRLLPVECLT"
FT                   /protein_id="YP_003606755.1"
FT   misc_feature    complement(12194..13858)
FT                   /note="formylmethanofuran dehydrogenase subunit A; Region:
FT                   one_C_dehyd_A; TIGR03121"
FT                   /db_xref="CDD:163143"
FT                   /locus_tag="BC1002_3199"
FT   misc_feature    complement(12227..13849)
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="BC1002_3199"
FT   misc_feature    complement(order(12662..12664,13007..13009,13094..13096,
FT                   13679..13681,13685..13687))
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="BC1002_3199"
FT   gene            complement(13861..15240)
FT                   /db_xref="GeneID:9112503"
FT                   /locus_tag="BC1002_3200"
FT   CDS_pept        complement(13861..15240)
FT                   /locus_tag="BC1002_3200"
FT                   /gene_family="HOG000236839" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2461"
FT                   /codon_start="1"
FT                   /product="formylmethanofuran dehydrogenase, subunit B"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2461 formylmethanofuran
FT                   dehydrogenase, subunit B"
FT                   /db_xref="GI:295698863"
FT                   /db_xref="GeneID:9112503"
FT                   /translation="MHSSAIDPSTPSSSATRAAALTRDWICPFCPLLCDDLVAASHDDG
FT                   TLEVPDTECSRLAHALTRYGAADAQCRCVVDGSEADHDAALTSAAQWLANARRPLFGGL
FT                   ATDVAGTRALYPLAAACGAILDHLHGDALTPATLALQDRGAFFTTLSEVRARADLLVFF
FT                   GCQPSRRYPRFYTRALGGTELARELVFVGCDADPAAAGLPQTRIDPLLRDADPYDTLAL
FT                   WSALAEGRDAAALSHGAGSQANVATALASLHARIASARYTVVVYEPAALPAPHAALLIE
FT                   ALNRIVKAVNRTTRAACLALGGDDGALTVNQTVTWLSGLPLRTRVSMPARVTGAAPLDH
FT                   DPYRYRTARLLAEREVDALVWIASFAPHAWPASLDPALPLIVLGHPALADAAKARGANT
FT                   VFVPVATPGIDSGGHLFRVDGTAVMPLAAARGAALETVASLAAQLNERLSERLNPREDQ
FT                   P"
FT                   /protein_id="YP_003606756.1"
FT   misc_feature    complement(13897..15171)
FT                   /note="The MopB_FmdB-FwdB CD contains the
FT                   molybdenum/tungsten formylmethanofuran dehydrogenases,
FT                   subunit B (FmdB/FwdB), and other related proteins.
FT                   Formylmethanofuran dehydrogenase catalyzes the first step
FT                   in methane formation from CO2 in methanogenic archaea...;
FT                   Region: MopB_FmdB-FwdB; cd02761"
FT                   /db_xref="CDD:29457"
FT                   /locus_tag="BC1002_3200"
FT   misc_feature    complement(13969..15165)
FT                   /note="formylmethanofuran dehydrogenase subunit B; Region:
FT                   one_C_dehyd_B; TIGR03129"
FT                   /db_xref="CDD:132173"
FT                   /locus_tag="BC1002_3200"
FT   misc_feature    complement(order(15079..15081,15139..15141,15151..15153,
FT                   15160..15162))
FT                   /note="putative [4Fe-4S] binding site; other site"
FT                   /db_xref="CDD:29457"
FT                   /locus_tag="BC1002_3200"
FT   misc_feature    complement(order(14008..14010,14026..14031,14077..14079,
FT                   14086..14094,14155..14157,14167..14175,14329..14334,
FT                   14425..14427,14431..14442,14593..14595,14599..14601,
FT                   14659..14670,14731..14736,14743..14745,14749..14754,
FT                   14842..14850,14854..14856,14926..14928,15073..15075))
FT                   /note="putative molybdopterin cofactor binding site; other
FT                   site"
FT                   /db_xref="CDD:29457"
FT                   /locus_tag="BC1002_3200"
FT   gene            complement(15537..16286)
FT                   /db_xref="GeneID:9112504"
FT                   /locus_tag="BC1002_3201"
FT   CDS_pept        complement(15537..16286)
FT                   /locus_tag="BC1002_3201"
FT                   /gene_family="HOG000224613" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00977"
FT                   /codon_start="1"
FT                   /product="histidine biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   bxe:Bxe_B2460 putative
FT                   phosphoribosylformimino-5-aminoimidazole
FT                   carboxamideribotide isomerase"
FT                   /db_xref="GI:295698864"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:9112504"
FT                   /translation="MQVIPVLDLLDGQVVRAVRGERSAYRPIQSRLVATSDPLATAHAL
FT                   LEASGARTLYIADLGAILQRGAHASTLAALRAALPGIELWLDAGFADYASMRALFERID
FT                   AAVDQLDRPAANSNLATLVPVFGSETLREIHALHAAQRAGLAPILSLDHRAGELLAATA
FT                   LDRSSAWWPSRVIAMTLDQVGSYAGPDLATFERLRAQAAAHTTLIGAGGIRNRDDLAAA
FT                   AGTGASAWLVASALHDRQIDCAPSDSA"
FT                   /protein_id="YP_003606757.1"
FT   misc_feature    complement(15564..16283)
FT                   /note="Phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribonucleotide (ProFAR) isomerase (HisA) and the cyclase
FT                   subunit of imidazoleglycerol phosphate synthase (HisF). The
FT                   ProFAR isomerase catalyzes the fourth step in histidine
FT                   biosynthesis, an...; Region: HisA_HisF; cd04723"
FT                   /db_xref="CDD:73385"
FT                   /locus_tag="BC1002_3201"
FT   misc_feature    complement(15561..16280)
FT                   /note="Histidine biosynthesis protein; Region:
FT                   His_biosynth; pfam00977"
FT                   /db_xref="CDD:144535"
FT                   /locus_tag="BC1002_3201"
FT   misc_feature    complement(order(15831..15833,16122..16124,16263..16265))
FT                   /note="active site"
FT                   /db_xref="CDD:73385"
FT                   /locus_tag="BC1002_3201"
FT   gene            16303..17346
FT                   /db_xref="GeneID:9112505"
FT                   /locus_tag="BC1002_3202"
FT   CDS_pept        16303..17346
FT                   /locus_tag="BC1002_3202"
FT                   /gene_family="HOG000236837" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF201"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   bxe:Bxe_B2459 hypothetical protein"
FT                   /db_xref="GI:295698865"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:9112505"
FT                   /translation="MTKIFVYEYLTGGGIDPEFAGAGSLADLSALIIEGRVMRDALVAA
FT                   LRELDGVQVTFATSRFETPAAGDAHCMAAPGESMTAFVARAARQHDYAWVVAPECDGLL
FT                   LRFHDAVGTVRWLGCAKEAIRVASSKSATAACLAAHGIATTPALEPGGPAAQHDGRWVV
FT                   KPDDGAGGLDTIVYERFADACADYDARAAAGRNPVLQAWVDGEPLSLSLICRGDATKLL
FT                   SINRQQIGLSGGDASGEVARIVEFDGVLVDQIDQHSDMGRALDTLAHRVARAIPGLRGF
FT                   VGIDVVWHPQRGPVVIEVNPRLTVAYAGLSAVRGSGLTRALLAAHGVRLERCGAARANP
FT                   PTYEVRP"
FT                   /protein_id="YP_003606758.1"
FT   misc_feature    16681..17214
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="BC1002_3202"
FT   gene            17343..18452
FT                   /db_xref="GeneID:9112506"
FT                   /locus_tag="BC1002_3203"
FT   CDS_pept        17343..18452
FT                   /locus_tag="BC1002_3203"
FT                   /gene_family="HOG000223720" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03123"
FT                   /codon_start="1"
FT                   /product="H4MPT-linked C1 transfer pathway protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2458 tetrahydromethanopterin
FT                   biosynthesis protein, putative hydrolase; TIGRFAM:
FT                   H4MPT-linked C1 transfer pathway protein; PFAM:
FT                   Hydantoinase/oxoprolinase"
FT                   /db_xref="GI:295698866"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="GeneID:9112506"
FT                   /translation="MSPARANPAVRFGWDVGGAHVKVSLVDDSDAVLDVVQWPCPLWQG
FT                   LDHLHRTIDLVFERWPQARTDAAQHAVTMTGEMVDLFADRAEGVRAIVAALAQRLGSSL
FT                   RFYAGDAGWLAAGDCAAGWRHVASANWLATASWVATRMPNALLIDIGSTTTDIIPIVDG
FT                   RVVARAATDAGRLASGELVYHGVVRTPLCGVAHRIEFGGAMRNVMNEWFATTADVYRLT
FT                   GELDPLHDVQPSADQGPKTQAASRARLARMIGHDAHDASDLEWLHFARRWRALQVREIG
FT                   ANLMRVIAAQPALAAAPLVGAGCGRFLVAALARDEARGYIDFGALAGVPDASAAWAATC
FT                   APSVAVALLAAREPRAQRRSARGVAARAA"
FT                   /protein_id="YP_003606759.1"
FT   misc_feature    17379..18311
FT                   /note="Hydantoinase/oxoprolinase; Region: Hydantoinase_A;
FT                   cl00668"
FT                   /db_xref="CDD:163895"
FT                   /locus_tag="BC1002_3203"
FT   gene            18597..19187
FT                   /db_xref="GeneID:9112507"
FT                   /locus_tag="BC1002_3204"
FT   CDS_pept        18597..19187
FT                   /locus_tag="BC1002_3204"
FT                   /gene_family="HOG000227210" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2457"
FT                   /codon_start="1"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2457 tetrahydromethanopterin
FT                   biosynthesis protein, putative kinase"
FT                   /db_xref="GI:295698867"
FT                   /db_xref="GeneID:9112507"
FT                   /translation="MWVVKIGGSLSHDPALRHWLSELCEVGGGRVVIVPGGGDFADKVR
FT                   QYQGEWNFDDLAAHNMCLLAMTQYALLMQGVSPELVIASSEAKIRRTLRDGHVAVWVPT
FT                   ALMRDTPDTMSNWDTTSDSLAAWLSTMLNAERLIVVKSCPIAADDPLETLAASGVVDRK
FT                   FVDYVTDANYVVELLDKSNVALMRDRLLNIPVM"
FT                   /protein_id="YP_003606760.1"
FT   misc_feature    18603..19094
FT                   /note="Amino Acid Kinases (AAK) superfamily, catalytic
FT                   domain; present in such enzymes like N-acetylglutamate
FT                   kinase (NAGK), carbamate kinase (CK), aspartokinase (AK),
FT                   glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK
FT                   superfamily includes kinases that...; Region: AAK; cl00452"
FT                   /db_xref="CDD:174211"
FT                   /locus_tag="BC1002_3204"
FT   misc_feature    order(18609..18611,18615..18623,19020..19025)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:58599"
FT                   /locus_tag="BC1002_3204"
FT   misc_feature    order(18609..18611,18615..18620,18693..18701,18954..18962)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:58599"
FT                   /locus_tag="BC1002_3204"
FT   gene            complement(19195..19938)
FT                   /db_xref="GeneID:9112508"
FT                   /locus_tag="BC1002_3205"
FT   CDS_pept        complement(19195..19938)
FT                   /locus_tag="BC1002_3205"
FT                   /gene_family="HOG000224625" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04476"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF556"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF556; KEGG:
FT                   bxe:Bxe_B2456 hypothetical protein"
FT                   /db_xref="GI:295698868"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="GeneID:9112508"
FT                   /translation="MTALLASVRSDEEAFDAARAGAELIDLKEPDDGALGGLSIGAITN
FT                   IARQLRARYPVKPISAAIGDVPADAFDEIAARVIDVSDAGVDYVKVGVARGPAARRCIE
FT                   QLANLPATVVPVLLCDGGMDDELVSHTAALGFAGLMFDTASKDGGTLFDHVDVDSLARW
FT                   LRLARQRGAMVGIAGALGWAQLPQIRALAPDVAGFRTALCADGRRSRLDPERVAQWASA
FT                   LHRPAGEIRVDGGAPLPDSTGATRL"
FT                   /protein_id="YP_003606761.1"
FT   misc_feature    complement(19252..19935)
FT                   /note="Protein of unknown function (DUF556); Region:
FT                   DUF556; cl00822"
FT                   /db_xref="CDD:174408"
FT                   /locus_tag="BC1002_3205"
FT   gene            complement(19962..20561)
FT                   /db_xref="GeneID:9112509"
FT                   /locus_tag="BC1002_3206"
FT   CDS_pept        complement(19962..20561)
FT                   /locus_tag="BC1002_3206"
FT                   /gene_family="HOG000236836" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04289"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF447"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF447; KEGG:
FT                   bxe:Bxe_B2455 hypothetical protein"
FT                   /db_xref="GI:295698869"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR018054"
FT                   /db_xref="GeneID:9112509"
FT                   /translation="MIHETIVTTAACDGRPHIAPMGARYEGERIILSPFRPSVTLDNIV
FT                   ATRSAVLNFTTDVRVFAGCVTHCATDWPTVAASRVASVRLTESLAHAELELDELRDDKE
FT                   RPVLVMKCVHRENHAPFAGFNRAQSAVVEGAILVSRLFMLPADKVDREMAYLQIAIDKT
FT                   AGDNERTAWGWLVAAVARYRATLEEAARQAVTSAHH"
FT                   /protein_id="YP_003606762.1"
FT   misc_feature    complement(20037..20555)
FT                   /note="Protein of unknown function (DUF447); Region:
FT                   DUF447; cl01035"
FT                   /db_xref="CDD:154160"
FT                   /locus_tag="BC1002_3206"
FT   gene            21231..22730
FT                   /db_xref="GeneID:9112510"
FT                   /locus_tag="BC1002_3207"
FT   CDS_pept        21231..22730
FT                   /locus_tag="BC1002_3207"
FT                   /gene_family="HOG000230831" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.39"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2453 ribulose bisophosphate
FT                   carboxylase; PFAM: ribulose bisphosphate carboxylase large
FT                   chain; Ribulose bisphosphate carboxylase, large
FT                   subunit-like"
FT                   /db_xref="GI:295698870"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR017444"
FT                   /db_xref="GeneID:9112510"
FT                   /translation="MNDFSQPPIQPEHQARDPHNPRERYAAGVMKYREMGYWQPDYEPK
FT                   ETDVIALFRITPQPGVEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVEPVP
FT                   ASRADEPQYFAYIAYELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKT
FT                   FQGPPTGIVVERERLDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENI
FT                   NSQAFMHWRDRFLFAMEAVSRAQAETGEVKGHYMNVTAGTMEDMYERAEFAKELGSCIV
FT                   MIDLVIGWTAIQSMSRWARKHDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDH
FT                   AHAGTAVGKLEGDPLSVQGYYNVCRDAHNAVDLSRGLFFDQPWAGLRKVMPVASGGIHA
FT                   GQMHQLLDLFGDDAILQFGGGTIGHPAGIQAGATANRVALEAMVKARNEGRDILREGPD
FT                   VLEAAARWCTPLKQALDTWRDVTFNYASTDTPDFAATPTAA"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /protein_id="YP_003606763.1"
FT   misc_feature    21291..22688
FT                   /note="ribulose bisophosphate carboxylase; Reviewed;
FT                   Region: rbcL; PRK04208"
FT                   /db_xref="CDD:167753"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    21336..22688
FT                   /note="Ribulose bisphosphate carboxylase large chain, Form
FT                   I; Region: RuBisCO_large_I; cd08212"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    order(21402..21404,21447..21449,21453..21458,21462..21485,
FT                   21492..21494,21507..21509,21594..21608,21612..21614,
FT                   21618..21623,21630..21635,21639..21647,21651..21662,
FT                   21666..21674,21801..21815,21888..21893,21897..21911,
FT                   21915..21917,22005..22022,22035..22037,22080..22082,
FT                   22089..22103,22107..22112,22155..22157,22161..22166,
FT                   22170..22178,22182..22187,22194..22202,22266..22283,
FT                   22416..22424,22485..22490,22494..22505,22509..22514,
FT                   22659..22661,22668..22670,22674..22676,22680..22685)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    order(21447..21449,21462..21467,21645..21647,21795..21797,
FT                   21801..21803,21807..21809,21885..21890,22155..22160,
FT                   22254..22256,22275..22280,22410..22418,22482..22487)
FT                   /note="active site"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    order(21744..21746,21759..21761,21765..21779,21858..21866,
FT                   21954..21956,21963..21983,22050..22052,22065..22067,
FT                   22140..22142,22464..22466,22503..22508,22518..22520,
FT                   22527..22529,22536..22541,22548..22553,22560..22562,
FT                   22566..22574,22626..22628,22632..22634)
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    21879..21881
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   misc_feature    21885..21890
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173977"
FT                   /locus_tag="BC1002_3207"
FT   gene            22847..23275
FT                   /db_xref="GeneID:9112511"
FT                   /locus_tag="BC1002_3208"
FT   CDS_pept        22847..23275
FT                   /locus_tag="BC1002_3208"
FT                   /gene_family="HOG000141331" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.39"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2452 ribulose 1,5-bisphosphate
FT                   carboxylase small subunit; PFAM: ribulose bisphosphate
FT                   carboxylase small chain"
FT                   /db_xref="GI:295698871"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="GeneID:9112511"
FT                   /translation="MRITQGTFSFLPELTDEEIGLQIDYALRQGWACSVEFTDDPHPRN
FT                   TYWEMWGLPMFDLHDAAGVLQEVRACREARPQHYIKVNAFDSVRTFETMRLSFIVNRPD
FT                   VEPGFRLLRQDAQGRTQRYSMAGYACDRPAGERYGATG"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /protein_id="YP_003606764.1"
FT   misc_feature    22853..23155
FT                   /note="Ribulose bisphosphate carboxylase/oxygenase
FT                   (Rubisco), small subunit. Rubisco is a bifunctional enzyme
FT                   catalyzes the initial steps of two opposing metabolic
FT                   pathways: photosynthetic carbon fixation and the competing
FT                   process of photorespiration. Rubisco...; Region:
FT                   RuBisCO_small; cd03527"
FT                   /db_xref="CDD:58643"
FT                   /locus_tag="BC1002_3208"
FT   misc_feature    order(22853..22858,22862..22876,22880..22882,22886..22888,
FT                   22910..22912,22919..22921,22952..22954,22979..22987,
FT                   22991..22996,23069..23071,23114..23116,23120..23125)
FT                   /note="multimerization interface; other site"
FT                   /db_xref="CDD:58643"
FT                   /locus_tag="BC1002_3208"
FT   gene            23337..24332
FT                   /db_xref="GeneID:9112512"
FT                   /locus_tag="BC1002_3209"
FT   CDS_pept        23337..24332
FT                   /locus_tag="BC1002_3209"
FT                   /gene_family="HOG000244080" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02880"
FT                   /codon_start="1"
FT                   /product="CbbX protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CbbX protein; PFAM: AAA ATPase central
FT                   domain protein; KEGG: bxe:Bxe_B2451 CbbX-like protein,
FT                   putative AAA ATPase; SMART: AAA ATPase"
FT                   /db_xref="GI:295698872"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="GeneID:9112512"
FT                   /translation="MTDAAIVDALPASTAHSDDATPHIDLAALYRDSGIGDVLGELDRD
FT                   LVGLAPVKTRIREVAAHLLVERARASLGLAGGAPTLHMCFSGNPGTGKTTVALRMAEVL
FT                   HRLGYIRRNHLVSVTRDDLVGQYIGHTAPKTRDVLKRAMGGVLFIDEAYYLYRPENERD
FT                   YGQEAIEILLQTMENQRSDLVVILAGYASRMEVFFESNPGFRSRIAHHITFPDYEETEL
FT                   LEIAERMLGTMHYRFDAASRRAFADYLARRIRQPNFANARSVRNALDRARLRQANRLFA
FT                   SALQGGEPIDAATLTLIDAADVRASRVFDEPMQPSSPPPSTARAVTPPPG"
FT                   /protein_id="YP_003606765.1"
FT   misc_feature    23406..24263
FT                   /note="probable Rubsico expression protein CbbX; Region:
FT                   cbbX_cfxQ; TIGR02880"
FT                   /db_xref="CDD:131926"
FT                   /locus_tag="BC1002_3209"
FT   misc_feature    23580..23981
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3209"
FT   misc_feature    23595..23618
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3209"
FT   misc_feature    order(23598..23621,23784..23786,23910..23912)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3209"
FT   misc_feature    23772..23789
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3209"
FT   misc_feature    23955..23957
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3209"
FT   gene            24360..25463
FT                   /db_xref="GeneID:9112513"
FT                   /locus_tag="BC1002_3210"
FT   CDS_pept        24360..25463
FT                   /locus_tag="BC1002_3210"
FT                   /gene_family="HOG000191264" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /codon_start="1"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: bxe:Bxe_B2450
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="GI:295698873"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="GeneID:9112513"
FT                   /translation="MQDGRTTLSKFLIDTLDRPPCTDNARDTAGLSALLIDVAAAIKSI
FT                   SAMLTKGALGGNYGSAQTLNTHGEEQKKLDVSTNDIFVQQCEWDGLLAAMVSEEMEHVY
FT                   PIPPEYPRGEYLLAFDPLDGSSNIDINGVVGSIFSVLRTRDPAEDASSEAAFLRPGCEQ
FT                   VAAGYAVYGPSTMLVLSVGNGTHGFTLERDIGNFVLTHSNIRIPEETGEFAINASNERF
FT                   WEPPVRRYVQECKDGRSGCRARDFNMRWIASMVAEVHRILMRGGVFMYPRDSKTPAMEG
FT                   RLRLLYEANPMSFLVEQAGGLAITGRERILDVAPRALHGRVPVILGSKNEVERIARYHG
FT                   EYDRGEDKPFSSPLFGTRSLFLPDFTA"
FT                   /protein_id="YP_003606766.1"
FT   misc_feature    24429..25376
FT                   /note="Fructose-1,6-bisphosphatase, an enzyme that
FT                   catalyzes the hydrolysis of fructose-1,6-biphosphate  into
FT                   fructose-6-phosphate and is critical in gluconeogenesis
FT                   pathway. The alignment model also includes chloroplastic
FT                   FBPases and sedoheptulose-1,7-...; Region: FBPase; cd00354"
FT                   /db_xref="CDD:30130"
FT                   /locus_tag="BC1002_3210"
FT   misc_feature    order(24441..24443,24447..24455,24699..24704,24783..24785)
FT                   /note="AMP binding site; other site"
FT                   /db_xref="CDD:30130"
FT                   /locus_tag="BC1002_3210"
FT   misc_feature    order(24582..24584,24651..24656,24717..24719,24723..24725,
FT                   25221..25223)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:30130"
FT                   /locus_tag="BC1002_3210"
FT   misc_feature    order(24726..24728,24732..24737,25014..25016,25104..25109,
FT                   25119..25121,25167..25169,25203..25205)
FT                   /note="active site"
FT                   /db_xref="CDD:30130"
FT                   /locus_tag="BC1002_3210"
FT   gene            25530..26402
FT                   /db_xref="GeneID:9112514"
FT                   /locus_tag="BC1002_3211"
FT   CDS_pept        25530..26402
FT                   /locus_tag="BC1002_3211"
FT                   /gene_family="HOG000272991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.19"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2449 phosphoribulokinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="GI:295698874"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="GeneID:9112514"
FT                   /translation="MSVKHPIIAVTGSSGAGTTTVMKSFMHIFRREHINAQIVEGDAFH
FT                   RYDRNGMRAAMQERERDGVPNFSHFGPEANLLEELETLFTRYGENGSGQFRHYVHDAAE
FT                   ELLYKQDGGTFTPWEDVAANTDLMFYEGLHGAAVTDKVNIARHADLLIGVVPIINLEWI
FT                   QKLHRDQTMRGYTHEAVVDTILRRMPDYVNYICPQFSRTHVNFQRVPTVDTSNPFTARE
FT                   IPQPDESFVVIRFARPKGIDFQYLLTMLHDSFMSRPNVIVVPGGKMGLAMQLIFTPMIL
FT                   QLIDRRSRA"
FT                   /product="Phosphoribulokinase"
FT                   /protein_id="YP_003606767.1"
FT   misc_feature    25596..26381
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="BC1002_3211"
FT   gene            26459..28507
FT                   /db_xref="GeneID:9112515"
FT                   /locus_tag="BC1002_3212"
FT   CDS_pept        26459..28507
FT                   /locus_tag="BC1002_3212"
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /codon_start="1"
FT                   /EC_number="2.2.1.3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transketolase; KEGG: bxe:Bxe_B2448
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="GI:295698875"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="GeneID:9112515"
FT                   /translation="MSAVAHPLDAPATRPMADALRMLAIDAVEAAKSGHPGMPLGMAEI
FT                   AVALWDRHLKHSPRNPAWPDRDRFVLSNGHGSMLLYGLLHLTGYDLPIDELKRFRQLHS
FT                   KTPGHPEVGVTPGVETTTGPLGQGLANGVGMALAEALLAREFNRPGHRIVDHRTYVFAG
FT                   DGCLMEGISHEAASLAGTLKLDKLTVLYDDNGISIDGHVAQWFADDTPARFAAYGWHVV
FT                   REVDGHDVDAVDRALHAARATGRPTLICCRTVIGHGAPKAGTHDVHGAPLGADEVERTG
FT                   RALGWPHPPFEIPDEIRANFDASARGAAAEAQWRARFDAYRQHYPVEAAEFERRVQGRL
FT                   PPHWYDTVRALLRDADCAAESIATRKASQKAIGALARSLPELLGGSADLTGSNLTDWPG
FT                   TVDVRSDENGLRGGNYVHYGVREFGMSAVMNGIALHRGYLPFGGTFLTFSDYARNALRM
FT                   AALMKTRSVFVFTHDSIGLGEDGPTHQAVEHAASLRLIPGLDVWRPCDTVETAQAWVSA
FT                   VEREGPSCLLLSRQNLRFVTRSAVQIAAIARGGYVLRDWPDEEGQQQPARVVLIATGSE
FT                   VSLALDAIAPLAAAGIATRIVSMPSTTAFDRQPRAWRDAVLPPGVPRVAIEAGVRAFWR
FT                   QYVGLDGGVVGIDTFGESAPAAALFEHFGLNAQAVIDAARRVADRAR"
FT                   /product="transketolase"
FT                   /protein_id="YP_003606768.1"
FT   misc_feature    26483..28456
FT                   /note="transketolase; Reviewed; Region: PRK05899"
FT                   /db_xref="CDD:168290"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    26510..27298
FT                   /note="Thiamine pyrophosphate (TPP) family, Transketolase
FT                   (TK) subfamily, TPP-binding module; TK catalyzes the
FT                   transfer of a two-carbon unit from ketose phosphates to
FT                   aldose phosphates. In heterotrophic organisms, TK provides
FT                   a link between glycolysis and the...; Region: TPP_TK;
FT                   cd02012"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    order(26681..26683,26825..26827,26831..26833,26948..26953,
FT                   26963..26965,27038..27040,27044..27046,27050..27052,
FT                   27260..27262)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    order(26756..26758,26780..26785,26789..26791,26828..26833,
FT                   26837..26839,26957..26968,26975..26980,26987..26989,
FT                   26999..27001,27047..27052,27095..27097)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    27554..28048
FT                   /note="Pyrimidine (PYR) binding domain of
FT                   1-deoxy-D-xylulose-5-phosphate synthase (DXS),
FT                   transketolase (TK), and related proteins; Region:
FT                   TPP_PYR_DXS_TK_like; cd07033"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    order(27596..27598,27602..27604,27620..27622,27698..27700,
FT                   27707..27709,27713..27730,27737..27742,27746..27754,
FT                   27809..27811,27818..27823,27896..27898,27905..27907,
FT                   27953..27958,28019..28021)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    order(27620..27622,27707..27709,27716..27724,27806..27811,
FT                   27815..27817,27896..27898,27902..27904,27929..27934,
FT                   27938..27943,27947..27949)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    order(27716..27718,27722..27724,27800..27802,27809..27811)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="BC1002_3212"
FT   misc_feature    28106..28456
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="BC1002_3212"
FT   gene            28552..29589
FT                   /db_xref="GeneID:9112516"
FT                   /locus_tag="BC1002_3213"
FT   CDS_pept        28552..29589
FT                   /locus_tag="BC1002_3213"
FT                   /gene_family="HOG000227792" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /codon_start="1"
FT                   /EC_number="4.1.2.13"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; ketose-bisphosphate aldolase; KEGG:
FT                   bxe:Bxe_B2447 fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="GI:295698876"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:9112516"
FT                   /translation="MAFITLRQLLDHAAEHDYGVPAFNVNNMEQIHAIMRAAEATDSPV
FT                   ILQASAGARKYAGEPYLRHLVLAALEAHPDIPLVLHQDHGASPAVCQQAIRSGFTSVMM
FT                   DGSLLPDQKTPAAYDYNVEVSRRVVDAAHAVGVSVEGELGCLGSLETGTAGEEDGVGAE
FT                   GKLTREHLLTDPDEARRFVEATGVDALAIAIGTSHGAYKFSREPTGDILAIDRIASIHS
FT                   RIPDTHLVMHGSSSVPQEWLAVIREYGGEIPTTYGVPVDEIRRGIAHGVRKVNIDTDIR
FT                   LAMSGAMRKSLANARSEFDPRAALKAATAAASAICIERFEAFGCAGQAARIKPLPLDTM
FT                   ASRYH"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /protein_id="YP_003606769.1"
FT   misc_feature    28567..29538
FT                   /note="hypothetical protein; Provisional; Region: PRK08185"
FT                   /db_xref="CDD:169264"
FT                   /locus_tag="BC1002_3213"
FT   misc_feature    28567..29532
FT                   /note="Tagatose-1,6-bisphosphate (TBP) aldolase and related
FT                   Type B Class II aldolases. TBP aldolase is a tetrameric
FT                   class II aldolase that catalyzes the reversible
FT                   condensation of dihydroxyacetone phosphate with
FT                   glyceraldehyde 3-phsophate to produce tagatose...; Region:
FT                   TBP_aldolase_IIB; cd00947"
FT                   /db_xref="CDD:29573"
FT                   /locus_tag="BC1002_3213"
FT   misc_feature    order(28630..28638,28645..28647,28705..28707,28714..28722,
FT                   28732..28734,28744..28746,28753..28758,29020..29022,
FT                   29383..29388,29392..29397,29404..29406,29416..29418,
FT                   29425..29427)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29573"
FT                   /locus_tag="BC1002_3213"
FT   misc_feature    order(28798..28803,29140..29148,29152..29154,29245..29250,
FT                   29254..29256,29374..29376,29380..29385)
FT                   /note="active site"
FT                   /db_xref="CDD:29573"
FT                   /locus_tag="BC1002_3213"
FT   misc_feature    order(28801..28803,29143..29145,29245..29247)
FT                   /note="zinc binding site; other site"
FT                   /db_xref="CDD:29573"
FT                   /locus_tag="BC1002_3213"
FT   misc_feature    order(29140..29142,29146..29148,29152..29154,29248..29250,
FT                   29254..29256)
FT                   /note="Na+ binding site; other site"
FT                   /db_xref="CDD:29573"
FT                   /locus_tag="BC1002_3213"
FT   gene            29612..30319
FT                   /db_xref="GeneID:9112517"
FT                   /locus_tag="BC1002_3214"
FT   CDS_pept        29612..30319
FT                   /locus_tag="BC1002_3214"
FT                   /gene_family="HOG000259347" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /codon_start="1"
FT                   /EC_number="5.1.3.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   bxe:Bxe_B2446 ribulose-5-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="GI:295698877"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:9112517"
FT                   /translation="MREFLIAPSLLSADFARLADEIRDVTVAGADWIHLDVMDNHYVPN
FT                   LTVGPLVCSAIRPYTSLPFDVHLMTTPVDPLVSAFAEAGANLISFHPEATLHVHRTIEL
FT                   IRSHGARAGLALNPATPLTVLDHVLEMLDVVLVMSVNPGFGGQAFITETLDKLRLLRER
FT                   VETTMQRTGRPLLIEVDGGVKASNIARVATAGADVFVAGSAVFGASDRAQAIRGMRGEL
FT                   ATVDEHAGVAAMQ"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /protein_id="YP_003606770.1"
FT   misc_feature    29624..30268
FT                   /note="Ribulose-5-phosphate 3-epimerase (RPE). This enzyme
FT                   catalyses the interconversion of D-ribulose 5-phosphate
FT                   (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin
FT                   cycle (reductive pentose phosphate pathway) in chloroplasts
FT                   and in the oxidative...; Region: RPE; cd00429"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="BC1002_3214"
FT   misc_feature    order(29636..29638,29642..29644,29717..29719,29816..29818,
FT                   30035..30040,30044..30049,30149..30151,30155..30157,
FT                   30215..30220)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="BC1002_3214"
FT   misc_feature    order(29657..29659,29666..29668,29726..29728,29732..29737,
FT                   29741..29743,29747..29758,29825..29827,29837..29839,
FT                   29900..29902,29906..29911,29963..29965,29972..29974,
FT                   29978..29980,29990..29992,30032..30034,30059..30061,
FT                   30065..30067,30077..30079)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="BC1002_3214"
FT   misc_feature    order(29711..29713,29717..29719,29810..29812,30149..30151)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="BC1002_3214"
FT   gene            complement(30333..31715)
FT                   /db_xref="GeneID:9112518"
FT                   /locus_tag="BC1002_3215"
FT   CDS_pept        complement(30333..31715)
FT                   /locus_tag="BC1002_3215"
FT                   /gene_family="HOG000226637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00809"
FT                   /codon_start="1"
FT                   /product="dihydropteroate synthase DHPS"
FT                   /transl_table="11"
FT                   /note="PFAM: dihydropteroate synthase DHPS; KEGG:
FT                   bxe:Bxe_B2441 tetrahydromethanopterin biosynthesis protein"
FT                   /db_xref="GI:295698878"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="GeneID:9112518"
FT                   /translation="MDHILFLTGRLAEPSLRRVLDGMAPTPFSWEVREIGLQVAALMTA
FT                   DMIQRRLPTPLAAHRVIVPGRCRGDLDALSAHFGVPFERGPEEVKDLPQFFGHKAKPFD
FT                   LSRYDTEIFAEIVDAPRLDLDGIAARAREYAAQGADVIDIGCLPDTPFPHLEDAVRRLK
FT                   AEGYRVSVDSMRNDELLRGGRAGADYLMSLNLDTLWIADEVPSTPILVAREPADTASLD
FT                   AAIEALSARGRAFLADPILDPIPFGLATSIARYVRLRERYPDIAIMMGIGNVTELTEAD
FT                   TSGINAVLLGMAAELRVGAVLTTSVSLHARRALREADVARRVMHAARDAQVLPKGISTE
FT                   LATVHAKRPFPYSAEEIDEFARAVRDPNFRVQISADGIHVYNRDGHRRGDDPFALYPQL
FT                   NLETDGGHAFYMGVQLARAEIAWRLGKRFDQDQPLDWGCAVDRPEEDLSVWCGPGETMK
FT                   KR"
FT                   /protein_id="YP_003606771.1"
FT   misc_feature    complement(30414..31706)
FT                   /note="dihydropteroate synthase-related protein; Region:
FT                   TIGR00284"
FT                   /db_xref="CDD:161804"
FT                   /locus_tag="BC1002_3215"
FT   misc_feature    complement(30765..31355)
FT                   /note="Pterin binding enzymes. This family includes
FT                   dihydropteroate synthase (DHPS) and cobalamin-dependent
FT                   methyltransferases such as methyltetrahydrofolate,
FT                   corrinoid iron-sulfur protein methyltransferase (MeTr) and
FT                   methionine synthase (MetH).  DHPS, a...; Region:
FT                   Pterin_binding; cl00219"
FT                   /db_xref="CDD:174042"
FT                   /locus_tag="BC1002_3215"
FT   misc_feature    complement(order(30789..30791,30795..30797,30894..30896,
FT                   30906..30908,31002..31004,31137..31139,31143..31145,
FT                   31200..31202))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29544"
FT                   /locus_tag="BC1002_3215"
FT   misc_feature    complement(30423..>31007)
FT                   /note="Pterin binding enzymes. This family includes
FT                   dihydropteroate synthase (DHPS) and cobalamin-dependent
FT                   methyltransferases such as methyltetrahydrofolate,
FT                   corrinoid iron-sulfur protein methyltransferase (MeTr) and
FT                   methionine synthase (MetH).  DHPS, a...; Region:
FT                   Pterin_binding; cl00219"
FT                   /db_xref="CDD:174042"
FT                   /locus_tag="BC1002_3215"
FT   misc_feature    complement(order(30765..30770,30810..30812,30822..30824,
FT                   30834..30836,30954..30959,30969..30971))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29544"
FT                   /locus_tag="BC1002_3215"
FT   misc_feature    complement(30894..30902)
FT                   /note="inhibitor binding site; inhibition site"
FT                   /db_xref="CDD:29544"
FT                   /locus_tag="BC1002_3215"
FT   gene            complement(31694..32314)
FT                   /db_xref="GeneID:9112519"
FT                   /locus_tag="BC1002_3216"
FT   CDS_pept        complement(31694..32314)
FT                   /locus_tag="BC1002_3216"
FT                   /gene_family="HOG000224057" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02441"
FT                   /codon_start="1"
FT                   /product="flavoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: flavoprotein; KEGG: bxe:Bxe_B2440 putative
FT                   dihydromethanopterin reductase (AfpA)"
FT                   /db_xref="GI:295698879"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="GeneID:9112519"
FT                   /translation="MTQSSANESAPKAARDLTAFKPDARFAWCVTGSGHMLEESIALAR
FT                   RLPRVDLFLSAAAEEVLPLYGWSLDKLREQFRVLRDNSASGVPVGMLYHGVYHTVVIAP
FT                   ATSNTVAKCAYGISDTLPTNMYAQAGKQCIPGIVFACDTEPSVITHSPDEWVELRPRAI
FT                   ELDNVERLARFEYTTLARSLDELEAALANRLATLDLAWTTSSS"
FT                   /protein_id="YP_003606772.1"
FT   misc_feature    complement(31754..32257)
FT                   /note="Archaeal flavoproteins [Energy production and
FT                   conversion]; Region: COG1036"
FT                   /db_xref="CDD:31239"
FT                   /locus_tag="BC1002_3216"
FT   misc_feature    complement(31922..32242)
FT                   /note="Flavoprotein; Region: Flavoprotein; cl08021"
FT                   /db_xref="CDD:174911"
FT                   /locus_tag="BC1002_3216"
FT   gene            complement(32311..34374)
FT                   /db_xref="GeneID:9112520"
FT                   /locus_tag="BC1002_3217"
FT   CDS_pept        complement(32311..34374)
FT                   /locus_tag="BC1002_3217"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2439 sigma-54 dependent
FT                   trancsriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; GAF domain protein;
FT                   helix-turn-helix Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:295698880"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR020441"
FT                   /db_xref="GeneID:9112520"
FT                   /translation="MSLLADSSTHVREVLNVVNHQLTTRPTSEPVAQSWTRCINEFQLD
FT                   PARFVPPPVLTEYELSARREALGDLIACSKLEMTTLYQQLADPELAVVLVDSGGVIVHQ
FT                   VSSVPFAEAVAVDGFRVGALWSEREAGTNGMGTCLAERDCIAVCQHEHFYPRYTSLTCS
FT                   AAPIFDDGGEIAGVLDVTSRSKLLQQHSLVLVGMSRQMIENRLLDARYRHANMIHFHSR
FT                   PEFVGTLHGGKLAVGDDSTVLAANRSALFQLGFRSLSELRGRRIEEAFNASLEDMIARS
FT                   IRGSFHPVTVYSANATNRFFLVAQTPQNGTGRVTRVIVTDSAIRSSTAEKHEKHDKHAP
FT                   VPKLDEIAHLEFGDPRMASQIQLAARVIQRKIPIVLRGQTGTGKEVFAQALHSISPHAD
FT                   GPFVPVNCASLPENLIESELFGYRAGAFTGAQREGRRGKIVQANGGTLFLDEIGDMPLV
FT                   LQARLLRVIEEHEVTPLGAETTVKVNFQLISASHRNLLELVQSGQFREDLYYRLKGVEL
FT                   NLPALRERVDKLPLIHHLLANETDDPPELTPEAEYALLTYAWPGNIRQLRHVLQMAIAL
FT                   SDGEPIRCEHLPPEVTQRTSAVDLPTALRLANADMDGQLADEADISSLNAIQLNERETV
FT                   LSLLDEHRWNVSNVAKALGISRNTLYRKMRRLHIRLSHEGSPPDGMPLDLDA"
FT                   /protein_id="YP_003606773.1"
FT   misc_feature    complement(32365..34362)
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(33823..34170)
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(32839..33306)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(33220..33243)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(order(32899..32901,33025..33027,33217..33240))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(33022..33039)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(32842..32844)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3217"
FT   misc_feature    complement(32374..32484)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="BC1002_3217"
FT   gene            34762..35268
FT                   /db_xref="GeneID:9112521"
FT                   /locus_tag="BC1002_3218"
FT   CDS_pept        34762..35268
FT                   /locus_tag="BC1002_3218"
FT                   /gene_family="HOG000217627" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02152"
FT                   /codon_start="1"
FT                   /product="dihydroneopterin aldolase"
FT                   /transl_table="11"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bxe:Bxe_B2438
FT                   dihydroneopterin aldolase"
FT                   /db_xref="GI:295698881"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="GeneID:9112521"
FT                   /translation="MDRIDTVRLAAFSSLGADPGSQAGALPERLDIVFIENFIGQTVIG
FT                   IDSSELHVAQPVRVNLAIGVPAIRACATDRIEDTVNYAAVREALLELFASHRVRLLEAL
FT                   AETIAQLLIADFGAHWVRVSLAKPAKFADLAAVGVQIERRRGDGPATSVGLACYASLGE
FT                   GLVPN"
FT                   /protein_id="YP_003606774.1"
FT   misc_feature    34852..35193
FT                   /note="Tunnelling fold (T-fold). The five known T-folds are
FT                   found in five different enzymes with different functions:
FT                   dihydroneopterin-triphosphate epimerase (DHNTPE),
FT                   dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I
FT                   (GTPCH-1),  6-pyrovoyl...; Region: TFold; cl00263"
FT                   /db_xref="CDD:174076"
FT                   /locus_tag="BC1002_3218"
FT   misc_feature    order(34924..34926,34930..34932,35134..35136,35182..35184)
FT                   /note="active site"
FT                   /db_xref="CDD:29764"
FT                   /locus_tag="BC1002_3218"
FT   gene            complement(35316..35693)
FT                   /db_xref="GeneID:9112522"
FT                   /locus_tag="BC1002_3219"
FT   CDS_pept        complement(35316..35693)
FT                   /locus_tag="BC1002_3219"
FT                   /gene_family="HOG000142783" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2437"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2437 hypothetical protein"
FT                   /db_xref="GI:295698882"
FT                   /db_xref="GeneID:9112522"
FT                   /translation="MTTRCRALLAFTTLMLAAPLAWAAGYNYPTEGRVEYVLSCMDDNG
FT                   HDFANVYKCSCVIDKMAASLPYDEFVDQSTFSKYATLGGEGGAEFRVDHAKAQTKKFRA
FT                   LQTSAYQACGLGPQKTSTVAK"
FT                   /protein_id="YP_003606775.1"
FT   gene            complement(35831..36340)
FT                   /db_xref="GeneID:9112523"
FT                   /locus_tag="BC1002_3220"
FT   CDS_pept        complement(35831..36340)
FT                   /locus_tag="BC1002_3220"
FT                   /gene_family="HOG000221499" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03126"
FT                   /codon_start="1"
FT                   /product="formaldehyde-activating enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2436 formaldehyde-activating protein;
FT                   TIGRFAM: formaldehyde-activating enzyme; PFAM:
FT                   Formaldehyde-activating enzyme (Fae)"
FT                   /db_xref="GI:295698883"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="GeneID:9112523"
FT                   /translation="MAKINRVMIGESLVGDGNEVAHIDLLIGPRGSAAETAFCNALTNN
FT                   KDGFTSLLAVVAPNLITKPNTILFNKVTIKGAKQAVQMFGPAQHAVALAVADSVEDGTI
FT                   PQEEADDLFLCVGVFIHWQAEDDKKIQQFNYQATREAIKRAVSGEPTASEVVAKKGSVA
FT                   HPFAPN"
FT                   /protein_id="YP_003606776.1"
FT   misc_feature    complement(35837..36316)
FT                   /note="Formaldehyde-activating enzyme (Fae); Region: Fae;
FT                   cl00774"
FT                   /db_xref="CDD:140919"
FT                   /locus_tag="BC1002_3220"
FT   gene            complement(36525..37427)
FT                   /db_xref="GeneID:9112524"
FT                   /locus_tag="BC1002_3221"
FT   CDS_pept        complement(36525..37427)
FT                   /locus_tag="BC1002_3221"
FT                   /gene_family="HOG000226894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01874"
FT                   /codon_start="1"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /transl_table="11"
FT                   /note="PFAM: triphosphoribosyl-dephospho-CoA protein; KEGG:
FT                   bxe:Bxe_B2435 putative triphosphoribosyl-dephospho-CoA
FT                   synthetase"
FT                   /db_xref="GI:295698884"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="GeneID:9112524"
FT                   /translation="MPGTHPISVEHARAAFLEACALDVTTPKPGNVSIQSPGHGMHAAQ
FT                   FLASADASLDALFARGARVGQRILDAVTRTRAAVGCNTNLGIVLLLAPLAATLDETGER
FT                   PLTAQAWRAAVGDVLSRLDVEDARLAYRAIALANPGGLGDAPEQSVHAPPTIGLRDAMR
FT                   LASERDSIARQYANGFADLFDTGLAACFEASTPAPEPAPVNRGEIAMLNVFLAFLGGWP
FT                   DSHIVRKHGLALAQSVTLVAREQHARWRQTRPAARRSASDPQLDAWDVELKARAINPGT
FT                   SGDLAVATLFVARCVQGRG"
FT                   /protein_id="YP_003606777.1"
FT   misc_feature    complement(36546..37244)
FT                   /note="ATP:dephospho-CoA triphosphoribosyl transferase;
FT                   Region: CitG; cl00768"
FT                   /db_xref="CDD:174382"
FT                   /locus_tag="BC1002_3221"
FT   gene            complement(37433..38431)
FT                   /db_xref="GeneID:9112525"
FT                   /locus_tag="BC1002_3222"
FT   CDS_pept        complement(37433..38431)
FT                   /locus_tag="BC1002_3222"
FT                   /gene_family="HOG000228553" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00768"
FT                   /codon_start="1"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2434 SSU ribosomal protein S6P
FT                   modification protein; TIGRFAM: alpha-L-glutamate ligase,
FT                   RimK family; PFAM: RimK domain protein ATP-grasp"
FT                   /db_xref="GI:295698885"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="GeneID:9112525"
FT                   /translation="MMITSGLRIAIMSDETGWHTGRLKKAFRARGAEARCVDLADCRID
FT                   TTWLPHGLVIPGFGRTLPDAVFVRGIAGGTFEQVTLRLGILHALRESGVPVYNDARAIE
FT                   RSVDKSMTSFLLHRAGVPTPATWAVESAAFAQRVLMREAAAGRQVVLKPLFGSQGHGLK
FT                   RLGARGGLLAPLPSLARYRQVAYLQRFVASSGPGFDWRVLVIGGKAVAAMRRSGGKGWI
FT                   HNVAQGARCEAAELTVPLAQTAVRATAALGLDYAGVDLIPNPDDAALPLVLEVNGVAAW
FT                   RGLQSVVPLDVAAALVDDLLDRKLAAQRRANRQDEQAASAGLPEPSPQRRA"
FT                   /protein_id="YP_003606778.1"
FT   misc_feature    complement(37580..38410)
FT                   /note="alpha-L-glutamate ligases, RimK family; Region:
FT                   rimK_fam; TIGR00768"
FT                   /db_xref="CDD:162031"
FT                   /locus_tag="BC1002_3222"
FT   misc_feature    complement(37604..38110)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="BC1002_3222"
FT   gene            complement(38428..39465)
FT                   /db_xref="GeneID:9112526"
FT                   /locus_tag="BC1002_3223"
FT   CDS_pept        complement(38428..39465)
FT                   /locus_tag="BC1002_3223"
FT                   /gene_family="HOG000224079" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03120"
FT                   /codon_start="1"
FT                   /EC_number="3.5.4.27"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methenyltetrahydromethanopterin
FT                   cyclohydrolase; KEGG: bxe:Bxe_B2433
FT                   N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase;
FT                   PFAM: Methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="GI:295698886"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="GeneID:9112526"
FT                   /translation="MNPTMPASTPTEPPPPAAPPSVNALSERLVTRLVDQAAQLGVALT
FT                   RTPAGTMIADAGVDARGSLDAGVLIARICMGGLGSVAVRGNFDAAPLWPTMLEVSTSAP
FT                   VLACLGSQYAGWSLSATKEQTGGKKFFSLGSGPARALAVKEPLFDELGYRDRHERGALV
FT                   LEVDRLPPQVVIDKVLHDCGLAPEHLTLIVTPTHSVAGTVQVVARVVEVALHKVHVLGV
FT                   PLDEIVAGTGSAPLPPPAPDGIQAMGRTNDAILYGGRVHLTVQHDEIARRLADTLPSAN
FT                   SRDYGRPFADVFTAVNFDFYQIDPALFAPAEVWVSSLESGATYHGGRLDGGLLRKQWGG
FT                   EPVAR"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /protein_id="YP_003606779.1"
FT   misc_feature    complement(38452..39405)
FT                   /note="Methenyltetrahydromethanopterin (methenyl-H4MPT)
FT                   cyclohydrolase (MCH). MCH is a cytoplasmic enzyme that has
FT                   been identified in methanogenic archaea, sulfate- reducing
FT                   archaea, and methylotrophic bacteria.  It catalyzes the
FT                   reversible formation of N(5)...; Region: MCH; cd00545"
FT                   /db_xref="CDD:29640"
FT                   /locus_tag="BC1002_3223"
FT   misc_feature    complement(order(38749..38751,38869..38874,39181..39183,
FT                   39217..39219,39262..39264,39274..39276))
FT                   /note="trimer interface I; other site"
FT                   /db_xref="CDD:29640"
FT                   /locus_tag="BC1002_3223"
FT   misc_feature    complement(order(38563..38568,38587..38589,38599..38601,
FT                   38701..38703,38725..38727,38821..38823,38833..38835,
FT                   38842..38844,39061..39063))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:29640"
FT                   /locus_tag="BC1002_3223"
FT   misc_feature    complement(order(38512..38514,38683..38685,38773..38775,
FT                   38779..38781))
FT                   /note="trimer interface II; other site"
FT                   /db_xref="CDD:29640"
FT                   /locus_tag="BC1002_3223"
FT   gene            complement(39431..40651)
FT                   /db_xref="GeneID:9112527"
FT                   /locus_tag="BC1002_3224"
FT   CDS_pept        complement(39431..40651)
FT                   /locus_tag="BC1002_3224"
FT                   /gene_family="HOG000236835" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF201"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   bxe:Bxe_B2432 hypothetical protein"
FT                   /db_xref="GI:295698887"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="GeneID:9112527"
FT                   /translation="MKPHRPLMHAPIVAVVGQSARLLAQSAARAGLHVAALDIFGDCDT
FT                   REAAELWFDIGRSDGALGIDRARLVDALARVARLPRLLGWIGGSGLEALMPDLCREPGL
FT                   PRFLGNDADAVAAVREPRRFFALLDALRIGHPAVSFERPATAGGWLFKQADGCGGTHIQ
FT                   AADSFDLTSASAHGYFQRLGQGRSLSALFIGAHGGAHLIGFAEQLTCAIGDLRFVHAGS
FT                   FGPIDLSPAFVAHVQQALDALCANTGLVGINSCDFLSDGASFDVLEINPRPSSTMALYE
FT                   TASPDAWPAGLLACHLDACRHGRAPSAASLALARAPRWRAGQRVLFAQRPFNVSAAFSD
FT                   ACLRDPQCRDVPMPGTRIDVGQPVCTLLVRAASVDGVRTALDAQHERVVQRIETCDEPD
FT                   HACLHAH"
FT                   /protein_id="YP_003606780.1"
FT   misc_feature    complement(39458..>40396)
FT                   /note="Predicted ATP-dependent carboligase related to
FT                   biotin carboxylase [General function prediction only];
FT                   Region: COG2232"
FT                   /db_xref="CDD:32413"
FT                   /locus_tag="BC1002_3224"
FT   misc_feature    complement(39824..40270)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="BC1002_3224"
FT   gene            complement(40663..41589)
FT                   /db_xref="GeneID:9112528"
FT                   /locus_tag="BC1002_3225"
FT   CDS_pept        complement(40663..41589)
FT                   /locus_tag="BC1002_3225"
FT                   /gene_family="HOG000236834" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09176"
FT                   /codon_start="1"
FT                   /product="Methylene-tetrahydromethanopterin dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Methylene-tetrahydromethanopterin
FT                   dehydrogenase; KEGG: bxe:Bxe_B2431
FT                   methylene-tetrahydromethanopterin dehydrogenase(NAD+/NADP+)
FT                   (MtdB)"
FT                   /db_xref="GI:295698888"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR015259"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112528"
FT                   /translation="MSETIERPYILHMFTATPQMSPFDVNMAADAGYQVIVPYCNVEAG
FT                   MVANLTQDAIFSRGPKGVSRTGIFIGGRDVMQAVDMLDTARKAMVPPFEVSVFADPSGS
FT                   YTTAAALVALVERHLGKQHGVELGGKRVLILGGAGAVGRIAAAIAASRGADVTIASHTD
FT                   RSRALGASAELNERFGIVTSGIGTATPEELRGALADAEIVLATAVAGVQVVGRDDLEHA
FT                   KRLLVAADVNAVPPEGIAGVNVMNDGKPIDGVPNAGAVGIGALAIGNVKYQVEHRLFMR
FT                   MRTGGKPVYLGFPEAYDEARAVAAGLG"
FT                   /protein_id="YP_003606781.1"
FT   misc_feature    complement(41284..41526)
FT                   /note="Methylene-tetrahydromethanopterin dehydrogenase,
FT                   N-terminal; Region: Mpt_N; pfam09176"
FT                   /db_xref="CDD:117730"
FT                   /locus_tag="BC1002_3225"
FT   misc_feature    complement(<40831..41289)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3225"
FT   misc_feature    complement(order(40897..40899,40969..40974,41107..41112,
FT                   41167..41175))
FT                   /note="NAD(P) binding pocket; other site"
FT                   /db_xref="CDD:133449"
FT                   /locus_tag="BC1002_3225"
FT   gene            complement(41693..42718)
FT                   /db_xref="GeneID:9112529"
FT                   /locus_tag="BC1002_3226"
FT   CDS_pept        complement(41693..42718)
FT                   /locus_tag="BC1002_3226"
FT                   /gene_family="HOG000232305" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00144"
FT                   /codon_start="1"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2430 beta-ribofuranosylaminobenzene
FT                   5'-phosphate synthase; TIGRFAM:
FT                   beta-ribofuranosylaminobenzene 5'-phosphate synthase
FT                   family; PFAM: GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="GI:295698889"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:9112529"
FT                   /translation="MPLQLRRLPPRSPITIDAPARLHLGFLDPNASLGRAFGSLGLVID
FT                   THGTRIQARLAEREQIGGLASEAERERIALSLARLQAAYGPASLAIDVLEAPRAHTGLG
FT                   SGTQLALAVGTAFTRLIGQPATSAEIASLLGRGARSGIGILGFECGGLLLDGGPPGDLR
FT                   QSMPPLLSRQPFPQPWRVLLVSDNSREGLHGADERSALASLAPFPQRLAAHLCHLVLMQ
FT                   ILPGAAEHNFAPFAHGLTELQQTIGEYFASAQGGVFASPDVERVLRAVAAERTAGIGQT
FT                   SWGPTGFAVLASAREAERALATARAVASALPHIECSVVAGRNSGAAISGAEARAPHIDA
FT                   A"
FT                   /protein_id="YP_003606782.1"
FT   misc_feature    complement(41729..42679)
FT                   /note="Predicted archaeal sugar kinases [General function
FT                   prediction only]; Region: COG1907"
FT                   /db_xref="CDD:32091"
FT                   /locus_tag="BC1002_3226"
FT   gene            complement(43004..43402)
FT                   /db_xref="GeneID:9112530"
FT                   /locus_tag="BC1002_3227"
FT   CDS_pept        complement(43004..43402)
FT                   /locus_tag="BC1002_3227"
FT                   /gene_family="HOG000007680" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /codon_start="1"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: bxe:Bxe_B2429
FT                   pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="GI:295698890"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="GeneID:9112530"
FT                   /translation="MANTEHVYTDEEIQQRLVGPLQHWYLEDGWLRRKYRTEGWKGTLM
FT                   VVNAVGHLAEAAWHHPDLTVSYAFVIVKLKTHTAKGITDKDFALATKIESVVHWQPALE
FT                   EGPLEGTPADDQRFRYIKYDAPKPAQGS"
FT                   /protein_id="YP_003606783.1"
FT   misc_feature    complement(43115..43336)
FT                   /note="PCD_DCoH: The bifunctional protein
FT                   pterin-4alpha-carbinolamine dehydratase (PCD), also known
FT                   as DCoH  (dimerization cofactor of hepatocyte nuclear
FT                   factor-1), is both a transcription activator and a
FT                   metabolic enzyme.  DCoH stimulates gene expression by...;
FT                   Region: PCD_DCoH; cd00488"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   misc_feature    complement(order(43172..43174,43214..43216,43223..43225,
FT                   43271..43273,43283..43285))
FT                   /note="aromatic arch; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   misc_feature    complement(order(43202..43225,43238..43240,43259..43261,
FT                   43271..43273,43283..43285))
FT                   /note="DCoH dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   misc_feature    complement(order(43235..43240,43247..43249,43256..43261,
FT                   43277..43282))
FT                   /note="DCoH /HNF-1 dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   misc_feature    complement(order(43235..43237,43247..43249,43256..43261,
FT                   43280..43282))
FT                   /note="DCoH tetramer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   misc_feature    complement(order(43169..43174,43178..43180,43223..43231))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="BC1002_3227"
FT   gene            43821..45638
FT                   /db_xref="GeneID:9112531"
FT                   /locus_tag="BC1002_3228"
FT   CDS_pept        43821..45638
FT                   /locus_tag="BC1002_3228"
FT                   /gene_family="HOG000217982" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03075"
FT                   /codon_start="1"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2427 methanol dehydrogenase-like
FT                   protein (XoxF); TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: PQQ-dependent enzyme-like;
FT                   Pyrrolo-quinoline quinone"
FT                   /db_xref="GI:295698891"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019551"
FT                   /db_xref="InterPro:IPR019556"
FT                   /db_xref="GeneID:9112531"
FT                   /translation="MNLRTVVLGLAILASAAFSSLAAQADSQLDGLMKNPANWAAQAGD
FT                   YANHRYSPLKQINENNVGKLQVAWTMSTGVLRGHEGAPLVIGDTMYIHSPFPNKVIAVN
FT                   LKDQTFLWQYQPKQDEQVVSVMCCDTVNRGLAYGDGKIFLQQADTKLVALNAKTGEVVW
FT                   TAQNGNPKAGETNTNAPHVFGDKVLTGISGGEFGVRGRLIAYDIKTGKQVWTAYSTGPD
FT                   NEMLLDPQKTMTYSNGQMVPVGADSSVKSWKGDQWKLGGGTTWGWYAWDPKLNLVYYGT
FT                   GNPGTWNPTQRPGDNKWSMSIFARDLNTGTAKWVYQMTPHDEWDYDGVNEMILSDLTIN
FT                   GKKVPAIVHFDRNGFGYTLNRETGQLLVAQKYDPAVNWADRVDLQSGLPIRNAAYSTQA
FT                   AGSDHNVKGICPAALGSKDQQPAAFDPKTSLFLVPTNHVCMDYEPFDVDYVSGQPYVGA
FT                   TLSMYPGPNEGNAMGNFIAWDASKGKIVYSKPEKFSVWSGVLATGGGIAFYGTLEGYLK
FT                   AVRISDGKELWRFKTPSGIIGNVFTYEYQGKQYVGVYSGIGGWAGIGMAAGLEKPTEGL
FT                   GAVGGYKDLAKYTALGGTLFVFAIPNEKS"
FT                   /protein_id="YP_003606784.1"
FT   misc_feature    43920..45620
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="BC1002_3228"
FT   misc_feature    43920..45485
FT                   /note="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family; Region: PQQ_enz_alc_DH; TIGR03075"
FT                   /db_xref="CDD:163127"
FT                   /locus_tag="BC1002_3228"
FT   misc_feature    order(44010..44018,44025..44027,44124..44126,44130..44132,
FT                   44139..44147,44154..44156,44277..44279,44283..44285,
FT                   44292..44300,44307..44309,44430..44432,44436..44438,
FT                   44445..44453,44460..44462,44730..44732,44736..44738,
FT                   44745..44753,44760..44762,44892..44894,44898..44900,
FT                   44907..44915,44922..44924,45201..45203,45207..45209,
FT                   45216..45224,45252..45254,45372..45374,45378..45380,
FT                   45387..45395,45402..45404,45609..45611,45615..45617)
FT                   /note="Trp docking motif; other site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_3228"
FT   misc_feature    order(44022..44039,45438..45458,45462..45482,45600..45620)
FT                   /note="'Velcro' closure; other site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_3228"
FT   misc_feature    order(44058..44060,44199..44204,44217..44219,44349..44351,
FT                   44394..44405,44613..44615,44667..44669,44793..44795,
FT                   44874..44876,45306..45308,45537..45539)
FT                   /note="active site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_3228"
FT   gene            45803..46222
FT                   /db_xref="GeneID:9112532"
FT                   /locus_tag="BC1002_3229"
FT   CDS_pept        45803..46222
FT                   /locus_tag="BC1002_3229"
FT                   /gene_family="HOG000230208" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2426"
FT                   /codon_start="1"
FT                   /product="putative methanol dehydrogenase-like protein,
FT                   cytochrome cL (XoxG)"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2426 putative methanol
FT                   dehydrogenase-like protein, cytochrome cL (XoxG)"
FT                   /db_xref="GI:295698892"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:9112532"
FT                   /translation="MKGRSILLLTALPVALVMLPVGYAQNNPSIAQVAYKVVDGNKVDS
FT                   NTLQGWKTWRALACERCHGAQQQGMVGPSLIDAFKTLDKNEFHRTVFGGRVDKGMPDFS
FT                   ASQMMQKNWENLYAYLKGRSDGQIKPGDLHAIDSN"
FT                   /protein_id="YP_003606785.1"
FT   misc_feature    45905..46180
FT                   /note="c-type cytochrome, methanol metabolism-related;
FT                   Region: 4cys_cytochr; TIGR03874"
FT                   /db_xref="CDD:163586"
FT                   /locus_tag="BC1002_3229"
FT   gene            46254..47165
FT                   /db_xref="GeneID:9112533"
FT                   /locus_tag="BC1002_3230"
FT   CDS_pept        46254..47165
FT                   /locus_tag="BC1002_3230"
FT                   /gene_family="HOG000137909" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00062"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: bxe:Bxe_B2425 ABC transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="GI:295698893"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:9112533"
FT                   /translation="MRDKRSMSVHVSVIAAALCGAALASAAVRADGPALPNNDGADGVL
FT                   RVCADPNNMPLSNDKGEGYENRIAAQMASDFGYKLEYTYFPQRMGFVRHTLREKAEGSE
FT                   RYRCDLIIGVPKGYDMTSTTQPYLRSTYAMVLPNRPEFASIKTPDDLLKLPPDQLHKLR
FT                   FGIFSQTPAVDWLLGHNLIDQAVSYQVQSGDPGVYPGQMIEHDLAAGNVDVVFLWGPIA
FT                   GYFAKRAGDSVRLVPFPPQPGIRFDYTISMGVRYGEKDWKDKVDQWIGANHDKIDSILA
FT                   TYQVPMLKPVDAPAGKPGDASQ"
FT                   /protein_id="YP_003606786.1"
FT   misc_feature    46383..47117
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3230"
FT   misc_feature    46383..47060
FT                   /note="Bacterial periplasmic substrate-binding proteins;
FT                   Region: PBPb; smart00062"
FT                   /db_xref="CDD:128376"
FT                   /locus_tag="BC1002_3230"
FT   gene            47162..47938
FT                   /db_xref="GeneID:9112534"
FT                   /locus_tag="BC1002_3231"
FT   CDS_pept        47162..47938
FT                   /locus_tag="BC1002_3231"
FT                   /gene_family="HOG000059174" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2424"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2424 hypothetical protein"
FT                   /db_xref="GI:295698894"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="GeneID:9112534"
FT                   /translation="MTRARGAWLRVARAALMGTLCVLCLAPAATRAASPASAASAPGGD
FT                   DITAAERLIFLTDHLHGVAAQTELDYALIDSGQPSRSADVVKVLVQSENNAKGDAQVSD
FT                   HSGSVNLPIGGLQCNPAIIYFLERDIAEMQGLTGGQRRYFQQRLRLALAAGPQIESVPS
FT                   EVGGKPVNARRIVVQPYLNDPNAARFAQYTGKRYTFLLADGVPGQVLQIRTDVPGPNND
FT                   FAHPAHSESLSFQSALNKLPSGKVPAKPSNAPRASR"
FT                   /protein_id="YP_003606787.1"
FT   gene            47946..48950
FT                   /db_xref="GeneID:9112535"
FT                   /locus_tag="BC1002_3232"
FT   CDS_pept        47946..48950
FT                   /locus_tag="BC1002_3232"
FT                   /gene_family="HOG000233518" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_B2423 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295698895"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112535"
FT                   /translation="MQNASFATNRVKLNFVRTLTLRQLQIFVVASRYTSFARAAEELHL
FT                   TQPAVSMQIHQLEEAVGLRLFERVARKLTLTEAGEVLTHHASRILGEIKDTEDAMMSLK
FT                   QADSGSINVGIVSSATYFAPKLLAMYSHLYPKVDVHFSVGNRDALLRLLQDNAIDLAIM
FT                   GRPPPELDTTAEPLASHPQVVIAPVHHPLCGARRFDLQELSNDTFLLREPGSGTRMAAE
FT                   AMFRQHLFTPAKTVTLGSNETIKQAVMAGMGVSLISLHTLQLELRTGEIALLDVNGTPI
FT                   VRTWQIVHLRTKQLSPTSVMFRQFLLEHAAVHLEQEYAQFAGVFAKRQIGAQR"
FT                   /protein_id="YP_003606788.1"
FT   misc_feature    48000..48893
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_3232"
FT   misc_feature    48006..48185
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3232"
FT   misc_feature    48273..48863
FT                   /note="The C-terminal substrate binding of LysR-type
FT                   transcriptional regulator (CbbR) of RubisCO operon, which
FT                   is involved in the carbon dioxide fixation, contains the
FT                   type 2 periplasmic binding fold; Region:
FT                   PBP2_CbbR_RubisCO_like; cd08419"
FT                   /db_xref="CDD:176111"
FT                   /locus_tag="BC1002_3232"
FT   misc_feature    order(48315..48320,48324..48329,48336..48338,48348..48350,
FT                   48354..48374,48648..48665,48681..48686,48690..48695)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176111"
FT                   /locus_tag="BC1002_3232"
FT   gene            49217..50239
FT                   /db_xref="GeneID:9112536"
FT                   /locus_tag="BC1002_3233"
FT   CDS_pept        49217..50239
FT                   /locus_tag="BC1002_3233"
FT                   /gene_family="HOG000236943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /codon_start="1"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /transl_table="11"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: bxe:Bxe_B2421 putative MxaR-like
FT                   protein"
FT                   /db_xref="GI:295698896"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR016366"
FT                   /db_xref="GeneID:9112536"
FT                   /translation="MVSGEQLQDWRSHAQQIENEVARVVVGQQQTLRLINVALFARGHV
FT                   LLEGGVGVGKTTVLRAFARVVGGDFERVEGTIDLMPGDLVYHTYVDADGKPRIEPGPLL
FT                   RHGEQLTTFFFNEINRARPQVQSLLLRAMAERSVWAFGREHRFPHMTVYADRNKVEKEE
FT                   TFELASAARDRFLFELNMPTPTDEEARRSLVFDTRFHDVDGLLAQLTPSIVPWEQLNRI
FT                   GAAIQQGVQASETIERYVHDIWQATETPARFGIALDGVDMEQLILAGASPRGMSALLRA
FT                   ARVVAWFAGRTHLLPEDIHEVLLPALGHRVFFTPIYELRRQELAEALISRIVANVAVPR
FT                   "
FT                   /protein_id="YP_003606789.1"
FT   misc_feature    49247..50236
FT                   /note="MoxR-like ATPases [General function prediction
FT                   only]; Region: COG0714"
FT                   /db_xref="CDD:31058"
FT                   /locus_tag="BC1002_3233"
FT   misc_feature    49394..49747
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_3233"
FT   gene            50260..51171
FT                   /db_xref="GeneID:9112537"
FT                   /locus_tag="BC1002_3234"
FT   CDS_pept        50260..51171
FT                   /locus_tag="BC1002_3234"
FT                   /gene_family="HOG000144338" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2420"
FT                   /codon_start="1"
FT                   /product="putative MxaS-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2420 putative MxaS-like protein"
FT                   /db_xref="GI:295698897"
FT                   /db_xref="GeneID:9112537"
FT                   /translation="MNGTAEFHYRLPMRAAGARPGSHPGSSFGSGQQFAMHGRLFDYPD
FT                   PRRLDLRASLRAARDEWLVRVHLQRVAVSVFVIVDVSASMQFGTHKTKLQVVADFVEAL
FT                   GHSAFRVGDRLGMLAFDSGERDDLFMPARTGRGTGSLLASMLREGVSDIADHQANGQAG
FT                   RHADRQAERGSVEGLRRCAIRIAGRQALVFVVSDFHWPLARLSPVLDMLVHACVVPMVV
FT                   WDAAETTPPQHASLLAVNDAESGEERRVWLSRGARERWRAGVARRRDELAAVFGARGIQ
FT                   PFYVEGAFDPEAMSRYFLELTV"
FT                   /protein_id="YP_003606790.1"
FT   gene            51168..52091
FT                   /db_xref="GeneID:9112538"
FT                   /locus_tag="BC1002_3235"
FT   CDS_pept        51168..52091
FT                   /locus_tag="BC1002_3235"
FT                   /gene_family="HOG000236879" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2418a"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2418a hypothetical protein"
FT                   /db_xref="GI:295698898"
FT                   /db_xref="GeneID:9112538"
FT                   /translation="MSAREVRGVCACRAALCVLIASLGGAACATASAAEVAALVQEPRA
FT                   FGYVLGDVLTQRVLLEADGRDVGAVTPPSVGRTGVWLERRPVTLETDTNGRKWMVIGYQ
FT                   VINAPQTLTQITLPALTLTSAAGTQLQIAEWPASIGPLTPQTAFAAGDLQPLRPDRQAP
FT                   MLATSGWRRQIAWALGLLFATLLVWASWWWARNRREAARLPFARAWRQMQRLPEAPGAS
FT                   SNDAWVCLHRALNETAGEVVHAASLSALLARAPYLQPLRAQLERFYLASAERFFAPAPH
FT                   AVENPGELSLHALCRALYRAERRHQR"
FT                   /protein_id="YP_003606791.1"
FT   gene            52088..53074
FT                   /db_xref="GeneID:9112539"
FT                   /locus_tag="BC1002_3236"
FT   CDS_pept        52088..53074
FT                   /locus_tag="BC1002_3236"
FT                   /gene_family="HOG000229959" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00327"
FT                   /codon_start="1"
FT                   /product="von Willebrand factor type A"
FT                   /transl_table="11"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   bxe:Bxe_B2418 putative MxaC-like protein"
FT                   /db_xref="GI:295698899"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="GeneID:9112539"
FT                   /translation="MTMNLDFALPWMLVLLPLAALPLLRRRSDTLVFSSVAWLPADDLG
FT                   RVAGWLVRGGAALAIAAIVVGLAGPGRSQLQVLRTGSGAQILILMDRSQSMDEPMGSKG
FT                   VESPRGDSKNHVAREALTRFVGQRPNDRLAFMMFGTNPVLAMPFTYNHRVIEAAVAATA
FT                   IGRGMPDTELDRGMLAAIAQFDGRLSSGRRAIVLVSDGGALLDERMQRRIEEGLRRDRI
FT                   ALYFIYLRSSVFSPDLNATQPASGSSAEAQLHRFFLTLKTPYRLFQAEDPKAMMAAIAE
FT                   INRQQNATTTFFEHLPRQDLSPYCFALALFCAALLVLLHQLQVRSWA"
FT                   /protein_id="YP_003606792.1"
FT   misc_feature    52337..52807
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cd00198"
FT                   /db_xref="CDD:29222"
FT                   /locus_tag="BC1002_3236"
FT   misc_feature    order(52358..52360,52598..52600,52685..52687)
FT                   /note="metal ion-dependent adhesion site (MIDAS); other
FT                   site"
FT                   /db_xref="CDD:29222"
FT                   /locus_tag="BC1002_3236"
FT   gene            53071..53616
FT                   /db_xref="GeneID:9112540"
FT                   /locus_tag="BC1002_3237"
FT   CDS_pept        53071..53616
FT                   /locus_tag="BC1002_3237"
FT                   /gene_family="HOG000058992" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2417"
FT                   /codon_start="1"
FT                   /product="putative MxaK-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2417 putative MxaK-like protein"
FT                   /db_xref="GI:295698900"
FT                   /db_xref="GeneID:9112540"
FT                   /translation="MKRTLIHTLFGTVAICCAAWAAYGFVRLQHAERVNQAIVATNAAA
FT                   REQQAGGDAREVQLARAIALSKAGAYDAAARLYNGLLPEGGPPDEVGRAALFDLGNLYL
FT                   REGSGDNAQTVRSLAMIGEAKARYRLALRAAPDDWDARYNLERALWLAPETPSALAGPD
FT                   VKEQHNVTVRDARSQDLP"
FT                   /protein_id="YP_003606793.1"
FT   gene            53613..54608
FT                   /db_xref="GeneID:9112541"
FT                   /locus_tag="BC1002_3238"
FT   CDS_pept        53613..54608
FT                   /locus_tag="BC1002_3238"
FT                   /gene_family="HOG000144371" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2416"
FT                   /codon_start="1"
FT                   /product="putative MxaL-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2416 putative MxaL-like protein"
FT                   /db_xref="GI:295698901"
FT                   /db_xref="GeneID:9112541"
FT                   /translation="MSGVQRERGFAKWRHALTPLALVALIAAVAMPDVTLPRNTFNYIV
FT                   TFDITQSMDVEDMVLDGAPVSRLKFAQAAMRDALGRVPCGSKVGWSVFTGQRVLLLMAP
FT                   VEVCGNYDALLVSLDGIDGRMRWTNWSRIAEGGVYSAVRVAQDVGGGAAIAFVTDGQEA
FT                   PPLLASRPLMEGINAARISGWLIGVGGDQPAAIPKTDANGNRIGVWQADDVIQVPPTPG
FT                   SGVAAQTHEELSELRGEYLASVARQTGLDYRRLLNVTSFGDALLETRFARREPVPTDLR
FT                   GCPALLALLLLVARFMPDAVLAWPRAWRKRIQTIALRIAPAFNGRPTRAD"
FT                   /protein_id="YP_003606794.1"
FT   misc_feature    53736..54218
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cl00057"
FT                   /db_xref="CDD:173993"
FT                   /locus_tag="BC1002_3238"
FT   misc_feature    order(53754..53756,54015..54017,54087..54089)
FT                   /note="metal ion-dependent adhesion site (MIDAS); other
FT                   site"
FT                   /db_xref="CDD:29222"
FT                   /locus_tag="BC1002_3238"
FT   gene            54900..55469
FT                   /db_xref="GeneID:9112542"
FT                   /locus_tag="BC1002_3239"
FT   CDS_pept        54900..55469
FT                   /locus_tag="BC1002_3239"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein, conserved"
FT                   /db_xref="GI:295698902"
FT                   /db_xref="GeneID:9112542"
FT                   /translation="MTCQNERIVGVVLVLMSGYAFAGGPFGDVPQAMMVANIVASPVEV
FT                   VPPIPEPRRYFEQQRQQRYAMEYQGDRGKPFYAQMENYYSVDLARDVQLGTAKALVSSG
FT                   PAFAPVSEPGANAGVQSASNSLRMGPSTAPQISIVQMNSSVLSIGQSPQRRLSLTVDNW
FT                   VFSGTARVAILHSHDTGATLIVKRRY"
FT                   /protein_id="YP_003606795.1"
FT   gene            complement(55502..56476)
FT                   /db_xref="GeneID:9112543"
FT                   /locus_tag="BC1002_3240"
FT   CDS_pept        complement(55502..56476)
FT                   /locus_tag="BC1002_3240"
FT                   /gene_family="HOG000063189" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bmj:BMULJ_02621 AraC subfamily transcriptional
FT                   regulator; PFAM: ThiJ/PfpI domain protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295698903"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:9112543"
FT                   /translation="MSSAPRPIVLLAFPNMQLLDISGPLQVFASANELVAQRGLDELYA
FT                   PRVVAASAGPVISSSGLMVLAASLRSVKTPLDTLIVPGGRGVREASADRRLIRWTQRHA
FT                   PHCRRVASVCSGAFLLAEAGLLDGRRVATHWARCDELAQAYPQLQVEADPIFIRDGDIW
FT                   TSAGVTAGIDLALAMLEDDHGRALALDVARELVVFLKRPGGQSQFSAALSLQHADDRFG
FT                   ELHAWMTSHLAADLSVPALAQRLHMSERSFMRHYKAQTGRTPARAVEQLRIEAAQRLLS
FT                   ETSLSIKRIALRCGFGSEETMRCSFVRQLRVPPQVYRERFSST"
FT                   /protein_id="YP_003606796.1"
FT   misc_feature    complement(55505..56470)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="BC1002_3240"
FT   misc_feature    complement(55883..56455)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_1; cd03137"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="BC1002_3240"
FT   misc_feature    complement(56135..56137)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="BC1002_3240"
FT   gene            56979..57401
FT                   /db_xref="GeneID:9112544"
FT                   /locus_tag="BC1002_3241"
FT   CDS_pept        56979..57401
FT                   /locus_tag="BC1002_3241"
FT                   /gene_family="HOG000162421" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_2607 hypothetical protein"
FT                   /db_xref="GI:295698904"
FT                   /db_xref="GeneID:9112544"
FT                   /translation="MEQLNQQSSGTDSTVEEECDLCRITYSIYSKFPPMPHAQALNAET
FT                   GEFFPFDRVRKMKSGYAMAEALGYGWACNCRGRPPKRFNEQFELRESTGKRLAGVRYRI
FT                   RVGSRVIAKGVTDSQGRTQRVSTDSANQVSIEVAGQ"
FT                   /protein_id="YP_003606797.1"
FT   misc_feature    <57213..57395
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2345); Region: DUF2345; cl01733"
FT                   /db_xref="CDD:154559"
FT                   /locus_tag="BC1002_3241"
FT   gene            57441..58391
FT                   /db_xref="GeneID:9112545"
FT                   /locus_tag="BC1002_3242"
FT   CDS_pept        57441..58391
FT                   /locus_tag="BC1002_3242"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_2603 hypothetical protein"
FT                   /db_xref="GI:295698905"
FT                   /db_xref="GeneID:9112545"
FT                   /translation="MTNEFLNKNSQYFKTDENEEWTEVGTALTNTTHGSISNVVINTTP
FT                   ICPNMSNKEFRGLIIRLRDTALTLIKERTADVARWDMSAQDRAKFWFGRSDQYTRDKLN
FT                   IGLPRLAAAMRELQPEKIIRWDKQKVVQLSCAIVPDRGTNDAAAKSNSIKRRSGDPMKK
FT                   FAFAVLSAFWFAASQQAAACTISEDLTESVPLNFQGIPNSYRLKMVDLVSNARRWPDVE
FT                   IQAQIVTNAYVGEKNAEELAKSRGQQLKEILIQLGVKSQYIYVDTHLEESPYPQDNSGF
FT                   NGYLQLSVGLMPLCKGGCERLCDDPRITPTSKTVK"
FT                   /protein_id="YP_003606798.1"
FT   gene            58772..59053
FT                   /db_xref="GeneID:9112546"
FT                   /locus_tag="BC1002_3243"
FT   CDS_pept        58772..59053
FT                   /locus_tag="BC1002_3243"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_1873 Mu P family protein"
FT                   /db_xref="GI:295698906"
FT                   /db_xref="GeneID:9112546"
FT                   /translation="MYLVSTGIFADDGQPPLAEYTVADDTMPRFRPKAFIAQNGDAGAE
FT                   VSNAQALWECNRRIGRGNVLSVTAMSWRDSDGVLYRPNTGGARCHNSR"
FT                   /protein_id="YP_003606799.1"
FT   misc_feature    <58832..>59020
FT                   /note="Mu-like prophage tail protein gpP [General function
FT                   prediction only]; Region: COG4379"
FT                   /db_xref="CDD:34086"
FT                   /locus_tag="BC1002_3243"
FT   gene            complement(59514..60245)
FT                   /db_xref="GeneID:9112547"
FT                   /locus_tag="BC1002_3244"
FT   CDS_pept        complement(59514..60245)
FT                   /locus_tag="BC1002_3244"
FT                   /gene_family="HOG000162422" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: cvi:CV_2126 hypothetical
FT                   protein"
FT                   /db_xref="GI:295698907"
FT                   /db_xref="GeneID:9112547"
FT                   /translation="MKITTIRVAALVVLSSSVYAAQSYDSYETFYVAQPGAVFADPIKE
FT                   TGDPTNQNTGVVYSYSGQPGTFTKLQAKLERKTLNIELWGNRLTVNGKSYRFADATTFP
FT                   GEHVSEIFPQSANVFIAPRTKTHPPLLCVEGHSSGSGEAASRYRQIALLVNPLARKPTF
FT                   LHLPSLLSSCRAVVATKDGKLAFPKNGYVFDDAQESRVGLLVSYYTFENRRFVPVSALK
FT                   QLRLRFAQPEIPFQFSVEDKD"
FT                   /protein_id="YP_003606800.1"
FT   gene            complement(60242..60854)
FT                   /db_xref="GeneID:9112548"
FT                   /locus_tag="BC1002_3245"
FT                   /pseudo
FT   gene            complement(61067..61300)
FT                   /db_xref="GeneID:9112549"
FT                   /locus_tag="BC1002_3246"
FT                   /pseudo
FT   gene            61408..61839
FT                   /db_xref="GeneID:9112550"
FT                   /locus_tag="BC1002_3247"
FT                   /pseudo
FT   gene            61868..62050
FT                   /db_xref="GeneID:9112551"
FT                   /locus_tag="BC1002_3248"
FT   CDS_pept        61868..62050
FT                   /locus_tag="BC1002_3248"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:295698908"
FT                   /db_xref="GeneID:9112551"
FT                   /translation="MIDTRSEIERRLSVLRGLELSGFNHAADMLTLSFGPLRQVTNFKG
FT                   TVKYVGAWSLQQLRQ"
FT                   /protein_id="YP_003606801.1"
FT   gene            62364..63041
FT                   /db_xref="GeneID:9112552"
FT                   /locus_tag="BC1002_3249"
FT   CDS_pept        62364..63041
FT                   /locus_tag="BC1002_3249"
FT                   /gene_family="HOG000063193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bvi:Bcep1808_2772 ThiJ/PfpI domain-containing protein"
FT                   /db_xref="GI:295698909"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:9112552"
FT                   /translation="MSLQIGFLVFPKVQQLDLTGPHDVLASLPDATMHLVWKTREPVVS
FT                   SNGLVLTPSATYESCPPLDVICVPGGSGVTALLQDEQTIDFVRRQAASARYVTSVCTGA
FT                   LLLGAAGLLRGRRATTHWAFHSLLEPLGAIPTHARVVRDGNLITGGGVTAGIDFGLTVA
FT                   AELAGVEEAQAIQLELEYAPAPPFDAGDPAMAPQAVVELVRQRSAETLASRRRVVMELA
FT                   ERS"
FT                   /protein_id="YP_003606802.1"
FT   misc_feature    62376..62906
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in a subgroup of proteins similar to PfpI from
FT                   Pyrococcus furiosus; Region: GATase1_PfpI_2; cd03139"
FT                   /db_xref="CDD:153233"
FT                   /locus_tag="BC1002_3249"
FT   misc_feature    62664..62666
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153233"
FT                   /locus_tag="BC1002_3249"
FT   gene            63149..63589
FT                   /db_xref="GeneID:9112553"
FT                   /locus_tag="BC1002_3250"
FT   CDS_pept        63149..63589
FT                   /locus_tag="BC1002_3250"
FT                   /gene_family="HOG000226996" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_7197"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7197 hypothetical protein"
FT                   /db_xref="GI:295698910"
FT                   /db_xref="GeneID:9112553"
FT                   /translation="MRVGKPVKALPQPSCDYCGNRALLARYGDESYPYRSDQGPLWICT
FT                   GCQAWIGVYSRSKHNLPLGRLADTTLRESKSKLHDALEPLVAAKVRRDGVNAFEARAKA
FT                   IRWVATELGFDPVPASIHAFTPEQCEQALRYVEAFVEARRAR"
FT                   /protein_id="YP_003606803.1"
FT   misc_feature    63191..63496
FT                   /note="Protein of unknown function (DUF3268); Region:
FT                   DUF3268; pfam11672"
FT                   /db_xref="CDD:152108"
FT                   /locus_tag="BC1002_3250"
FT   gene            complement(63609..64346)
FT                   /db_xref="GeneID:9112554"
FT                   /locus_tag="BC1002_3251"
FT   CDS_pept        complement(63609..64346)
FT                   /locus_tag="BC1002_3251"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4965 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295698911"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112554"
FT                   /translation="MNRELAPLLEVRGLTRRFGERNVFDKVSFALSRGEIVSLVGPSGC
FT                   GKSTLLRAVAGLDRIATGTVLIDGVPLLAPSPRVGMIFQEPRLLPWLSVAENIAFAAGP
FT                   HAGDDPRVDALLAEVGLAGVRDALPKQLSGGMAQRVALARGLFNEPELLLLDEPFSAVD
FT                   AITRARLQQLLLALKHARGTTVLLVTHDLDEALSLSDRVLLLSPAGVGSPSRIARELPI
FT                   ALQRPRNPRDASLDALRDVLLEM"
FT                   /protein_id="YP_003606804.1"
FT   misc_feature    complement(63615..64331)
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(63675..64322)
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(64203..64226)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(order(63777..63779,63876..63881,64095..64097,
FT                   64200..64208,64212..64217))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(64095..64106)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(63924..63953)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(63876..63893)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(63858..63869)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   misc_feature    complement(63771..63791)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3251"
FT   gene            complement(64343..65209)
FT                   /db_xref="GeneID:9112555"
FT                   /locus_tag="BC1002_3252"
FT   CDS_pept        complement(64343..65209)
FT                   /locus_tag="BC1002_3252"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcj:BCAS0341 putative
FT                   binding-protein-dependent transport system component"
FT                   /db_xref="GI:295698912"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9112555"
FT                   /translation="MSAAKNFFTLARRDSSCPSCSELAQPPRAIDPLRLWRYAGLALPV
FT                   AFLAVIELLVRASILPMHLVPAPSAIAQTLWDLGAARLARHVGASVIRVYGGFAIGAAL
FT                   ALLIGAAMGLSRRVDALLDPAFQALRAIPSLAWVPILLLWMGIDEAPKITLIAIGAFFP
FT                   VQLSVVAGIRGVDRKLIEFGELNRLSRRALFTRILLPASMPQIFTGLRTGLSLAWMFMV
FT                   AAELIAATRGLGYLLSDGRETGRPDLVFGAILLLALLGKLSDGMLKAIEVRALSWRDAH
FT                   QVSEAAR"
FT                   /protein_id="YP_003606805.1"
FT   misc_feature    complement(64523..64864)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3252"
FT   misc_feature    complement(order(64532..64537,64544..64555,64574..64576,
FT                   64583..64588,64628..64630,64679..64681,64688..64693,
FT                   64703..64705,64709..64714,64721..64723,64727..64729,
FT                   64733..64738,64784..64786,64790..64795,64802..64831,
FT                   64835..64846))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3252"
FT   misc_feature    complement(order(64538..64555,64784..64828))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3252"
FT   misc_feature    complement(order(64535..64537,64751..64753,64784..64786))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3252"
FT   misc_feature    complement(order(64607..64609,64619..64624,64640..64678))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3252"
FT   gene            complement(65238..66308)
FT                   /db_xref="GeneID:9112556"
FT                   /locus_tag="BC1002_3253"
FT   CDS_pept        complement(65238..66308)
FT                   /locus_tag="BC1002_3253"
FT                   /gene_family="HOG000164732" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /codon_start="1"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   NMT1/THI5 like domain protein; KEGG: bcj:BCAS0342
FT                   hypothetical protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="GI:295698913"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9112556"
FT                   /translation="MKPIRGFSFFTTARNAIATVGERNRSRRAWLKTAAAALALGIFGA
FT                   AHTAHAAPLDELKLDYAYYSPESLVIKRNGWLEQEFAADHTQVKWVLSLGSNRALEYLN
FT                   SGAIDIGSTAGLAAVLGKANGNPIRAVYIYSRPEWTALVVRKDSPIKTVADLKGKKIAA
FT                   TKGTDPFLFTLRALHTAGLSRDDVEIVNLQHPDGRTALANGQVDAWAGLDPHMAAAQID
FT                   DGARLLYRNVDFNTWGFLNAREDFIRDHQDALARVLKVYEKARVWIAAHPDDTARIVAE
FT                   ESKVSLPVAKLQLSRNDFSQPQPGARQIAALKTAAPILVDEQLVKSGTDLNAIIDALVD
FT                   AKVAQPVIATASNGTK"
FT                   /protein_id="YP_003606806.1"
FT   misc_feature    complement(65286..66140)
FT                   /note="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
FT                   /db_xref="CDD:130789"
FT                   /locus_tag="BC1002_3253"
FT   misc_feature    complement(65532..66080)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3253"
FT   misc_feature    complement(order(65673..65675,65805..65807,65943..65945,
FT                   66024..66026))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3253"
FT   misc_feature    complement(order(65694..65696,65712..65714))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3253"
FT   misc_feature    complement(65589..65606)
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3253"
FT   gene            66546..67595
FT                   /db_xref="GeneID:9112557"
FT                   /locus_tag="BC1002_3254"
FT   CDS_pept        66546..67595
FT                   /locus_tag="BC1002_3254"
FT                   /gene_family="HOG000265079" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01729"
FT                   /codon_start="1"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: taurine ABC transporter, periplasmic
FT                   binding protein; PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bph:Bphy_6080 taurine ABC transporter, periplasmic binding
FT                   protein; SMART: extracellular solute-binding protein family
FT                   3"
FT                   /db_xref="GI:295698914"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9112557"
FT                   /translation="MNHSLRLVRRALRAAAFVAASAGIASFSPFASSAHAQSREVVIGY
FT                   QDMVVPWRYAQATGAVEKATGYKVTYRKLGSGADVVRALASGSIQLGEAGSSPIAAGLS
FT                   QGVDLSLFWILDNINDAEALVARDGSGVTKIADLKGKTIGVPYVSTSHFHALVALQQAG
FT                   VDPSSVKILNLRPPEVAAAWQRGNIDATYIWDPVLAKVKQNGKVLITSGEVAKGSGKAT
FT                   FDGFIATRQFERDNAAFMAGLVKVLADTDALYRDHKADWTATSQQVQAVAQESGAAPAD
FT                   VPASLALYAFPSAAEQASPTWLGGGKQSGAAQSLAATAAFLKTQGTIQNVLPDYSAAVN
FT                   PRFVQQVSR"
FT                   /protein_id="YP_003606807.1"
FT   misc_feature    66663..67289
FT                   /note="Bacterial periplasmic substrate-binding proteins;
FT                   Region: PBPb; smart00062"
FT                   /db_xref="CDD:128376"
FT                   /locus_tag="BC1002_3254"
FT   misc_feature    66723..67292
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3254"
FT   misc_feature    order(66774..66776,66852..66854,66993..66995,67125..67127)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3254"
FT   misc_feature    order(67074..67076,67086..67088,67104..67106)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3254"
FT   misc_feature    order(67197..67211,67221..67223)
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3254"
FT   gene            67592..68371
FT                   /db_xref="GeneID:9112558"
FT                   /locus_tag="BC1002_3255"
FT   CDS_pept        67592..68371
FT                   /locus_tag="BC1002_3255"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6081 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295698915"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112558"
FT                   /translation="MSMLDIRGLRVTYAGASEPALAGVDLCIERGEFVVALGASGCGKT
FT                   TLLNCIAGFVDPSEGEVRLNGTPIDGPGAERGVVFQKHALMPWLDVLDNVALGLRFRGI
FT                   ARAQRHEIARRTLALVGLERHANAKIHALSGGMQQRVGIARALASDPQILLMDEPMGAL
FT                   DALTRETVQELVLDVWARTHKTVFFITHSVEEALFLATRLVLMTPGPGRIAEVHELPFA
FT                   REYLATRDARAVKSSPAFIEWRERLTRRLHDTLREAA"
FT                   /protein_id="YP_003606808.1"
FT   misc_feature    67598..68365
FT                   /note="taurine transporter ATP-binding subunit;
FT                   Provisional; Region: tauB; PRK11248"
FT                   /db_xref="CDD:171042"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    67601..68254
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    67703..67726
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    order(67712..67717,67721..67729,67832..67834,68060..68065,
FT                   68162..68164)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    67823..67834
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    67988..68017
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    68048..68065
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    68072..68083
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   misc_feature    68150..68170
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3255"
FT   gene            68371..69255
FT                   /db_xref="GeneID:9112559"
FT                   /locus_tag="BC1002_3256"
FT   CDS_pept        68371..69255
FT                   /locus_tag="BC1002_3256"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_6082
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295698916"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9112559"
FT                   /translation="MSVIESSQQHAPTRPDTARDSTRARSAAHGRRPYRGMPGEGPTAW
FT                   LSVICVAAFALLWWVATHLHWIPPLFLPAPDAVWHAFVDAWHGRIQGGLPLSEHLLWSA
FT                   IRVFGAFALASITAIPVGILMGVSRVARGLLDPPLEFYRPLPPLAYLPLVVIWFGIDET
FT                   AKIVVIWLACFAPIAMAARAGVRSASVEQVNAAWSLGANFRQVVLHVVLPAALPEILTG
FT                   LRIAIGFGWTTLVAAEMVAATAGLGQMVLNASSFLRTDVVVMGIVLIGLIAWLFDLGMR
FT                   ALERRLVPWKGKQ"
FT                   /protein_id="YP_003606809.1"
FT   misc_feature    68503..69252
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_3256"
FT   gene            69404..70222
FT                   /db_xref="GeneID:9112560"
FT                   /locus_tag="BC1002_3257"
FT   CDS_pept        69404..70222
FT                   /locus_tag="BC1002_3257"
FT                   /gene_family="HOG000031895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0127 polar amino acid ABC transporter
FT                   periplasmic ligand-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="GI:295698917"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:9112560"
FT                   /translation="MKIKFVGAAVMGLLLAISGAAHADRLDDIKKAGVLRVATFDSNAP
FT                   FGFADPKTNQIVGLDVDYARAVANKLGVKLEIQPTNPANRIAFLKSGKVDLVFANFTIT
FT                   DERKKEVDFSTPYFASGTQFIAKKGVLTSPQQVNGLRVGADKGTTNEQQVRAQFPNATI
FT                   VAYDDTPFAFAALRAGNVQAITQDGPKLVALLANVPDKANYEIPPFTISNDYEGVGVPK
FT                   GETRLLSVVDDTLKGLEANGSAAKIYDHWFGPESRAPLPRLFKIGDPQKS"
FT                   /protein_id="YP_003606810.1"
FT   misc_feature    69506..70165
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="BC1002_3257"
FT   misc_feature    69506..70159
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3257"
FT   misc_feature    order(69530..69532,69647..69649,69722..69724,69848..69850,
FT                   69962..69964)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3257"
FT   misc_feature    order(69911..69913,69923..69925,69941..69943)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3257"
FT   misc_feature    70037..70054
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3257"
FT   gene            70312..71058
FT                   /db_xref="GeneID:9112561"
FT                   /locus_tag="BC1002_3258"
FT   CDS_pept        70312..71058
FT                   /locus_tag="BC1002_3258"
FT                   /gene_family="HOG000267552" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /codon_start="1"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7228 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295698918"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="GeneID:9112561"
FT                   /translation="MNGWLEPKYLGWIAHGFLMTLVLSACAGAAATLAGFGLALARNAR
FT                   NGMLARAAALYVLAFRNSPLLVQLLFWYFGAATLLPQPWMEWLNASHTVSLSGWTIAWP
FT                   SFEFVAGWVGLTCYTTAFVGEEFRAGMRGVNDAQHQAAAALGLTPLAAFRYVILPQAIR
FT                   IATPPLAGQYMNLVKNSSLAMTIGLAELSYVSRQVDTETFKTFQAFGAATVLYIAIIAV
FT                   IEAVLLVWKRSAAPHSGARRLWQGGH"
FT                   /protein_id="YP_003606811.1"
FT   misc_feature    70321..70950
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_3258"
FT   gene            71058..71795
FT                   /db_xref="GeneID:9112562"
FT                   /locus_tag="BC1002_3259"
FT   CDS_pept        71058..71795
FT                   /locus_tag="BC1002_3259"
FT                   /gene_family="HOG000267552" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /codon_start="1"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7229 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295698919"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="GeneID:9112562"
FT                   /translation="MSELEWLPTLRYLLLGTFPDGPLGGAALTVVMSMVSALLSALVGL
FT                   AGGIALSMTRGAAHLALTALVGFFRAIPVLMLIFWTFFLMPILLHIDVPGLATVVCALA
FT                   LIGGAYLSHSVQAGIAAVGAGQAQAAASLGMTRWQALRYVQLPQAIRIMMPSFVNQWVT
FT                   LIKDTSLAYIVGVPEFTFLANQVNNRLMVYPVQIFLFVGVVYLLLCSTLQYGATWLLKH
FT                   RFRAGHSAANSETKIKWQFPFGV"
FT                   /protein_id="YP_003606812.1"
FT   misc_feature    71214..71684
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3259"
FT   misc_feature    order(71241..71252,71256..71285,71292..71297,71301..71303,
FT                   71370..71375,71379..71381,71385..71387,71394..71399,
FT                   71403..71405,71415..71420,71427..71429,71478..71480,
FT                   71520..71525,71532..71534,71553..71564,71571..71576,
FT                   71604..71609,71637..71642,71649..71654,71658..71663,
FT                   71670..71675,71682..71684)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3259"
FT   misc_feature    order(71259..71303,71553..71570)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3259"
FT   misc_feature    order(71301..71303,71355..71357,71571..71573,71598..71600,
FT                   71607..71609,71637..71639)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3259"
FT   misc_feature    order(71430..71468,71484..71489,71499..71501)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3259"
FT   gene            71836..72852
FT                   /db_xref="GeneID:9112563"
FT                   /locus_tag="BC1002_3260"
FT   CDS_pept        71836..72852
FT                   /locus_tag="BC1002_3260"
FT                   /gene_family="HOG000190472" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /codon_start="1"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bpm:BURPS1710b_A0742
FT                   succinylglutamate desuccinylase/aspartoacylase family
FT                   protein"
FT                   /db_xref="GI:295698920"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="GeneID:9112563"
FT                   /translation="MSSTLTPSNPIRSEINLDAQGKHAGYLRLPHSVHRSAYGWLPIPI
FT                   ASIRNGTGPVVPIMAGNHGDEYEGQILVSTLIREIDAAQVAGQLILLPQANAPAAEAGL
FT                   RTSPLDDGNLNRAFPGNPQGSPTQVIAHYIEHVLLARADYLIDLHSGGSSLLYRGNNML
FT                   AIDARDEGENERLQRALRAFGLPNAFLHAENPVHAATAARRQGALSITAELGGGGTVDA
FT                   ALLREARQGLLHFLGAIGALSGPLVPEAPPADTRFLRVAGARHYVYAYDNGLFEPLVKL
FT                   GDRVVAGQPAARVHFPDTPLKEPVTCHFASDGEVVCKRVPALVRRGDCLFHLAGEVV"
FT                   /protein_id="YP_003606813.1"
FT   misc_feature    71860..72837
FT                   /note="ectoine utilization protein EutE; Region:
FT                   ectoine_eutE; TIGR02994"
FT                   /db_xref="CDD:132039"
FT                   /locus_tag="BC1002_3260"
FT   misc_feature    71896..72837
FT                   /note="A functionally uncharacterized subgroup of the
FT                   Succinylglutamate desuccinylase (ASTE)/aspartoacylase
FT                   (ASPA) subfamily which is part of the M14 family of
FT                   metallocarboxypeptidases. ASTE catalyzes the fifth and last
FT                   step in arginine catabolism by the...; Region:
FT                   M14_ASTE_ASPA_like_2; cd06252"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="BC1002_3260"
FT   misc_feature    order(72022..72024,72031..72033,72148..72150,72178..72183,
FT                   72280..72282,72319..72321,72430..72432,72472..72474)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="BC1002_3260"
FT   misc_feature    order(72022..72024,72031..72033,72280..72282)
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="BC1002_3260"
FT   gene            73134..74555
FT                   /db_xref="GeneID:9112564"
FT                   /locus_tag="BC1002_3261"
FT   CDS_pept        73134..74555
FT                   /locus_tag="BC1002_3261"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="MmgE/PrpD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bph:Bphy_7071
FT                   hypothetical protein"
FT                   /db_xref="GI:295698921"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:9112564"
FT                   /translation="MATPTPKPDVQSTVAQTFARFCTSLEFEALPPLVVERAKHFFIDY
FT                   IAIALRGSILDSSRPMRMLAAARPIPGGATLLGRPDPVHAAWAALANGMAAHSMELDDT
FT                   FLPGSIHNESFVFSSALALAEERGASGKRFITAVVAGFEVACRVAAALKPAVTNARGFH
FT                   PTGTTGALGAAATSATLLGLDAAQVTNALGVACSQAAGLLEFVTDGAWTKRFHGGWASH
FT                   AGMIAAELAQHGITAPPTSIEGKYGYLHAYSGDPLPQALAVGEGEMLAIAQTALKYYPC
FT                   NYYIQSINDSVLQLAVRADLTLEAIESIVVHTVQAAMPLVCEPIEQKRRPRLMIDAQFS
FT                   VPFNVALGLVKRRVSFVDFTPAEFTNPAIERLMDRVTCCVDPGLDAQYPAAWPARVEIT
FT                   LVDGRTLAVATQYAKGDPRNPLNLDEVIAKHRSIVAGVVDESTDDAILDFILRLETKSD
FT                   FSELTRVLKRFVLPR"
FT                   /protein_id="YP_003606814.1"
FT   misc_feature    73167..74501
FT                   /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
FT                   /db_xref="CDD:174454"
FT                   /locus_tag="BC1002_3261"
FT   gene            74839..75645
FT                   /db_xref="GeneID:9112565"
FT                   /locus_tag="BC1002_3262"
FT   CDS_pept        74839..75645
FT                   /locus_tag="BC1002_3262"
FT                   /gene_family="HOG000267783" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /transl_table="11"
FT                   /note="KEGG: bcm:Bcenmc03_6760 HAD family hydrolase;
FT                   manually curated; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB"
FT                   /db_xref="GI:295698922"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="GeneID:9112565"
FT                   /translation="MQPLSQAAANQFSTVRFVLTDMDETLTYQGRLPASTYAALAQLEA
FT                   SGIRVVPVTAAPAGWCDQMARMWPVDGVIAENGGLFLRRSSDGHRVERHYWHSPDSIEH
FT                   VREQLKYIAQVVEKAVPQAQEADDQVFRLTSLAYRRTRTDADHHIVDALRQAGADATIN
FT                   NLWVLGWIGGYDKLTMSLRVLASTYGIDIGAARELVAYSGDSTNDAPMFEFFKHTAGVS
FT                   TVIDYLPQLPTPPRWITRSPGGAGFVEFANAILQSGATSARDASAL"
FT                   /protein_id="YP_003606815.1"
FT   misc_feature    74878..75603
FT                   /note="Predicted hydrolases of the HAD superfamily [General
FT                   function prediction only]; Region: Cof; COG0561"
FT                   /db_xref="CDD:30907"
FT                   /locus_tag="BC1002_3262"
FT   misc_feature    74890..75186
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="BC1002_3262"
FT   misc_feature    order(74899..74907,74998..75000)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="BC1002_3262"
FT   misc_feature    74899..74916
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="BC1002_3262"
FT   misc_feature    74998..75000
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="BC1002_3262"
FT   misc_feature    <75346..75606
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="BC1002_3262"
FT   gene            complement(75849..76868)
FT                   /db_xref="GeneID:9112566"
FT                   /locus_tag="BC1002_3263"
FT   CDS_pept        complement(75849..76868)
FT                   /locus_tag="BC1002_3263"
FT                   /gene_family="HOG000294692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bmj:BMULJ_03380 Zn-dependent NADPH:quinone reductase"
FT                   /db_xref="GI:295698923"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112566"
FT                   /translation="MNAWKLKPGAGISGLKRSDATMRSPGPTEVVVKVHAASLNYRDLM
FT                   FARGDYLGIGDAPLIPLCDGAGEVVETGRDVSRFKSGDRVVNTYFPRWIDGAPAPWKVD
FT                   SSPGAKVNGVLAERFLVDETALAAIPAHLGYEEASTLSCVGVTAWNALFVDGDAKPGST
FT                   VVLLGTGGVSIFALQLARAAGLRTIITSSSDEKLERARKLGADETINYRARPEWQNEVL
FT                   RLTDGVGADIVLEIGGRDTLPRSVAATKMGGLVSVIGGVSGFSGPELGLLPVIGGIKRL
FT                   HGIMVGSRSMLDEVVRLVSAHRIRPVVDHVFGFDDAPAAYRHLESGQHFGKVVVRIDA"
FT                   /protein_id="YP_003606816.1"
FT   misc_feature    complement(75858..76868)
FT                   /note="Medium chain dehydrogenases/reductase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR7; cd08276"
FT                   /db_xref="CDD:176237"
FT                   /locus_tag="BC1002_3263"
FT   misc_feature    complement(75858..76868)
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="BC1002_3263"
FT   misc_feature    complement(order(76011..76019,76092..76097,76152..76154,
FT                   76158..76163,76236..76238,76281..76283,76293..76298,
FT                   76350..76367,76428..76430,76440..76442,76734..76736,
FT                   76743..76751))
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176237"
FT                   /locus_tag="BC1002_3263"
FT   gene            76992..77900
FT                   /db_xref="GeneID:9112567"
FT                   /locus_tag="BC1002_3264"
FT   CDS_pept        76992..77900
FT                   /locus_tag="BC1002_3264"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bmj:BMULJ_03381 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295698924"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112567"
FT                   /translation="MDDRLRGIAEFVDVVDAGTFAAAGERLGVTRSAIAKIVARLEQRL
FT                   GVRLLQRTTRHLSLTDEGHAYYEQCRRVMAELGAVEATLEAGRRDPSGRLRITAPVLFG
FT                   RQCVAPVMLKLVERHPLLDVEMSFSDRVSDLVEDGFDIAVRIGPLPDHATLVGRRLGVQ
FT                   RMGICASPAWLDRHGRPSGLAELGSHVSIAYGRGGQSTPWRVLGADGEVQECRLSARLR
FT                   YDDLQAIADAAAAGAGLAWLPCWLVAPYLRDGRLSLVMDSNSVQGAEVHVIRPQSRHLP
FT                   SKVRVAIDALVDEIPRVLARV"
FT                   /protein_id="YP_003606817.1"
FT   misc_feature    76998..77885
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="BC1002_3264"
FT   misc_feature    77004..77183
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3264"
FT   misc_feature    77268..77864
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_CrgA_like_6; cd08475"
FT                   /db_xref="CDD:176164"
FT                   /locus_tag="BC1002_3264"
FT   misc_feature    order(77298..77300,77310..77312,77427..77429,77472..77474,
FT                   77478..77480,77667..77669,77718..77720,77799..77801)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176164"
FT                   /locus_tag="BC1002_3264"
FT   misc_feature    order(77301..77306,77316..77321,77325..77330,77337..77339,
FT                   77349..77351,77355..77375,77559..77561,77649..77663,
FT                   77682..77687,77694..77696)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176164"
FT                   /locus_tag="BC1002_3264"
FT   gene            complement(78046..79350)
FT                   /db_xref="GeneID:9112568"
FT                   /locus_tag="BC1002_3265"
FT   CDS_pept        complement(78046..79350)
FT                   /locus_tag="BC1002_3265"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_5189 major facilitator transporter"
FT                   /db_xref="GI:295698925"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112568"
FT                   /translation="MNRTMSAEQAVVKKVAWRLMPLLIVMFLIAFIDRQNVGFAKLQMV
FT                   HALRMSEASYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMATWGAITVAMAFTH
FT                   STGLFYVFRFALGVAEAGFYPGVIFYLTLWFPQSHRTRMLGFFTLGSALANMLGSLAGG
FT                   LLLSLDGNLGLAGWQWVFVATGIPAVLVALVALRFLPESVERAPFLSNEEKALMIAALR
FT                   REAPAQAAAGHPWRALVDKRVLMFACGYMLMSTSLYGVTYWLPTLLKSGGVSHSSLNGL
FT                   LNMIPWMLSALLLLWLPAKLKREGVVLSSMALVAGVGVIGFALSLVLPGLPLQFAALVL
FT                   GGACIPLLYPCFWSLPPRYFTGARAAASIAAINSIGNLGGFFAQNLMPYIGKVAGNASA
FT                   PMLVPVVCLTLLGLGMSIASARTKAGERVRIAARQ"
FT                   /protein_id="YP_003606818.1"
FT   misc_feature    complement(<78907..79287)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3265"
FT   misc_feature    complement(78271..79272)
FT                   /note="d-galactonate transporter; Region: 2A0114;
FT                   TIGR00893"
FT                   /db_xref="CDD:162094"
FT                   /locus_tag="BC1002_3265"
FT   gene            79519..80241
FT                   /db_xref="GeneID:9112569"
FT                   /locus_tag="BC1002_3266"
FT   CDS_pept        79519..80241
FT                   /locus_tag="BC1002_3266"
FT                   /gene_family="HOG000228717" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5190 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="GI:295698926"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112569"
FT                   /translation="MPADERLPRYQRLRDEMVALIAARHWRPGEAIPTEQALAKSYDVA
FT                   VGTVRKAVDLLVAEGLLERFQGRGTFVRRASFDSSLFRFFRFQTRQGERRIPESRILRR
FT                   EVVDAPSAVAAILQISSSARVIQMTRLRLIDDVPMLAEEIWLPYVRFAAFAQMDLNEVG
FT                   DLLYPVYEAQCNQVVASATETLTVEAIGPLHARLLRIEPGTPAVVIERLAYGYDRQPLE
FT                   WRRSRGPASEFIYQAEIR"
FT                   /protein_id="YP_003606819.1"
FT   misc_feature    79534..80235
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PhnF; COG2188"
FT                   /db_xref="CDD:32371"
FT                   /locus_tag="BC1002_3266"
FT   misc_feature    79540..79734
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3266"
FT   misc_feature    order(79540..79542,79546..79548,79615..79617,79621..79626,
FT                   79648..79662,79666..79671,79678..79680,79708..79713,
FT                   79717..79728)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3266"
FT   misc_feature    79801..80217
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="BC1002_3266"
FT   gene            80303..81595
FT                   /db_xref="GeneID:9112570"
FT                   /locus_tag="BC1002_3267"
FT   CDS_pept        80303..81595
FT                   /locus_tag="BC1002_3267"
FT                   /gene_family="HOG000136135" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_5191 major facilitator transporter"
FT                   /db_xref="GI:295698927"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112570"
FT                   /translation="MFKWFSQISGNERRTFWACFGGWALDSLDVQMFSLVIPAIIAEWS
FT                   ISRTQAGLVSGVTLVASALGGWIAGMMSDRLGRVKTLQWTVACFSVFTFLCAFAQNYPQ
FT                   FLVLKTLQGFGFGGEWAAGAVLMAETIRNEHRGKAMGSVQSAWAVGWGAAVLLYALMFS
FT                   LLPADTAWRVMFGVGIVPALLILYVRRGVQEPAAPARAARNARARQQPTPGLVVGIFSP
FT                   QVLRMTLLGALLGVGAHGGYYALMTWLPTFLKSERHLSVLSTGGYLAVVIVAFFCGCLV
FT                   SAQLLDRIGRRKTILTFAICCVITVIAYLFLPLGNTAMLFFGFPLGFFAAGIPASMGAL
FT                   FNELYPRGMRGTGVGFCYNFGRVVSAGFPVLVGHMSATMSLGTAIGIDAGLAYAIVVLS
FT                   VLMLPETRGRMLDEATLEPEHAGALSHAQRH"
FT                   /protein_id="YP_003606820.1"
FT   misc_feature    80342..81427
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BC1002_3267"
FT   misc_feature    80348..81508
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3267"
FT   misc_feature    order(80390..80392,80399..80407,80411..80416,80465..80467,
FT                   80474..80479,80486..80488,80498..80503,80507..80512,
FT                   80648..80653,80660..80665,80672..80677,80684..80686,
FT                   80720..80725,80732..80737,80753..80755,80969..80971,
FT                   80978..80983,81038..81043,81050..81052,81092..81094,
FT                   81104..81106,81116..81118,81125..81127,81137..81139,
FT                   81281..81283,81290..81295,81302..81304,81314..81319,
FT                   81326..81328,81359..81364,81371..81376,81383..81388,
FT                   81395..81397)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3267"
FT   gene            81647..82522
FT                   /db_xref="GeneID:9112571"
FT                   /locus_tag="BC1002_3268"
FT   CDS_pept        81647..82522
FT                   /locus_tag="BC1002_3268"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bph:Bphy_5192
FT                   amidohydrolase 2"
FT                   /db_xref="GI:295698928"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:9112571"
FT                   /translation="MMEKSGIEASHRQAVHRPAHIASVDTHAHVFERSLPLAEKRRYVP
FT                   DYDATLDAYLAQLDTHGVSHGVLVQPSFLGTDCSYMLDALRRAPQQLRGVAVIERDCRI
FT                   DTLTEMANAGIAGIRLNLIGHPDQPLDRWVSAQTLAHVRDLKWHVEVHAEAARLQGIVE
FT                   PLLDAGMNVVVDHFGRPDPEIGVRDVGFRRLLELADTQRVWVKISAAYRNRRQLRPDDH
FT                   DAREAFHFLKAAFGVHRLMWGSDWPHTQFEADEDFTHALELLRVLLPVDEERTVVLADT
FT                   PARLYRFDIA"
FT                   /protein_id="YP_003606821.1"
FT   misc_feature    81713..82501
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="BC1002_3268"
FT   misc_feature    81716..82510
FT                   /note="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold [General function prediction only]; Region:
FT                   COG3618"
FT                   /db_xref="CDD:33417"
FT                   /locus_tag="BC1002_3268"
FT   misc_feature    order(81725..81727,81731..81733,82088..82090,82172..82174,
FT                   82379..82381)
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="BC1002_3268"
FT   gene            complement(82627..83544)
FT                   /db_xref="GeneID:9112572"
FT                   /locus_tag="BC1002_3269"
FT   CDS_pept        complement(82627..83544)
FT                   /locus_tag="BC1002_3269"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: reu:Reut_B5695 regulatory protein, LysR:LysR,
FT                   substrate-binding"
FT                   /db_xref="GI:295698929"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112572"
FT                   /translation="MRLRIDLRQLECFVSVAEEGTFRAAAERLHMSQPPLSRQIKQLES
FT                   ELGVTLLTRDSAGAELTTAGRAFLKGARKTLLQAAEAIETARRHSTGRPRQLRVGYSKV
FT                   FDPEIFPSLEPAFKKAVRGGSLVFVAAISIELIRRLRRGALDVALIGLPSATGELVVEP
FT                   LHKEPLVAVIPARHPLARHKVLSIAQLNDQPVFWPQRRTNPGFFDYYEEVFAKLGHAPS
FT                   RRLLEPADHHLLLAEVANGRGIGFIPKSMTKMRRAGATFRPLKEREFWIGFGLAYRDAQ
FT                   HGPELDALLRIARRKTALLPRGME"
FT                   /protein_id="YP_003606822.1"
FT   misc_feature    complement(82648..83532)
FT                   /note="DNA-binding transcriptional regulator HcaR;
FT                   Provisional; Region: PRK09906"
FT                   /db_xref="CDD:170151"
FT                   /locus_tag="BC1002_3269"
FT   misc_feature    complement(83347..83526)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3269"
FT   misc_feature    complement(82666..83259)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="BC1002_3269"
FT   misc_feature    complement(order(82771..82773,82825..82830,82834..82839,
FT                   82855..82860,82918..82923,83023..83025,83155..83157,
FT                   83161..83163,83167..83169,83191..83193,83200..83205,
FT                   83209..83214,83221..83223,83242..83244))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="BC1002_3269"
FT   misc_feature    complement(order(82927..82929,82948..82953,83092..83094,
FT                   83239..83241))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="BC1002_3269"
FT   gene            83637..85058
FT                   /db_xref="GeneID:9112573"
FT                   /locus_tag="BC1002_3270"
FT   CDS_pept        83637..85058
FT                   /locus_tag="BC1002_3270"
FT                   /gene_family="HOG000107625" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /codon_start="1"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sme:SMa0316 hypothetical protein"
FT                   /db_xref="GI:295698930"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="GeneID:9112573"
FT                   /translation="MDTCKRRGILQRNTAARTLAAAAFAPIEAGRQITDGKAQMNGSTA
FT                   QTGMTALLGASAGETSAERFTRGIEVLKRIGGTGYDIPVNRLAQVAPDLARLTVEFGYG
FT                   DILSRPGLDLGLRQIATVAALMAHGSVQPQLKYHMTGFLNAGGEPAELVEMLFLAIAIL
FT                   GFPVSINAVGIVREIFRERGLAFDPIAPVSDDGTARYQRGLEVLDGLMANPEKYVEKLA
FT                   STSPELARWSVEFAFGEIFVREGLDPKARQIASISMLAAAGNRCDLLRLHIEAGLESGL
FT                   SRAEITEALMQLAVYAGFPSALNAFGVADAVFTKPEQKEKEGAGGRVSANAIVSETRKA
FT                   RSERGLATLARTSAQAGEAVVNSFNDLAPDIGRAIVEHSYGDIFSRAGLDAKTRELAAC
FT                   SALAAVGSKATETPLRVHANAALTAGATQAEIVETLLNVLPYRGYPAVEESMRVVGEEF
FT                   RKRSDHAQKAAGERQ"
FT                   /protein_id="YP_003606823.1"
FT   misc_feature    83889..84185
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_3270"
FT   misc_feature    84228..84581
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_3270"
FT   misc_feature    84708..85019
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_3270"
FT   gene            complement(85196..86002)
FT                   /db_xref="GeneID:9112574"
FT                   /locus_tag="BC1002_3271"
FT   CDS_pept        complement(85196..86002)
FT                   /locus_tag="BC1002_3271"
FT                   /gene_family="HOG000262997" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BamMC406_3384"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_3384 hypothetical protein"
FT                   /db_xref="GI:295698931"
FT                   /db_xref="GeneID:9112574"
FT                   /translation="MADLKSMLVRSNVACALVCMSLLAHAEMSADSAAVPNTTEPEISA
FT                   SADVLSTRPFVGDDPVAIRDALAGQSLNANSPSLSDRIRKLIHVPVPKAPSGLDSTKAS
FT                   LGRDLAFVVPAPYGIRYQSKTHLLTVDIDLSDDDNPGAILLKKTITGQRGRGLVVAPEA
FT                   KAKGYIQHIDLIELKSGERSKTRVRGRVTLSQTAFHEANGDFAIVLMCSMAPPYLTDRR
FT                   EHSDPTNDEPTDITTRTSTLYTNIHAIWLVSPQRGIVLSKKLHLSK"
FT                   /protein_id="YP_003606824.1"
FT   gene            complement(86202..88238)
FT                   /db_xref="GeneID:9112575"
FT                   /locus_tag="BC1002_3272"
FT   CDS_pept        complement(86202..88238)
FT                   /locus_tag="BC1002_3272"
FT                   /gene_family="HOG000258275" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF839"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   bxe:Bxe_B0622 putative exported alkaline phosphatase"
FT                   /db_xref="GI:295698932"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="GeneID:9112575"
FT                   /translation="MVIPILSPRYIPTTRNQENMVQSFDYSRRRALRIIAGAPMLPLGA
FT                   SAATTILGGCGGSSDLAAGNTPAPTAATFTAASFAGMAAPSLANPAAMAATTVGSTLTT
FT                   RYSDGSSRTYKLAYQPFFVTGDTVVNTTGGVIVAGGYFDINNQPIMDTSVPGKERQFFS
FT                   DCPDGTSLIRLDKPVVKGVKGNAVFAVVQFEYATRDQTETAAGDMYGKLPSPIAVLTLD
FT                   QDPTTGKLTLVSYSNVDTSGAHGLWITCGASLSPWNTHLSSEEYEPDAATIATNTQFQA
FT                   YSRNLYGSASAARPYHYGHLPEVTVHPDGTGTVKKHYCLGRISHELIQVMPDKRTVLMG
FT                   DDATNGGLFMFIADKQADLSAGTLYVAKWAQSSSAGAGAATLTWLKIGHATSDQIEALA
FT                   DTLTITDIMDVVTDEKNPPTDPTFTRIHFGGKFNWVRLKPGMEKAAAFLETHRYAALRG
FT                   ASMGFTKLEGTTVNAKDKILYSAMSQITASMVRGNDHSTDVALDKAITSGAVYALNMKG
FT                   GQRDLEGAAIDSEWVPIDMSAPAELVGEDLASADGLGNTANPEKIANPDNLKFSEKLRT
FT                   LFIGEDSGMHVNNFLWAYNVDTKALSRVLSCPAGAESTGLHAVDEINGWTYIMSNFQHA
FT                   GDWTSLHSKVQATLDPLVRANYRNRFGSAVGYLTADPTSIKLV"
FT                   /protein_id="YP_003606825.1"
FT   misc_feature    complement(<87141..>87491)
FT                   /note="Bacterial protein of unknown function (DUF839);
FT                   Region: DUF839; pfam05787"
FT                   /db_xref="CDD:114509"
FT                   /locus_tag="BC1002_3272"
FT   gene            88532..89083
FT                   /db_xref="GeneID:9112576"
FT                   /locus_tag="BC1002_3273"
FT   CDS_pept        88532..89083
FT                   /locus_tag="BC1002_3273"
FT                   /gene_family="HOG000078531" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcj:BCAM1559 putative acetyltransferase"
FT                   /db_xref="GI:295698933"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9112576"
FT                   /translation="MSTLVVDTTPLDPRSQPLLDALLHEYASRYEDYRKDGGAAAAQEM
FT                   ARYPADLFAPPHGAFILLVRDGETIGGGAFKRYDARTAELKRIWTRDDLRRQGLARQVV
FT                   QELEARALAQGYSRIYLTTGFKQPEAWALYERTGYTKLFDTALPPEVHVHLRFGKNLLA
FT                   PQRLDTLDDLRAKDADLAAR"
FT                   /protein_id="YP_003606826.1"
FT   misc_feature    <88583..>88774
FT                   /note="bifunctional biotin--[acetyl-CoA-carboxylase]
FT                   ligase/pantothenate kinase; Reviewed; Region: PRK13325"
FT                   /db_xref="CDD:171981"
FT                   /locus_tag="BC1002_3273"
FT   misc_feature    88709..88897
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="BC1002_3273"
FT   misc_feature    order(88793..88801,88829..88834)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="BC1002_3273"
FT   gene            89124..90053
FT                   /db_xref="GeneID:9112577"
FT                   /locus_tag="BC1002_3274"
FT   CDS_pept        89124..90053
FT                   /locus_tag="BC1002_3274"
FT                   /gene_family="HOG000190583" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="KEGG: bpd:BURPS668_A2408 cystine-binding periplasmic
FT                   protein FliY; PFAM: extracellular solute-binding protein
FT                   family 3; SMART: extracellular solute-binding protein
FT                   family 3"
FT                   /db_xref="GI:295698934"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:9112577"
FT                   /translation="MKTGLQLSSLVLVVMFYVGGNAFAATGFDLSPDQHGRVRAEQDAA
FT                   ATKAVPANFPFVAKDELTVGIVVAHPPISTYATDAKTVVGFDPDLAQLVADSLGRKLNV
FT                   VILAWPDWPLALASGKVDAVISNVTVTEERKVKFDFSTYRRDEVGFFVKTDSPIKSIRE
FT                   PKDVAGLRVITDAGTNQEKILLEWDKQNVAHGLKPIQVQYYDDDAVKSVALQSGRADAI
FT                   FSVNAALLYDSATHGKTRQVGTVSGGWPRTAEVAVTTRRGSGLAAPVTIALNDLIGKGQ
FT                   YRAVLERWNLGSEAIDKAATNPPGLPKS"
FT                   /protein_id="YP_003606827.1"
FT   misc_feature    89307..89990
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3274"
FT   misc_feature    89307..89990
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="BC1002_3274"
FT   misc_feature    order(89331..89333,89448..89450,89523..89525,89658..89660,
FT                   89796..89798)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3274"
FT   misc_feature    order(89745..89747,89757..89759,89775..89777)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3274"
FT   misc_feature    89874..89891
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3274"
FT   gene            90097..91098
FT                   /db_xref="GeneID:9112578"
FT                   /locus_tag="BC1002_3275"
FT   CDS_pept        90097..91098
FT                   /locus_tag="BC1002_3275"
FT                   /gene_family="HOG000190695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03558"
FT                   /codon_start="1"
FT                   /product="luciferase family oxidoreductase, group 1"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_A0739 luciferase-like
FT                   monooxygenase superfamily protein; TIGRFAM: luciferase
FT                   family oxidoreductase, group 1; PFAM: Luciferase-like,
FT                   subgroup"
FT                   /db_xref="GI:295698935"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="GeneID:9112578"
FT                   /translation="MTFSLSLLDKSPIAAGASAAEALRFTVSLAKRAEALGFKRFWIAE
FT                   HHGASNLASSAPEIVVSHVLAHTSRIRVGSGGVMLQHYSPFKVAETFRLLAALAPGRVD
FT                   FGIGKAPGGLPQTTRALQWLHDKKNKPGFNTQLAQLDAFLGAGVEPDHALAGAFAFPAP
FT                   PALPERILLGGSPDSAALAAKQGWQFCYAGHFNGDEANIERTVQTYRAASGRAPLLALY
FT                   AVAAATRDEAERLTGPLRIFRLQLASGQSLNLATAEAAEEYARQAGASGYTIEERHPHV
FT                   VKGTADDVRDQLDALSRRYGIDEFVIDSPLQHYPARLRSVELLGSTIEPAYA"
FT                   /protein_id="YP_003606828.1"
FT   misc_feature    90163..91074
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="BC1002_3275"
FT   misc_feature    90175..>90417
FT                   /note="Flavin-utilizing monoxygenases; Region:
FT                   Flavin_utilizing_monoxygenases; cl07892"
FT                   /db_xref="CDD:174883"
FT                   /locus_tag="BC1002_3275"
FT   gene            91137..92516
FT                   /db_xref="GeneID:9112579"
FT                   /locus_tag="BC1002_3276"
FT   CDS_pept        91137..92516
FT                   /locus_tag="BC1002_3276"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BURPS1106A_A2267"
FT                   /codon_start="1"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpl:BURPS1106A_A2267 flavin-dependent
FT                   oxidoreductase"
FT                   /db_xref="GI:295698936"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9112579"
FT                   /translation="MSHRKLNFGIMLQGAGSHMNSWKHPAGPADASVNLNFFVDTVRKA
FT                   EAHGIAFAFVADGLYINEKSVPHFLNRFEPVSILSALATVTSKIGLAGTVSTSYSDPFT
FT                   VARQFASLDLISGGRAGWNVVTTPLEGTAKNYGGSHPEHALRYEIADEYLSVAQGLWDS
FT                   WDDDAFVRDRERGVFFERDKLHTLDHEGKFFQVAGPLNIQRSAQGQPVIFQAGSSDAGI
FT                   ALAGKYADAVFTHSVSIEETRAFAQRVKDSAVEHGRSRDDVKIFPGISPIVGATVEEAE
FT                   AKYRAIRELLTIDEALAYLGRYFDHHDFTQYPLDEPFPELGEIGRNSFRSTTDRIKAEA
FT                   RRKGSTLREVALEVATPRTHFLGTPAQIADELIRWLDAGAADGFILGFAVQAQGLDDFV
FT                   RYVLPELERRGRYERTLTGSTLRDHLGLPRKASRYAAAAELADPADPADPADTANAAAV
FT                   A"
FT                   /protein_id="YP_003606829.1"
FT   misc_feature    91152..92372
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_3276"
FT   misc_feature    91158..92408
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_3276"
FT   misc_feature    order(91167..91169,91179..91181,91350..91352,91509..91511,
FT                   91572..91574,91791..91796)
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_3276"
FT   misc_feature    91416..91421
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_3276"
FT   gene            92536..94344
FT                   /db_xref="GeneID:9112580"
FT                   /locus_tag="BC1002_3277"
FT   CDS_pept        92536..94344
FT                   /locus_tag="BC1002_3277"
FT                   /gene_family="HOG000190919" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /codon_start="1"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: ABC transporter related;
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: bpl:BURPS1106A_A2265 ABC-type polar amino
FT                   acid transport system, ATPase component; SMART: AAA ATPase"
FT                   /db_xref="GI:295698937"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112580"
FT                   /translation="MNDTAELANPQLAAAHADALRERADYRIVPAKNRARLAGTVAAVL
FT                   LIGIVLESVLGNPRWGWNVFAEWFLSEPVLSGLGRTLLLTALGAAFGFALGVPIALARV
FT                   SRSPLLAGCAWAFVWLFRSIPLIVLLLILNNLGYLYETVHLGLPFTSVVVLDVPTTELI
FT                   SPFLAAVLGLTLNHAAFSAEVIRGGIQSVDHGQLEAAAALGLPRERQARRIVLPQAMRA
FT                   IVPTAFNDLIALAKGSSMVYVLAMPELFYTVQIIYRRNLEVIPLLMVATVWYLIILTVL
FT                   SAIQVYVERHFSRGVKRSAVPSAFGALLKSMGIARGGDVAHVEPFGDAKDNARAGASAS
FT                   LDQRWADQRDGARITIQQVSKSFGTLKVLDNVSLTMRPGSVTVILGQSGSGKSTLLRTI
FT                   NHLERVDGGLIDIDGELIGYRRDGDTLYELKEKEVLRRRVEVGMVFQSFNLFPHLTVLE
FT                   NIIEAPVALGRLSRAEAESLALSLLARVGLEAKAHAWPRQLSGGQQQRVAIARALALKP
FT                   KVLLFDEPTSALDPELVNEVLDVIKALARSGTTMVIVTHEIGFAREVADTIVFMDRGRV
FT                   IESGPPAQVLNEPRHARTREFLSRVL"
FT                   /protein_id="YP_003606830.1"
FT   misc_feature    92824..93381
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    order(92827..92832,92845..92847,92875..92886,92890..92919,
FT                   92974..92979,92983..92985,93058..93063,93067..93069,
FT                   93073..93075,93082..93087,93091..93093,93103..93108,
FT                   93115..93117,93166..93168,93208..93213,93220..93222,
FT                   93241..93252,93259..93264,93301..93306,93334..93339,
FT                   93346..93351,93355..93360,93367..93372,93379..93381)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    order(92893..92919,92968..92985,93241..93258)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    order(92983..92985,93043..93045,93259..93261,93295..93297,
FT                   93304..93306,93334..93336)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    order(93118..93156,93172..93177,93187..93189)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    93595..94341
FT                   /note="ABC-type polar amino acid transport system, ATPase
FT                   component [Amino acid transport and metabolism]; Region:
FT                   GlnQ; COG1126"
FT                   /db_xref="CDD:31323"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    93595..94263
FT                   /note="HisP and GlnQ are the ATP-binding components of the
FT                   bacterial periplasmic histidine and glutamine permeases,
FT                   repectively.  Histidine permease is a multisubunit complex
FT                   containing the HisQ and HisM integral membrane subunits and
FT                   two copies of HisP...; Region: ABC_HisP_GlnQ_permeases;
FT                   cd03262"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    93691..93714
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    order(93700..93705,93709..93717,93871..93873,94102..94107,
FT                   94201..94203)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    93862..93873
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    94030..94059
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    94090..94107
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    94114..94125
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   misc_feature    94189..94209
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73021"
FT                   /locus_tag="BC1002_3277"
FT   gene            94364..95317
FT                   /db_xref="GeneID:9112581"
FT                   /locus_tag="BC1002_3278"
FT   CDS_pept        94364..95317
FT                   /locus_tag="BC1002_3278"
FT                   /gene_family="HOG000190583" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_3864 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="GI:295698938"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9112581"
FT                   /translation="MTNRRQFILAGTALGALLVRNALDVANAAQAPHGTVDLSPEQPGR
FT                   IRVPKNPAAIAAIGNHYRFANDGNFTVAISPHLPPTATYAADARTVVGSDADYAQLIAD
FT                   SLELKLNLVPIAWADWPLGLTSGKYDAVISNVGVTEQRKEKFDFTTYRQGLHGFYVKTA
FT                   SPIRKIAQPQDIAGLRLITTSGTNQEKIILEWNRQNIAKGLKPVEFQYFDDDAASRIAL
FT                   LSGRADVVFNPNAPLAYDAATTGAIREVGTLNAGWPARADVAIATRKGSGLMDALTVAT
FT                   NGLIANGVYQRSLAHWGIESEALPRSESNPPGLPKF"
FT                   /protein_id="YP_003606831.1"
FT   misc_feature    94574..95257
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3278"
FT   misc_feature    94574..95257
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 3; Region: SBP_bac_3; pfam00497"
FT                   /db_xref="CDD:144186"
FT                   /locus_tag="BC1002_3278"
FT   misc_feature    order(94595..94597,94712..94714,94787..94789,94922..94924,
FT                   95060..95062)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3278"
FT   misc_feature    order(95009..95011,95021..95023,95039..95041)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3278"
FT   misc_feature    95138..95155
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3278"
FT   gene            95470..96366
FT                   /db_xref="GeneID:9112582"
FT                   /locus_tag="BC1002_3279"
FT   CDS_pept        95470..96366
FT                   /locus_tag="BC1002_3279"
FT                   /gene_family="HOG000165071" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.11.17"
FT                   /codon_start="1"
FT                   /EC_number="1.14.11.17"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0153 taurine dioxygenase; PFAM:
FT                   Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="GI:295698939"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="GeneID:9112582"
FT                   /translation="MTTTAAAFTAPAIPTQSFEIRAFDAPLGAEVLGLDLGQPLGDDDF
FT                   ARIHRAHLDHHVLVFRDQRITPEQQIAFSRRFGPLQIHVLHQFGLAGYPEVLVVSNVIE
FT                   NGKPVGLGDAGHYWHSDLSYKEKPSLGSLLHAQELPAEGGDTLFANMHLAWDTLPARLR
FT                   SAVEGRSAEHTYLAKYAELQKRSPWRPNLSAEQIAQVKPVVHPIVRTHPETGRKALFVS
FT                   EHFTTRVIGLPEDESRALLDELFAHSVRPEHLYRHRWAEHDMVFWDNRSLMHLAAGTPD
FT                   HLRRKLYRTTIEGDVPR"
FT                   /product="Taurine dioxygenase"
FT                   /protein_id="YP_003606832.1"
FT   misc_feature    95515..96360
FT                   /note="Probable taurine catabolism dioxygenase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: TauD; COG2175"
FT                   /db_xref="CDD:32358"
FT                   /locus_tag="BC1002_3279"
FT   misc_feature    95548..96360
FT                   /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
FT                   trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
FT                   carrying out three reactions in the biosynthesis of
FT                   clavulanic acid, an inhibitor of class A serine
FT                   beta-lactamases. In general, Fe(II)-2OG...; Region:
FT                   CAS_like; cl00184"
FT                   /db_xref="CDD:174021"
FT                   /locus_tag="BC1002_3279"
FT   gene            96422..97465
FT                   /db_xref="GeneID:9112583"
FT                   /locus_tag="BC1002_3280"
FT   CDS_pept        96422..97465
FT                   /locus_tag="BC1002_3280"
FT                   /gene_family="HOG000138597" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /codon_start="1"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bxe:Bxe_C0154 nitrate/sulfonate/bicarbonate ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295698940"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="GeneID:9112583"
FT                   /translation="MLSRFRPTAARPSSFRRLTALLLSLSMGAVVSAPAHAEGEIRVAE
FT                   QFGIVYLLLNVARDQHFIESEGRKQGLDIKVDWVKLSGGAAVNDALLSGAVDIAGAGVG
FT                   PLLTIWDRTHGKQNVKGVASLGNLPYYLVSNNPDVKTIADFTQKDRIALPAVNVSVQSR
FT                   VLQYAAAKRWGDKEYDRLDKYTQALPHPDAAAAIIAGGTEITGHFGNPPFQEQELAGNP
FT                   KAHIVLNSYDVLGGPSSATVLYATEKFRHDNPKTYRAFVDALADAAKYINANPQGAADI
FT                   YIRTNQSKIDRELLVKIITNPQVQFKIVPQNTLGLAQFMHRVGAIRNEPSSWKDYFFDD
FT                   PATAAGS"
FT                   /protein_id="YP_003606833.1"
FT   misc_feature    96467..97462
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components [Inorganic ion transport
FT                   and metabolism]; Region: TauA; COG0715"
FT                   /db_xref="CDD:31059"
FT                   /locus_tag="BC1002_3280"
FT   misc_feature    96647..>97252
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3280"
FT   gene            97551..98381
FT                   /db_xref="GeneID:9112584"
FT                   /locus_tag="BC1002_3281"
FT   CDS_pept        97551..98381
FT                   /locus_tag="BC1002_3281"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0155 nitrate/sulfonate/bicarbonate
FT                   ABC transporter ATPase; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:295698941"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112584"
FT                   /translation="MVANPTLLFPHDADRSAAATSGKLLAVENVNLEYRTRERIVRATH
FT                   DVSFDVYGGDRFVLLGPSGCGKSTLLKAVAGFIEPSAGSISLDGQRVRGPGADRIVVFQ
FT                   EFDQLPPWKTVVQNVAFPLRVAKKLSKAEAHERSLHYLDKVGLAAFADAYPHTLSGGMK
FT                   QRVAIARALAMQPRVLLMDEPFAALDALTRRKMQEELLRLWEEVNFTLLFVTHSIEEAL
FT                   VVGNRILLLSPHPGRVRAELNSHQYSQDSFGRADFQRSVARIHHLLFEQTEAVQ"
FT                   /protein_id="YP_003606834.1"
FT   misc_feature    97620..98375
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    97623..98276
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    97731..97754
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    order(97740..97745,97749..97757,97860..97862,98094..98099,
FT                   98196..98198)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    97851..97862
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    98022..98051
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    98082..98099
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    98106..98117
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   misc_feature    98184..98204
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_3281"
FT   gene            98378..99256
FT                   /db_xref="GeneID:9112585"
FT                   /locus_tag="BC1002_3282"
FT   CDS_pept        98378..99256
FT                   /locus_tag="BC1002_3282"
FT                   /gene_family="HOG000134231" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0156
FT                   nitrate/sulfonate/bicarbonate ABC transporter inner
FT                   membrane protein"
FT                   /db_xref="GI:295698942"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9112585"
FT                   /translation="MSTPVTLLPPVRDEYERPLEAPGDLAIEAPLPAAGRIFAHGWLRK
FT                   SLIALVLIAAWEIAARVINNDLLLPTFGATLSAFVQGVCSGELLAKTAVSMSVLLRGYL
FT                   LGAGFAFMLTSLAVSTRVGRDLLSMLTAMFNPLPSIALLPLALLWFGLGTGSLLFVLVH
FT                   AVLWPLALNTYSGFQSVPATLKMTGRNYGLTGLRHVLLILVPAALPSILAGLRVGWAFA
FT                   WRTLIAAELVFGASSGSGGLGWYIFQNRNELYTDRVFAGLAAVIVIGLLVEHLVFDTLE
FT                   RVTVRRWGVQQ"
FT                   /protein_id="YP_003606835.1"
FT   misc_feature    98498..99250
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_3282"
FT   gene            99471..100877
FT                   /db_xref="GeneID:9112586"
FT                   /locus_tag="BC1002_3283"
FT   CDS_pept        99471..100877
FT                   /locus_tag="BC1002_3283"
FT                   /gene_family="HOG000263885" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05694"
FT                   /codon_start="1"
FT                   /product="selenium-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: selenium-binding protein; KEGG: bpy:Bphyt_2095
FT                   selenium-binding protein"
FT                   /db_xref="GI:295698943"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="GeneID:9112586"
FT                   /translation="MGMRPDPTFHASPKLAMDAPAEEYAYTVLLSPDSSQPDALAVIDV
FT                   KPGSASYSQVVHTVPMPNKGDEFHHFGWNACSSALSPLTGHAFLERRYLIIPGMRSSRI
FT                   YIVDTKPHPTQAKIHKIIEPEEIFRKTGYSRPHTVHCGPEGIYVSTLGGGGKDGTDGPP
FT                   GIFIMDCQTFEVLGRWEIERGAQEKHYDFWWNLPRDYMVSTEWALPPQFENGIVPEDLL
FT                   SNKYGHRVHFWDLRARRNVQTLDLGANHQMALEVRPAHDPSREYGFIGVVVDTTNLEGS
FT                   IWTWWREGGHFHIEKTATIPPEPAHADELPPLLQGFGAVPPLVTDIDLSIDDKFLYVSC
FT                   WGTGEMRQYDVTEPRKPKLTGSVRIGGIERCTPHPSGKAFAGGPQMVEISRDGKRVYWT
FT                   NSLYSTWDDQFYPDGVPGVQVMAHADPNGGLKLAEDYFVEFPAGYRAHQIRLEGGDCST
FT                   DSFCYPSVGV"
FT                   /protein_id="YP_003606836.1"
FT   misc_feature    99477..100856
FT                   /note="56kDa selenium binding protein (SBP56); Region:
FT                   SBP56; pfam05694"
FT                   /db_xref="CDD:147702"
FT                   /locus_tag="BC1002_3283"
FT   gene            100886..101557
FT                   /db_xref="GeneID:9112587"
FT                   /locus_tag="BC1002_3284"
FT   CDS_pept        100886..101557
FT                   /locus_tag="BC1002_3284"
FT                   /gene_family="HOG000263886" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0089"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0089 hypothetical protein"
FT                   /db_xref="GI:295698944"
FT                   /db_xref="GeneID:9112587"
FT                   /translation="MSPQAALWLAVVASGVYHGLNPAMGWPLAVSNALMQRRSQALVVA
FT                   LLYLAAGHALAILLMMLPFAMLSSVLAWQRQMQIGASVLVIGFGLVLLMRRRHPRVLAR
FT                   IPPSRLALWSFAVAIAHGAGLMLVPIYLGLCRADAMDSAHKAAQALIETSLRMALSVSA
FT                   VHAATMTVAGGVLAWLVYRYLGLRFVSRSWFNLDAVWASSLILVGGVSLGLNATATGVS
FT                   G"
FT                   /protein_id="YP_003606837.1"
FT   gene            101673..101825
FT                   /db_xref="GeneID:9112588"
FT                   /locus_tag="BC1002_3285"
FT   CDS_pept        101673..101825
FT                   /locus_tag="BC1002_3285"
FT                   /gene_family="HOG000059021" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4169"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4169 hypothetical protein"
FT                   /db_xref="GI:295698945"
FT                   /db_xref="GeneID:9112588"
FT                   /translation="MPLKKGTSKETVSHNIKTESKHGKPHKQAVAIALNQARKSGGKIP
FT                   KKSEK"
FT                   /protein_id="YP_003606838.1"
FT   gene            101856..102518
FT                   /db_xref="GeneID:9112589"
FT                   /locus_tag="BC1002_3286"
FT   CDS_pept        101856..102518
FT                   /locus_tag="BC1002_3286"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B0404 phage SPO1 DNA
FT                   polymerase-related protein; TIGRFAM: phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="GI:295698946"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:9112589"
FT                   /translation="MTDRPQKKRARGDAQSEPADVEPDQHPAKLGDCRRCALWRNATQA
FT                   VPGEGQRHASIVLVGEQPGDMEDLQGKPFVGPAGALLDRALEEAGVKRNDVYVTNAVKH
FT                   FKWIARGKRRLHKTPAQREVDACSYWLEQELDMPDVRVVVALGATALKAVVDDPHARLQ
FT                   DAFDKTLERGEQRVVATYHPSFALRAPDPETRREVYQRIVAALRTAQKLAHGGKRSG"
FT                   /protein_id="YP_003606839.1"
FT   misc_feature    101937..102476
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:174234"
FT                   /locus_tag="BC1002_3286"
FT   gene            complement(102510..103421)
FT                   /db_xref="GeneID:9112590"
FT                   /locus_tag="BC1002_3287"
FT   CDS_pept        complement(102510..103421)
FT                   /locus_tag="BC1002_3287"
FT                   /gene_family="HOG000068666" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF72"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   bpy:Bphyt_2348 protein of unknown function DUF72"
FT                   /db_xref="GI:295698947"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="GeneID:9112590"
FT                   /translation="MKKTGDARIGISGWRYQGWRGSFYPEHLKHAAELQYASALFGTIE
FT                   INGTHYSLQSLDSWQRWYAQTPDGFVFGIKGARYLTHMLRFRDASARAGIANFFAQGLL
FT                   ALNEKLGPILWQFPPSFRFEPDAMERFLRELPPDTASAMALARQHDERVKTPYVDIDRN
FT                   RMLRHAVEVRHASFVDPAFVTLLRQYGVALVVSDSTEPWPVAEDLTADFVYIRLHGSEA
FT                   KYSGSYGDEALQRWAERIDAWRGGSQPADARLIAPQLAPRRRAARDVYCYFDNDVKARA
FT                   PFDAQRLMKNLRLQATHAPALP"
FT                   /protein_id="YP_003606840.1"
FT   misc_feature    complement(102552..103355)
FT                   /note="Protein of unknown function DUF72; Region: DUF72;
FT                   cl00777"
FT                   /db_xref="CDD:174384"
FT                   /locus_tag="BC1002_3287"
FT   gene            complement(103480..103713)
FT                   /db_xref="GeneID:9112591"
FT                   /locus_tag="BC1002_3288"
FT   CDS_pept        complement(103480..103713)
FT                   /locus_tag="BC1002_3288"
FT                   /gene_family="HOG000266268" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C1279"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C1279 hypothetical protein"
FT                   /db_xref="GI:295698948"
FT                   /db_xref="GeneID:9112591"
FT                   /translation="MSQHPAHSQDHRHPGQPNPADIEKALSGVNYPTTREKLVAQARKN
FT                   HANTDIVDLVDRLPDHNFDSPAAVAKEIARIQ"
FT                   /protein_id="YP_003606841.1"
FT   misc_feature    complement(103507..103638)
FT                   /note="Protein of unknown function (DUF2795); Region:
FT                   DUF2795; pfam11387"
FT                   /db_xref="CDD:151827"
FT                   /locus_tag="BC1002_3288"
FT   gene            103862..104800
FT                   /db_xref="GeneID:9112592"
FT                   /locus_tag="BC1002_3289"
FT   CDS_pept        103862..104800
FT                   /locus_tag="BC1002_3289"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bxe:Bxe_B0832 putative oxidoreductase"
FT                   /db_xref="GI:295698949"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112592"
FT                   /translation="MSTMLAYRIHSFGGPEVFKAERIEVPEPGAGEVLVRVRSAGVNPV
FT                   DLKTRSGQYPLIREEQLPFTLGRDFSGVVERVGEGAAQWRAGEQVYGFVGQGQGAYAEF
FT                   VLVPASALARAPEKLDAGTAGAVPLAALTAWQGLFDHGCLEAGGRVLIHAGAGGVGHFA
FT                   VQFARQKGAQVYATASGDGIEFVRSLGADRVIDYHAQRFEDVARDMDLVFDLIGGDTQR
FT                   RSWSAVATGGALISTLNEPSQTEASSHGARAARYTARPDGRQLTEIASLINNGSVRVAV
FT                   AERFSFDATAKALERLAKGHVRGKIVVDIAP"
FT                   /protein_id="YP_003606842.1"
FT   misc_feature    103871..104791
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="BC1002_3289"
FT   misc_feature    103871..104785
FT                   /note="alcohol dehydrogenase and quinone reductase-like
FT                   medium chain degydrogenases/reductases; Region: MDR_like_2;
FT                   cd05289"
FT                   /db_xref="CDD:176191"
FT                   /locus_tag="BC1002_3289"
FT   misc_feature    order(103988..103996,104003..104005,104246..104248,
FT                   104258..104260,104324..104341,104396..104401,
FT                   104405..104407,104447..104449,104504..104509,
FT                   104570..104575,104627..104635)
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176191"
FT                   /locus_tag="BC1002_3289"
FT   gene            complement(104825..105325)
FT                   /db_xref="GeneID:9112593"
FT                   /locus_tag="BC1002_3290"
FT   CDS_pept        complement(104825..105325)
FT                   /locus_tag="BC1002_3290"
FT                   /gene_family="HOG000221447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:BCAM2435 MarR family regulatory protein;
FT                   PFAM: regulatory protein MarR; SMART: regulatory protein
FT                   MarR"
FT                   /db_xref="GI:295698950"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112593"
FT                   /translation="MVTSTETSTSAISIDLYDQPGHLIRRAHQISVSMFHDLIGREVTP
FT                   VQYAVLRMLQELPGLDQVTLAQRVGLDTSTTADIAVRLEAKGWIVREVLPRRQRRLLLT
FT                   PAGEQLLDELIPGVNALNHGLLDGMGDDDARELLRLLRKFVHLNNDQSRAPLRSASDDA
FT                   TPS"
FT                   /protein_id="YP_003606843.1"
FT   misc_feature    complement(104939..105199)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3290"
FT   gene            105513..106613
FT                   /db_xref="GeneID:9112594"
FT                   /locus_tag="BC1002_3291"
FT   CDS_pept        105513..106613
FT                   /locus_tag="BC1002_3291"
FT                   /gene_family="HOG000218715" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /codon_start="1"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   bac:BamMC406_5124 vanillate monooxygenase"
FT                   /db_xref="GI:295698951"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="GeneID:9112594"
FT                   /translation="MFPKNAWYVACMPDEVADKPLGRQICGEPMVFYRNAEGAVVALED
FT                   FCPHRGAPLSLGFVRDGTLVCGYHGLEMGCQGKATGMPGQRVNGFPSIRSFPVIERYGF
FT                   VWVWPGDAAKADAAKLHHLEWAESAEWAYGGGLYHIRCDYRLMIDNLMDLTHETYVHAN
FT                   SIGQKEIDEAAPKTVAEGDTVRTSRFMENVAAPPFWKMALRGNGLADDVPVDRWQICHF
FT                   TPPSHVLIEVGVAHAGHGGYHAPADKKASSIVVDFITPETETSIWYFWGMARNFRPDDA
FT                   ALTASIREGQGKIFSEDLEMLERQQQNLLRWPERNLLKLNIDAGGVMSRRVIDRLVAQE
FT                   RAETGAPQAGAPRAEVTRVIPVRTAT"
FT                   /protein_id="YP_003606844.1"
FT   misc_feature    105513..106556
FT                   /note="Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit
FT                   [Inorganic ion transport and metabolism / General function
FT                   prediction only]; Region: HcaE; COG4638"
FT                   /db_xref="CDD:34257"
FT                   /locus_tag="BC1002_3291"
FT   misc_feature    105516..105842
FT                   /note="Rieske domain; a [2Fe-2S] cluster binding domain
FT                   commonly found in Rieske non-heme iron oxygenase (RO)
FT                   systems such as naphthalene and biphenyl dioxygenases, as
FT                   well as in plant/cyanobacterial chloroplast b6f and
FT                   mitochondrial cytochrome bc(1)...; Region: Rieske; cl00938"
FT                   /db_xref="CDD:174471"
FT                   /locus_tag="BC1002_3291"
FT   misc_feature    order(105651..105653,105657..105662,105708..105710,
FT                   105714..105719,105723..105725,105729..105731)
FT                   /note="iron-sulfur cluster; other site"
FT                   /db_xref="CDD:58538"
FT                   /locus_tag="BC1002_3291"
FT   misc_feature    order(105651..105653,105657..105662,105708..105710,
FT                   105717..105719,105723..105725)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58538"
FT                   /locus_tag="BC1002_3291"
FT   gene            106610..107575
FT                   /db_xref="GeneID:9112595"
FT                   /locus_tag="BC1002_3292"
FT   CDS_pept        106610..107575
FT                   /locus_tag="BC1002_3292"
FT                   /gene_family="HOG000141052" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.12.7"
FT                   /codon_start="1"
FT                   /EC_number="1.14.12.7"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_3499 ferredoxin; PFAM:
FT                   ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="GI:295698952"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="GeneID:9112595"
FT                   /translation="MNQPVLNVVVARRRDEALGIASFELASENGQALPAFDAGSHVDVH
FT                   LPNGLVRQYSLCNDPRETHRYLIAVLRDEAGRGGSKAVHDLLREGDRLQISAPRNHFAL
FT                   ADDAAHHLLLAGGIGVTPILCMAERLAATGASFDMHYCTRSKQRTAFVERLAQAGFANS
FT                   VQLHHDDHSGGSTFDIEQTLSDAPAGTHLYVCGPRGFMDLVLETARANGWAENRLHYEF
FT                   FGAAANQPATGGSFQVRIASSGATIDVPPECTVVQALAAHGVEVITSCEQGVCGTCLTR
FT                   ILSGEPDHQDSYLTDEERAANDQFLPCCSRAKSPLLVLDL"
FT                   /product="Phthalate 4,5-dioxygenase"
FT                   /protein_id="YP_003606845.1"
FT   misc_feature    106610..107386
FT                   /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
FT                   family 1 [Energy production and conversion]; Region: Hmp;
FT                   COG1018"
FT                   /db_xref="CDD:31221"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    106640..107281
FT                   /note="Phthalate dioxygenase reductase (PDR) is an
FT                   FMN-dependent reductase that mediates electron transfer
FT                   from NADH to FMN to an iron sulfur cluster. PDR has an an
FT                   N-terminal  ferrredoxin reductase (FNR)-like NAD(H) binding
FT                   domain and a C-terminal iron-...; Region: PDR_like;
FT                   cd06185"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(106763..106768,106772..106774,106814..106822,
FT                   106838..106840,106844..106849,106970..106972,
FT                   107276..107278)
FT                   /note="FMN-binding pocket; other site"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(106763..106765,106769..106774)
FT                   /note="flavin binding motif; other site"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(106838..106840,106847..106849,106856..106858,
FT                   106877..106879)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(106946..106948,106958..106969,106973..106975)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(106961..106966,107033..107041,107195..107200)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99782"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    107318..107563
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(107405..107410,107417..107419,107426..107428,
FT                   107432..107443,107528..107533)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3292"
FT   misc_feature    order(107417..107419,107432..107434,107441..107443,
FT                   107531..107533)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3292"
FT   gene            complement(107771..108040)
FT                   /db_xref="GeneID:9112596"
FT                   /locus_tag="BC1002_3293"
FT   CDS_pept        complement(107771..108040)
FT                   /locus_tag="BC1002_3293"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nodulin MtN21 family protein"
FT                   /db_xref="GI:295698953"
FT                   /db_xref="GeneID:9112596"
FT                   /translation="MKKLLICLAVGFNLLLAIFANALWWMLNPEAPLNFSNPVWKLAVR
FT                   MYGVKTAYQESDLAFLMSSAGIVLGFAAAIVLVWRSKKRSQRKP"
FT                   /protein_id="YP_003606846.1"
FT   gene            complement(108037..108510)
FT                   /db_xref="GeneID:9112597"
FT                   /locus_tag="BC1002_3294"
FT   CDS_pept        complement(108037..108510)
FT                   /locus_tag="BC1002_3294"
FT                   /gene_family="HOG000227263" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RSc2888"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RSc2888 hypothetical protein"
FT                   /db_xref="GI:295698954"
FT                   /db_xref="GeneID:9112597"
FT                   /translation="MFQCKFELNGKPMSEFRIGALSFPAYSGQGSYINKAAGTCTPRYG
FT                   AIPVGRYYIFDRRSGGLLGPWKDRLDLNGNHKSEWFALHAIDGDIDDDKVLCDGIIRGR
FT                   FRLHPKGRLGKSEGCITIDRLADWHHIRSIFTSTPKVSVPGSELKAYGEVIVR"
FT                   /protein_id="YP_003606847.1"
FT   misc_feature    complement(108073..108447)
FT                   /note="Protein of unknown function (DUF2778); Region:
FT                   DUF2778; pfam10908"
FT                   /db_xref="CDD:151355"
FT                   /locus_tag="BC1002_3294"
FT   gene            108777..109880
FT                   /db_xref="GeneID:9112598"
FT                   /locus_tag="BC1002_3295"
FT   CDS_pept        108777..109880
FT                   /locus_tag="BC1002_3295"
FT                   /gene_family="HOG000268576" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0079 putative cytochrome c oxidase
FT                   subunit II; TIGRFAM: cytochrome c oxidase, subunit II;
FT                   PFAM: cytochrome c oxidase subunit II; cytochrome c class
FT                   I"
FT                   /db_xref="GI:295698955"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="GeneID:9112598"
FT                   /translation="MARIKRSSLSAGSPVAAAEASGESGRRIRRGRVTLLPALAIGSTN
FT                   SAHANPVAPLNYFLHAAGPAARPTLYLGWVFTAIVTLVTLIVAGLLIGAMVRKRPAAQP
FT                   DALSAEPGGIRWVFIGTAVSSVVLLAMLVYALITLESVASPASSPQLTITVTAYDWWWK
FT                   ADYSDDPNPARNFSTANEIHIPVGEPVKIQLKSADVVHAFWVPQLAGKTQTIPGQTNEQ
FT                   WIQADHPGIYRGQCSQFCGAQHAHMAFEVIAQDAAAFNAWRDAQGRAASVPTGDAAVAA
FT                   GQHLFEERCAGCHTIRGTKATGLQAPDLTHLGSRRTIAAGTLSNTPDHLLDWIEHAQRI
FT                   KPDGLMPSIALTTSEAAALSAYLATLH"
FT                   /protein_id="YP_003606848.1"
FT   misc_feature    108957..109562
FT                   /note="cytochrome c oxidase, subunit II; Region: CoxB;
FT                   TIGR02866"
FT                   /db_xref="CDD:163049"
FT                   /locus_tag="BC1002_3295"
FT   misc_feature    109227..109517
FT                   /note="Cytochrome C oxidase subunit II, periplasmic domain;
FT                   Region: COX2; cl10078"
FT                   /db_xref="CDD:175074"
FT                   /locus_tag="BC1002_3295"
FT   misc_feature    109614..>109817
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="BC1002_3295"
FT   gene            109909..111906
FT                   /db_xref="GeneID:9112599"
FT                   /locus_tag="BC1002_3296"
FT   CDS_pept        109909..111906
FT                   /locus_tag="BC1002_3296"
FT                   /gene_family="HOG000085274" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /codon_start="1"
FT                   /EC_number="1.9.3.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   bxe:Bxe_C0080 putative cytochrome c oxidase subunit I;
FT                   PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="GI:295698956"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="GeneID:9112599"
FT                   /translation="MSDQPASASPPALTRTPRRGRVEPGSEQEKRLREIWESRPGWRGW
FT                   FSTVDHKTIGLRYLVSAFVFLLMGGVEALIMRVQLARPDATVLTPEQYNQLFTMHGLTM
FT                   IFLYALPVLSGFSNYLWPLVLGARDMAFPRLNALSYWVFLFAGIFLYASFPTGQAPDAG
FT                   WFNYVPLSGLEYSPGPNIDVYALGMVLLGISTTVGSMNFVVTLLRMRAPGMSLDRVPVL
FT                   VWGTLTASGGNLLAVPSVSLAFLMLWMDRRIGTHFFDVLNSGRPLLWQHLFWIFAHPWV
FT                   YVVVLPAMGIVSDALPVFCRRPLVGYGPVALATVATMVIGFAVWIHHMFATGIPALALS
FT                   FFGSASMVIAVPSAVATFAWVATIWTGRPVYRVPFLFFAGFVLLFVIGGVSGVMTAAVP
FT                   FDWQLTDTYFVVAHLHYVLLGINVFPVIGGIYFWFPKFTGRMTNERLGKLAFWVLFIGF
FT                   NVAFFPMHIAGLLGMPRRMYTYPADMGWNTVNLVTSLGSFLFAAGVLLFLIDIAVSLKR
FT                   GKLAGNNPWDAPTLEWSVSSPPPPYNFAVVPTLASRHPLWEGRVEEPGEAVQARSQLDE
FT                   GYLLAQGREALGTTALEASPDVILKMPEDSYAPFWLAVFAALLFAGLALTAWVFVGAML
FT                   AGCAVSIITWLWPERALIQREPVAVEDAGG"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /protein_id="YP_003606849.1"
FT   misc_feature    110020..111585
FT                   /note="Heme/copper-type cytochrome/quinol oxidases, subunit
FT                   1 [Energy production and conversion]; Region: CyoB;
FT                   COG0843"
FT                   /db_xref="CDD:31185"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    110041..111540
FT                   /note="Ubiquinol oxidase subunit I.  Ubiquinol oxidase, the
FT                   terminal oxidase in the respiratory chains of aerobic
FT                   bacteria, is a multi-chain transmembrane protein located in
FT                   the cell membrane.  It catalyzes the reduction of O2 and
FT                   simultaneously pumps protons...; Region:
FT                   Ubiquinol_Oxidase_I; cd01662"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110080..110082,110263..110265,110293..110295,
FT                   110314..110316,110323..110325,110488..110493,
FT                   110509..110511,110521..110523)
FT                   /note="D-pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110110..110112,110122..110124,110131..110136,
FT                   110182..110184,110191..110199)
FT                   /note="Putative ubiquinol binding site; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110206..110208,111151..111153,111163..111165,
FT                   111289..111291,111406..111408)
FT                   /note="Low-spin heme (heme b) binding site; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110701..110703,110716..110721,111109..111111,
FT                   111121..111126,111331..111333)
FT                   /note="Putative water exit pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110740..110742,110887..110892,111145..111147)
FT                   /note="Binuclear center (heme o3/CuB); other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110740..110742,110752..110754,110785..110787,
FT                   110887..110892,110965..110967,110974..110976)
FT                   /note="K-pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   misc_feature    order(110890..110892,111121..111126,111331..111336)
FT                   /note="Putative proton exit pathway; other site"
FT                   /db_xref="CDD:29933"
FT                   /locus_tag="BC1002_3296"
FT   gene            111908..112549
FT                   /db_xref="GeneID:9112600"
FT                   /locus_tag="BC1002_3297"
FT   CDS_pept        111908..112549
FT                   /locus_tag="BC1002_3297"
FT                   /gene_family="HOG000059009" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bxe:Bxe_C0081 putative cytochrome c oxidase subunit III"
FT                   /db_xref="GI:295698957"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="GeneID:9112600"
FT                   /translation="MSDALNFDRASSEPDETARALPVGSAGERSSGWWGCCTLIATEGA
FT                   LFGYLIFSYLYLASQSQQPWPPEGLPKLGLGSANTVILLSSSVFVWFCERCVRRRRLRL
FT                   GVASMAVSIVLGCIFMGIQLREWHNHPYGLTSHLYGSLYFTITGFHMAHVLVGIVVLTL
FT                   LAIWTALGYFDDKRCAALSIGGLYWHFVDMVWLFIFSTLYLTPYLFREWS"
FT                   /protein_id="YP_003606850.1"
FT   misc_feature    111977..112522
FT                   /note="Heme-copper oxidase subunit III subfamily.
FT                   Heme-copper oxidases are transmembrane protein complexes in
FT                   the respiratory chains of prokaryotes and mitochondria
FT                   which couple the reduction of molecular oxygen to water to,
FT                   proton pumping across the...; Region:
FT                   Heme_Cu_Oxidase_III_2; cd02865"
FT                   /db_xref="CDD:29489"
FT                   /locus_tag="BC1002_3297"
FT   misc_feature    order(111995..112000,112040..112042,112052..112057,
FT                   112316..112321,112328..112330,112340..112342)
FT                   /note="Subunit I/III interface; other site"
FT                   /db_xref="CDD:29489"
FT                   /locus_tag="BC1002_3297"
FT   gene            112546..112962
FT                   /db_xref="GeneID:9112601"
FT                   /locus_tag="BC1002_3298"
FT   CDS_pept        112546..112962
FT                   /locus_tag="BC1002_3298"
FT                   /gene_family="HOG000059008" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2186"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2186 hypothetical protein"
FT                   /db_xref="GI:295698958"
FT                   /db_xref="GeneID:9112601"
FT                   /translation="MTTVPRDSHISMRYVLIGLLAAPFAWLLQMMLAETLAAQACYPHN
FT                   HPLGAPLVSWMRPAIVALGAVCMIAGAFGTWVAWRNLRRVAPLKPGALNGERRTRAELD
FT                   WFLTHVAVMTSMLFLFALIATDVAVAIVSPCRWW"
FT                   /protein_id="YP_003606851.1"
FT   gene            112962..114290
FT                   /db_xref="GeneID:9112602"
FT                   /locus_tag="BC1002_3299"
FT   CDS_pept        112962..114290
FT                   /locus_tag="BC1002_3299"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /codon_start="1"
FT                   /EC_number="1.1.99.3"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0083 putative alcohol dehydrogenase
FT                   cytochrome c subunit; PFAM: cytochrome c class I"
FT                   /db_xref="GI:295698959"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="GeneID:9112602"
FT                   /translation="MTRDVPNTVRYAIAAACALTIAATANATSASTDAAQIARGAYLAK
FT                   AADCAGCHTAAPRVPHPGATPEATSPFAGGLSMGSPFGTIYTSNITPDPQYGIGRYSYD
FT                   DFARALREGIAPGGKRLYPAMPYPSFAKITDDDMHALYAYFMHGVQPVAVPAPQTRLPF
FT                   PFNQRWALMFWDWAFAPKGQFKADAKHDAQWNRGAYLVQSLGHCGACHTPRGPAYEERG
FT                   YDESASAYLTGGTNDHWFAPNLSADPGSGLGRSSATDIVDFLRKGHGGGLITFGSMVQV
FT                   VEDSTQYLNDDDVAAIAAYLKSLPPSAPSGYFNARSSAAQQTVQALRTGDVERPGAGIY
FT                   ASYCARCHQMDGAGVPHKYPRLAGNPAVLSASSASLVRLLVEGGGSPHTESGPEPHKMP
FT                   SFAGKLTDTEMARVLTFVRTTWGNTAGPVTRNDVSNVRGALHK"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /protein_id="YP_003606852.1"
FT   misc_feature    113547..113873
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="BC1002_3299"
FT   misc_feature    113967..114218
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="BC1002_3299"
FT   gene            complement(114307..114723)
FT                   /db_xref="GeneID:9112603"
FT                   /locus_tag="BC1002_3300"
FT   CDS_pept        complement(114307..114723)
FT                   /locus_tag="BC1002_3300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_5978"
FT                   /codon_start="1"
FT                   /product="fis family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_5978 fis family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295698960"
FT                   /db_xref="GeneID:9112603"
FT                   /translation="MLRPIVPAKAGEISLDYHMTLEALRSGVANQYHVGSMAQAIYMAM
FT                   LLNQRGYGPAVPELFRDAEGVILRCRQAGLETGICVVDHDAFALLGQVLTLFDQQLAVT
FT                   PVGELIAVNAKLKTLFSTANGHCDRNGNGDENPA"
FT                   /protein_id="YP_003606853.1"
FT   gene            complement(114897..115637)
FT                   /db_xref="GeneID:9112604"
FT                   /locus_tag="BC1002_3301"
FT   CDS_pept        complement(114897..115637)
FT                   /locus_tag="BC1002_3301"
FT                   /inference="protein motif:TFAM:TIGR01829"
FT                   /codon_start="1"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_0181 acetoacetyl-CoA reductase;
FT                   TIGRFAM: acetoacetyl-CoA reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295698961"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112604"
FT                   /translation="MANRVAYVTGGMGGIGTAICQRLHKENYTVIAGCGPNSTRKARWL
FT                   EDQKALGFNFIASEGNVADWESTAKAFEKVRKEVGEVDVLVNNAGITRDGMFRKMTYED
FT                   WQAVIDTNLTSLFNVTKQVIEGMVDRGFGRIINISSVNGQKGQFGQTNYSTAKAGIHGF
FT                   TMALAQEVATKNVTVNTVSPGYIGTDMVKAIRPEVLEKIVATIPVRRLGTPDEIASIVA
FT                   WIASDEAGFATGADFSLNGGLHMG"
FT                   /protein_id="YP_003606854.1"
FT   misc_feature    complement(114900..115637)
FT                   /note="acetyacetyl-CoA reductase; Provisional; Region:
FT                   PRK12938"
FT                   /db_xref="CDD:171822"
FT                   /locus_tag="BC1002_3301"
FT   misc_feature    complement(114903..115637)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3301"
FT   gene            116014..117705
FT                   /db_xref="GeneID:9112605"
FT                   /locus_tag="BC1002_3302"
FT   CDS_pept        116014..117705
FT                   /locus_tag="BC1002_3302"
FT                   /gene_family="HOG000003672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /codon_start="1"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1777 Na/Pi cotransporter II-related;
FT                   TIGRFAM: Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein"
FT                   /db_xref="GI:295698962"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR008170"
FT                   /db_xref="GeneID:9112605"
FT                   /translation="MTDYLADIDPDKLNILGIFGLLIGGLALFLLGLEFLTGGLKAIAG
FT                   SKLQSLIGVLTANRFRGVLAGAIVTALLNSSTITTVLMVGFVSAGLMTLAQSVPMIMGA
FT                   NIGSTITAQIIAFDVSRLTPYMLSIGFALHAFAPREVLRQIGRVVLGLGLLFMGIQLMG
FT                   ESTHPLRTYQPFIDAMQDMRNPFVGVIVGAVFTAIVQSSAATLAVVIALSGQGLMPLEA
FT                   AITLILGANVGTCGTALLASIGKPPEAVQVGIVHLVFNVLGVVIALFLIPQMAEFVRWI
FT                   SPSHPDLQGLERLAAEAPRQVANVHTLFSVANTLLLIWFTGPIARFAQLVVPERAKPAK
FT                   PAGDPQYLDESVLTVPALGLQRVRIELTRLGMQVLEVVQRGSQMVSTGTMEEINQMLDK
FT                   DKESDRLSFEILQYIGRLSKGEHSEEEGQQMVGYTQVTSHLESISGIVGTTLLSVAQQR
FT                   MTQQIDLLRLRDAATTQFSEAVIRNLEQAIRTIEAPDPEEVAKVIDAKAGIEKLAATAR
FT                   QVVLAKLQLADKADVVTFRLAMDLIEQGRQIAQFARAIAKNVAALQ"
FT                   /protein_id="YP_003606855.1"
FT   misc_feature    116134..117702
FT                   /note="Na+/phosphate symporter [Inorganic ion transport and
FT                   metabolism]; Region: NptA; COG1283"
FT                   /db_xref="CDD:31474"
FT                   /locus_tag="BC1002_3302"
FT   misc_feature    116134..116508
FT                   /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
FT                   pfam02690"
FT                   /db_xref="CDD:145706"
FT                   /locus_tag="BC1002_3302"
FT   misc_feature    116473..>116820
FT                   /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
FT                   pfam02690"
FT                   /db_xref="CDD:145706"
FT                   /locus_tag="BC1002_3302"
FT   gene            117978..118250
FT                   /db_xref="GeneID:9112606"
FT                   /locus_tag="BC1002_3303"
FT   CDS_pept        117978..118250
FT                   /locus_tag="BC1002_3303"
FT                   /gene_family="HOG000217109" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_2089"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpf:Rpic12D_2089 hypothetical protein"
FT                   /db_xref="GI:295698963"
FT                   /db_xref="GeneID:9112606"
FT                   /translation="MIRWLANWASQHAPTPEKQAERALNNLRMELFQAEQLVLDAQLRA
FT                   DYYRARLTFLEEVTRKGIEQVSDERKAPLEPPQPLRPGLKLTAAQ"
FT                   /protein_id="YP_003606856.1"
FT   gene            complement(118499..118900)
FT                   /db_xref="GeneID:9112607"
FT                   /locus_tag="BC1002_3304"
FT   CDS_pept        complement(118499..118900)
FT                   /locus_tag="BC1002_3304"
FT                   /gene_family="HOG000267265" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_1779"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_1779 hypothetical protein"
FT                   /db_xref="GI:295698964"
FT                   /db_xref="GeneID:9112607"
FT                   /translation="MSIFGDIVHKLFGKAKPDQPPPATEPTPDPTAASAATPNAPAAPA
FT                   PLSDVDVAAVMDQLVSESGQKLNWRTSIVDTMKALGVDSSLEHRKQLAQELKYSGDMND
FT                   SASMNIWLHKQVMQALVANGGKLPPDLAS"
FT                   /protein_id="YP_003606857.1"
FT   misc_feature    complement(118517..118894)
FT                   /note="Domain of unknown function (DUF3597); Region:
FT                   DUF3597; pfam12200"
FT                   /db_xref="CDD:152635"
FT                   /locus_tag="BC1002_3304"
FT   gene            complement(119015..119604)
FT                   /db_xref="GeneID:9112608"
FT                   /locus_tag="BC1002_3305"
FT                   /pseudo
FT   gene            complement(119652..121058)
FT                   /db_xref="GeneID:9112609"
FT                   /locus_tag="BC1002_3306"
FT                   /pseudo
FT   gene            complement(121043..121330)
FT                   /db_xref="GeneID:9112610"
FT                   /locus_tag="BC1002_3307"
FT   CDS_pept        complement(121043..121330)
FT                   /locus_tag="BC1002_3307"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5168 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="GI:295698965"
FT                   /db_xref="GeneID:9112610"
FT                   /translation="MKETPLIKWTFDSYNDEHRASSARQHFEIVQALENRNAAWAEAIT
FT                   RCHILAAEKAVLDRYQRGAPFVVAGRSPRIEAPHEQPSHNDAGDVKCRVP"
FT                   /protein_id="YP_003606858.1"
FT   misc_feature    complement(121178..>121288)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_3307"
FT   gene            121947..123302
FT                   /db_xref="GeneID:9112611"
FT                   /locus_tag="BC1002_3308"
FT   CDS_pept        121947..123302
FT                   /locus_tag="BC1002_3308"
FT                   /gene_family="HOG000114541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6376 major facilitator transporter"
FT                   /db_xref="GI:295698966"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112611"
FT                   /translation="MSTTSGNRIDIKKFIDERPISPYQWLLVVLCFLIVTADGMDVAIM
FT                   GFVAPSIIHDWGISRPEFGLVMSAAPIGLVIGALFAGPASDRIGRKWVLITSVFLFGVF
FT                   TIATAFTQSPFSMAALRLLSGVGLGAAMPNSTTLLSEYAPQRKRALLITVMFTGFNLGS
FT                   ALIGFAAGWLIPVHGWRSVLIFGGALPLVLIPFQIWLLPESARLLAVRGAPAQRIGKVL
FT                   GRVCGVRFAGNEVFVSNEPPLPTRKPIGVLFSQGYGSMTIALWVTYFMGLLVIYLLTGW
FT                   LPTLMKDAGLSVTTAANVTAMFQIGGTIGAVLVGWIMDKARPAPVISAAYIGGAVCVLG
FT                   LGYIGAMSSSLALLVFAAGFCMSGAQTGLNAFAPGRYPTVARATGVSWMLGMGRFGSIF
FT                   GSAIGGALLGFGWQFGAILAMLAIPATLAAIAILVSQRVGSTETAAQPNTAH"
FT                   /protein_id="YP_003606859.1"
FT   misc_feature    121974..123170
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BC1002_3308"
FT   misc_feature    122028..>122552
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3308"
FT   misc_feature    order(122070..122072,122079..122087,122091..122096,
FT                   122145..122147,122154..122159,122166..122168,
FT                   122178..122183,122187..122192,122328..122333,
FT                   122340..122345,122352..122357,122364..122366,
FT                   122400..122405,122412..122417,122433..122435)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3308"
FT   misc_feature    <122727..123191
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3308"
FT   gene            123374..124399
FT                   /db_xref="GeneID:9112612"
FT                   /locus_tag="BC1002_3309"
FT   CDS_pept        123374..124399
FT                   /locus_tag="BC1002_3309"
FT                   /gene_family="HOG000107712" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bph:Bphy_6375
FT                   amidohydrolase 2"
FT                   /db_xref="GI:295698967"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:9112612"
FT                   /translation="MIIDIHGHYTTAPKALETWRNRQIAGIKSPSEMPAVSELQISDDE
FT                   LRESIENNQLKLMRERGLDLTIFSPRASFMAHHIGDFEVSSTWAAICNELCYRVNQLFP
FT                   ENFVPAAMLPQSPGVDPATCIPELVKCVEQYGNVAINLNPDPSGGRWTSPPLSDRSWYP
FT                   IYEKMVEYDIPAMIHVSTSCNACFHTTGSHYLNADTTAFMQCLTSDLFRDFPTLRFVIP
FT                   HGGGAVPYHWGRFRGLAQEMKKPLLKDHLLNNVFFDTCVYHQPGIDLLTRVIPVDNILF
FT                   ASEMIGAVRGIDPETGHYFDDTKRYVEAADMNPQQRYKIYEGNARRVYPRLDALLKTKG
FT                   L"
FT                   /protein_id="YP_003606860.1"
FT   misc_feature    123524..124366
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="BC1002_3309"
FT   gene            124402..125085
FT                   /db_xref="GeneID:9112613"
FT                   /locus_tag="BC1002_3310"
FT   CDS_pept        124402..125085
FT                   /locus_tag="BC1002_3310"
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02798"
FT                   /codon_start="1"
FT                   /product="4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase/oxaloacetate decarboxylase"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6374 hypothetical protein; TIGRFAM:
FT                   4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate
FT                   decarboxylase; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="GI:295698968"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="GeneID:9112613"
FT                   /translation="MYEIGVVYRNIQRADADVAAKLGALGSATVHEAMGRTGLLQPYVR
FT                   PIYTGARASGTAVTVLLQPGDNWMLHVAAEQIRPGDVVVAGVTAESTDGYFGDLLATSF
FT                   QARGAHALIIDAGVRDVSVLTEMKFPVWSKAISAKGTVKATLGSVNIPVVCAGALVTPG
FT                   DVVVADDDGVVVVPAAVAQAVLDKAAAREANEAEKRAKLASGVLGLDMYNMRGPLEQAG
FT                   LRYKD"
FT                   /protein_id="YP_003606861.1"
FT   misc_feature    124408..125082
FT                   /note="Demethylmenaquinone methyltransferase; Region:
FT                   Methyltransf_6; cl00480"
FT                   /db_xref="CDD:176421"
FT                   /locus_tag="BC1002_3310"
FT   gene            125091..125807
FT                   /db_xref="GeneID:9112614"
FT                   /locus_tag="BC1002_3311"
FT   CDS_pept        125091..125807
FT                   /locus_tag="BC1002_3311"
FT                   /gene_family="HOG000107152" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Lcho_1278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lch:Lcho_1278 hypothetical protein"
FT                   /db_xref="GI:295698969"
FT                   /db_xref="GeneID:9112614"
FT                   /translation="MVAEINGQAARAPITGISSMATRQVLAELAASYERRTGQSVAIES
FT                   VGGVDAARRVENDEVFDIVVLAADAIERLVVTGYVEAASRVGLARSGIAVAVAAGATQP
FT                   DIATEAALRDAILGARSIGYSTGPSGTHLLKLFERWGIAGQIASRIVKAPPGVPVGTLV
FT                   ARGEVALGFQQMSELIHVPGIDVLGELPAAIQSTTTFTAAVCTAARHREAARALLTFLA
FT                   SREADGAKLQNGMLPA"
FT                   /protein_id="YP_003606862.1"
FT   misc_feature    125094..125804
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3311"
FT   gene            complement(125842..126858)
FT                   /db_xref="GeneID:9112615"
FT                   /locus_tag="BC1002_3312"
FT   CDS_pept        complement(125842..126858)
FT                   /locus_tag="BC1002_3312"
FT                   /gene_family="HOG000245498" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_3735"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3735 hypothetical protein"
FT                   /db_xref="GI:295698970"
FT                   /db_xref="GeneID:9112615"
FT                   /translation="MTIIKTGELGAEDAAVAPENMASLQSGDSAVAARGERPGLHAGAH
FT                   SAQGQAPSTVRKIKEAAKTLLPDAVFLSLLHHKCTGRYPNLIRPVTFNEKILQRNLRPD
FT                   PRYIDLTDKLLVRNYIARKIGDKHLIPLISAPDAFTPEVFDALPDAFVMKANHGSSFVE
FT                   VVRNKSETSFEKLKKLADQWLRTEFYYVGRERHYRSIEPRIFFEQLLLDQRGQIPADLK
FT                   MHCFGGRPEGPIIYILVISDRFGNATHGDVYDVDWNHLDIAIGDYKRSAAPGPRPPNLD
FT                   AVLDIAARLCEDFDYVRVDLYAPDDRVYFGELTFTPGAGVLPFTPDSIDYEWGKLMA"
FT                   /protein_id="YP_003606863.1"
FT   gene            complement(126918..127889)
FT                   /db_xref="GeneID:9112616"
FT                   /locus_tag="BC1002_3313"
FT   CDS_pept        complement(126918..127889)
FT                   /locus_tag="BC1002_3313"
FT                   /gene_family="HOG000152092" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="manually curated; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; KEGG: bph:Bphy_3734 AraC
FT                   family transcriptional regulator; SMART: Helix-turn-helix,
FT                   AraC domain"
FT                   /db_xref="GI:295698971"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:9112616"
FT                   /translation="MKHIGLFVFQDCSMASTGAIGDAFRLANEFKRTAGEEAPYRFTVV
FT                   SDGGGLVTSSSGISIWTQGLERYCLADFHAFFVACRDVTEVAESNDRFLSWISLQGSIA
FT                   SFGMQQGANLAVVCNDPLQSIVPIFLFDDSGDAARTQSNVTPTDLALAQIERDINTDTA
FT                   RKIGRILQTGYAEKSRSELDDVNITTTTEKIRESARWIKENYSKAISVAQAAESVAMSK
FT                   RNFQRRFKCEFGMTPLEYLLRTRFEIVRSMLKNTDLPVDKIARRCGMGDGNRLGRLFKE
FT                   RYGMSPTQFRAQQHVDAEERWLTPEESWSAATEMLRQAPLTL"
FT                   /protein_id="YP_003606864.1"
FT   misc_feature    complement(127002..127883)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="BC1002_3313"
FT   misc_feature    complement(<127599..127880)
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain; Region: GAT_1; cl00020"
FT                   /db_xref="CDD:173987"
FT                   /locus_tag="BC1002_3313"
FT   misc_feature    complement(127164..127289)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_3313"
FT   misc_feature    complement(127017..127124)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_3313"
FT   gene            128660..130981
FT                   /db_xref="GeneID:9112617"
FT                   /locus_tag="BC1002_3314"
FT   CDS_pept        128660..130981
FT                   /locus_tag="BC1002_3314"
FT                   /gene_family="HOG000153997" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /codon_start="1"
FT                   /EC_number="2.7.10.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   bph:Bphy_3733 exopolysaccharide tyrosine-protein kinase;
FT                   PFAM: lipopolysaccharide biosynthesis protein"
FT                   /db_xref="GI:295698972"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="GeneID:9112617"
FT                   /translation="MDYYPQNSLYPAVDTERRQLTASGMLTLMRDHIWEIVVTTVVVLT
FT                   LAVAYLLIATPIYSADVIVRVDPPEPNALGLALQNQELLPPPTPSSVTEMAVMESRSVL
FT                   QPVIDQFRFDISVKPHKLPVLGDIAEKFATPGQPSAPWLGLKSFAWGGERVQIAALDVP
FT                   RDLEEEKLTLTALDNGAFELHGPSGELLASGTVGMPVKQNGVSMLVKELAARPGTKFEV
FT                   IRWNELDAIKRFENLIKIGDKVKDSGLLQIQYRDKSPDKAAAVANALGQQYLASAVASR
FT                   QSNDTQTLAFINGELPRLLGDLRKAEEALKNFRSNSQSMQPTSEAQAYLQGGLDLDKQI
FT                   ATLQLQRTQMLERYTPQSRWVQNIDEQLAQLKEAKAKFSDHFNGMPASERASVDLIRAQ
FT                   KVAETVYLGMVQKAEQLQVRRASTTGGAHILDQAIRPHMPVMPQPILVLGGGLVLGIVS
FT                   GVVLVFMRRHVMIGVTDPRYVERQMSVPVFGEILFSHQQLLLDRDATAGRKSLPPATGR
FT                   AHPPLQKSLHEIQLDTGIQNRILAARFPHDTSVEALRSVRTAVTRDLAHARNNIVMIIG
FT                   PTPSAGKSFVAANLAILHAEVGQRVVLIDADMRRGHLASLFNESNRGGLSEVLAERLPL
FT                   RNALRSTRIDGLTFLSCGVRPENPAALLMKPRLKDVLERLSSQFDLVIIDTPPFLAVTD
FT                   ASIVANEAGASLLVLRSGMQSEEEIADTIRKVERAEGRIAGAVFNGIPLRRSRKNYGYE
FT                   TNYASDFGENDAGQQAPRGA"
FT                   /product="capsular exopolysaccharide family"
FT                   /protein_id="YP_003606865.1"
FT   misc_feature    128825..130936
FT                   /note="tyrosine kinase; Provisional; Region: PRK11519"
FT                   /db_xref="CDD:171145"
FT                   /locus_tag="BC1002_3314"
FT   misc_feature    130403..>130483
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:175213"
FT                   /locus_tag="BC1002_3314"
FT   gene            131041..132156
FT                   /db_xref="GeneID:9112618"
FT                   /locus_tag="BC1002_3315"
FT   CDS_pept        131041..132156
FT                   /locus_tag="BC1002_3315"
FT                   /gene_family="HOG000177518" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bph:Bphy_3732 glycosyl transferase group 1"
FT                   /db_xref="GI:295698973"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:9112618"
FT                   /translation="MAFAINGKFTSQTITGVQRVAYELTRAMQMRAAPGDEPELFLPQN
FT                   AVEPGALLKPQRRFPWLRGTLWEQITLPIAARGITLLSLCNTNPLFKHSQVVMVHDMAV
FT                   FDVPQGFSRKFRLWYRIVFTLLPRTNPIVLTVSTYSKMRICHHLKIDESRVKVVAPGAD
FT                   HLDRIVADPSVLQRLELNKDAYCVIVGSLDPRKNLRGVLDAIARLGHLRDVKFVIVGKQ
FT                   YPRIFSSAGVEHPLHSRQVVWAGFVSDEELKGLYENAGCLVFPSLYEGFGLPPLEAMYC
FT                   GCPVIASARTSIPEACGDAAMYCDATSADDIAAKIAQMMSDADLRQQYRSAGLLHAREF
FT                   RWERAAQQVLEILDVKTGERVPELAPRASAS"
FT                   /protein_id="YP_003606866.1"
FT   misc_feature    131044..132120
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="BC1002_3315"
FT   misc_feature    131050..132093
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. mtfB (mannosyltransferase
FT                   B) in E. coli has been shown to direct the growth of the
FT                   O9-specific polysaccharide chain. It transfers two mannoses
FT                   into the position 3 of the...; Region: GT1_mtfB_like;
FT                   cd03809"
FT                   /db_xref="CDD:99981"
FT                   /locus_tag="BC1002_3315"
FT   gene            132163..133632
FT                   /db_xref="GeneID:9112619"
FT                   /locus_tag="BC1002_3316"
FT   CDS_pept        132163..133632
FT                   /locus_tag="BC1002_3316"
FT                   /gene_family="HOG000055482" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_3731"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3731 hypothetical protein"
FT                   /db_xref="GI:295698974"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9112619"
FT                   /translation="MGTNMDRMKTRAGRRRTLRTLAALAAGAVAPLSDIRPALALVPEP
FT                   APANARARMMTDLIGTNGWAGSAADIEMWRAMGISWGRDSVGPGQPERRGEAMRIDKTS
FT                   SAFDVDLPSRLLRNERNGIGSLLMLGYTPRWNASVPGESNSAPVDVDAWKQYVDAVVRK
FT                   YSAPPYNLRYFQIWNEAAGRLSGGLQQSVFWRGPGFSKDEKRSKPYERAMQDYVERVHI
FT                   PAARIIRSYRAYVVYGGWPDQGGLDNFYRWLEYRSPALKERMLDWVDYIDTHYLPVGDM
FT                   ESLYQKYVKNGPARGIWQTEIGNEYMKDPHYLPRYFFDFAVWALGRNWDDPNKYLSMIY
FT                   HWEGYEPYRLTHPGPPERTYNVSGRSLVVLQETVGGHLASFSKPLQGGPGVAANALLSG
FT                   NDLVMQVSSSAGWQNISIGGLQALRAHAVKADFIDALSGEASAPGNVALSWENDSMNVR
FT                   FKVPDKVNGAGNNPPKHLAYLVVRSAAPAVA"
FT                   /protein_id="YP_003606867.1"
FT   gene            133702..134712
FT                   /db_xref="GeneID:9112620"
FT                   /locus_tag="BC1002_3317"
FT   CDS_pept        133702..134712
FT                   /locus_tag="BC1002_3317"
FT                   /gene_family="HOG000055546" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bph:Bphy_3730 glycosyl transferase family protein"
FT                   /db_xref="GI:295698975"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:9112620"
FT                   /translation="MKQVTIAICNYNYEHYLAAAIDSALAQDYPATTVMIVDDGSTDGS
FT                   RAIIESYGERVVALCKKNGGQVSAYNHAIASLSTEFVIFLDSDDVLYPSAVTEVMRFFE
FT                   DGEWAKVQFRLDVMDSEGALTGAYVPNSEPPPDCGSLLRGGWLYPSPPASGNAYRVSAL
FT                   KQIFPVPEEGVNRYGADFYAIYGVALAGPIATVSKSLGGYRVHNAGSETVSFANSEQLT
FT                   KAPRAFNMRWAILRNIAKDRLDIELPATFLDFSHEKATFCSSVYRATLFRRWRWMIRDS
FT                   RNYLHTIIANPFWSLKKKLGTLVLSSLCLVPYSPLSDFAVRYIANPLARRRVAGR"
FT                   /protein_id="YP_003606868.1"
FT   misc_feature    133717..>134016
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="BC1002_3317"
FT   misc_feature    order(133726..133728,133732..133734,133810..133812,
FT                   133957..133959,133963..133965)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="BC1002_3317"
FT   gene            134729..136045
FT                   /db_xref="GeneID:9112621"
FT                   /locus_tag="BC1002_3318"
FT   CDS_pept        134729..136045
FT                   /locus_tag="BC1002_3318"
FT                   /gene_family="HOG000051184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bph:Bphy_3729 polysaccharide biosynthesis protein"
FT                   /db_xref="GI:295698976"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="GeneID:9112621"
FT                   /translation="MDRRTSTNLIVFVYVGYFMRYVYLMIVVPFYGRVLGVAEYGRVLA
FT                   SMSLMNVIWMLVGFGFTFVGMREVAKAQSTQECNAIYSLHVSARLVLAVIGAGIGIIAT
FT                   FCSPLLAEQPLIGMLATLLGIVSACNLGWLFQGRQQIRTPVMIEVFGFALSLVLVLTLV
FT                   KGPNDAVWVLASLLIAGVVSLVIAYGLTTWQLGWPRLAFSGVLPLVRRSTMLFCYSSGS
FT                   VVLTASSTYLLTLFATPAEVGYFGAAERFATIGLSLMAPAAQVFIPTITRQLAQGDKAG
FT                   AHVTTRRGAVLLFGYGVLVLCGALALSPFVLPLILGAAFEPSVHVLQVFAWMFPFAAFN
FT                   EFVAMYVFVPRRKDRVLAIAGVASALVNLASALVLAPRFGAIGMASARVIGEAALSVTL
FT                   LSVLIRLELVGVLPGAERALARVRVVCGLRTQAGGAKDD"
FT                   /protein_id="YP_003606869.1"
FT   misc_feature    134801..135544
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt; cl10513"
FT                   /db_xref="CDD:175223"
FT                   /locus_tag="BC1002_3318"
FT   gene            136095..137285
FT                   /db_xref="GeneID:9112622"
FT                   /locus_tag="BC1002_3319"
FT   CDS_pept        136095..137285
FT                   /locus_tag="BC1002_3319"
FT                   /gene_family="HOG000228325" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bph:Bphy_3728 glycosyl transferase group 1"
FT                   /db_xref="GI:295698977"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:9112622"
FT                   /translation="MKVAIVHDWLVVSGGAEKVLKNIIECFPDADVFSIVDFLEDRECV
FT                   KGKSVNTSFIQKMPFARRRYRAYLPLMPIAIEQVDLSGYDLVISSSHAVAKGVLTGPNQ
FT                   VHISYIHSPIRYAWDLQHQYLRESHLDRGLRSALARVLLHYIRGWDSRSANGVDHLVAN
FT                   SQFIARRIRKAYQREATVIYPPVDLANMSIGTEKEDFYVTASRMVPYKRIDLIVQAFSQ
FT                   TPERKLVVIGDGPEMKKIKAVAGDNVKILGHQPSDVLVDHLRRARAFVFAAEEDFGISV
FT                   VEAQACGTPVIAFGRGGALESVVGLPLERPTGVFFGEQSTASLLEAVIRFESNAALFDA
FT                   RACRKNAERFSSENFKKALMGFVDARLPYACVEQFLPYAPSQSLPAEERHLADVAP"
FT                   /protein_id="YP_003606870.1"
FT   misc_feature    136095..137195
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="BC1002_3319"
FT   misc_feature    136098..137171
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases.  wbaZ in Salmonella
FT                   enterica has been shown to possess the mannosyl transferase
FT                   activity. The members of this family are found in certain
FT                   bacteria and Archaea; Region: GT1_wbaZ_like; cd03804"
FT                   /db_xref="CDD:99976"
FT                   /locus_tag="BC1002_3319"
FT   misc_feature    order(136137..136139,136704..136712,136866..136868,
FT                   136932..136934)
FT                   /note="putative ADP-binding pocket; other site"
FT                   /db_xref="CDD:99976"
FT                   /locus_tag="BC1002_3319"
FT   gene            complement(137261..138568)
FT                   /db_xref="GeneID:9112623"
FT                   /locus_tag="BC1002_3320"
FT   CDS_pept        complement(137261..138568)
FT                   /locus_tag="BC1002_3320"
FT                   /gene_family="HOG000055481" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /codon_start="1"
FT                   /product="O-antigen polymerase"
FT                   /transl_table="11"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bph:Bphy_3726
FT                   O-antigen polymerase"
FT                   /db_xref="GI:295698978"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="GeneID:9112623"
FT                   /translation="MAYLSLLALFMTVTNFVPISAIGFVPLLLLAWRFYGRTYPSFITP
FT                   LTAFTVLAIISTLLYDPQSFLEFDFYRRDGNFFISYLPIFAGCVYAHRWDLNKVLRTLF
FT                   IFAVVINLPMYAYFIAENGLFSIFTRPNDSFGSYFIARNAAGGFLAMLFCLGVACYLQK
FT                   RSKLLIVLLVCNALMLFSTYSRGSLLGAAAVLPYLYFGRKRWILGTLIAVLLLASAAIA
FT                   IYHTQPNVDYMGYTFAIHANDAKVNNLNIRYEWLWPRALAYFVQSPLVGLGFGSFDDHI
FT                   GSLSSYFHLFAVPSDIVIEHSDSHAHNSYLNILAELGVVGLTLILAFFWKLVEWSKQGA
FT                   AYAALVEGGRQFAAFRFVEISSVCLLVMSATEHRLVTPSNVLILSLVISLLLAARPLAA
FT                   TAFRPGPRGARKAGIVGARATPPVPRRPTQGATSAR"
FT                   /protein_id="YP_003606871.1"
FT   misc_feature    complement(137582..138562)
FT                   /note="Lipid A core - O-antigen ligase and related enzymes
FT                   [Cell envelope biogenesis, outer membrane]; Region: RfaL;
FT                   COG3307"
FT                   /db_xref="CDD:33116"
FT                   /locus_tag="BC1002_3320"
FT   misc_feature    complement(137591..138061)
FT                   /note="O-Antigen ligase; Region: Wzy_C; cl04850"
FT                   /db_xref="CDD:156339"
FT                   /locus_tag="BC1002_3320"
FT   gene            139200..140720
FT                   /db_xref="GeneID:9112624"
FT                   /locus_tag="BC1002_3321"
FT   CDS_pept        139200..140720
FT                   /locus_tag="BC1002_3321"
FT                   /gene_family="HOG000153549" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.8"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; KEGG:
FT                   bph:Bphy_3725 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase"
FT                   /db_xref="GI:295698979"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="GeneID:9112624"
FT                   /translation="MGKVTAAAAATDVETIRQDSGESEFPTLVQVILAGGSGTRLWPVS
FT                   REQFPKQLIDVIGKQTLLQATMGRMAGFDAAWNVAADPVIVCGTEHYFATYEQAREIGV
FT                   NARIVVEPARRDTAPALTLAALTACAEDEDAILVAMPADHAIANLEALHRSLGIAATHA
FT                   RNGAIVTLGVPPERPDTGFGYIRLGDALPDGARRIERFVEKPAAELAAQYVASGNYWWN
FT                   SGIFVVRASVWLAIIEQFQPDMHAACVQAYRDAKKTEECIMPDADGFLGSPSDSIDYAV
FT                   MEQLGKPESAFSGVVVPLEAGWSDLGSWDAVWQAMEKDDCGNAANGRVLFEGATATYAR
FT                   SQGGRLLACVGTNNMIVIETDDAVLVADRSHVQDIKGLVSRIRAEKSPEADAHRKVRRP
FT                   WGFYDSIDHGERFQVKRIVVMPGGRLSLQMHHHRAEHWVVVCGTALVTRGEEQFLLGEN
FT                   ESTYIPLGVRHRLENPGRVPLQIIEVQSGTYLGEDDIVRFDDKYGRCG"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /protein_id="YP_003606872.1"
FT   misc_feature    139290..140711
FT                   /note="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; Region:
FT                   GMP_PMI; TIGR01479"
FT                   /db_xref="CDD:162382"
FT                   /locus_tag="BC1002_3321"
FT   misc_feature    139290..140135
FT                   /note="GDP-M1P_Guanylyltransferase catalyzes the formation
FT                   of GDP-Mannose; Region: GDP-M1P_Guanylyltransferase;
FT                   cd02509"
FT                   /db_xref="CDD:133003"
FT                   /locus_tag="BC1002_3321"
FT   misc_feature    order(139296..139298,139302..139304,139626..139628)
FT                   /note="Substrate binding site; other site"
FT                   /db_xref="CDD:133003"
FT                   /locus_tag="BC1002_3321"
FT   misc_feature    140247..140699
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_3321"
FT   gene            140762..142144
FT                   /db_xref="GeneID:9112625"
FT                   /locus_tag="BC1002_3322"
FT   CDS_pept        140762..142144
FT                   /locus_tag="BC1002_3322"
FT                   /gene_family="HOG000153662" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /codon_start="1"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3724 undecaprenyl-phosphate glucose
FT                   phosphotransferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="GI:295698980"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="GeneID:9112625"
FT                   /translation="MRLLTGLLARAFDVAMIVAGAFAASQIRFDGGSQRSLYFAFVAFA
FT                   AAFALAVFPSLGVYQSWRGRSKRVLASQVALGWLVVQACAMALMFSLHRIDFVSRLWFV
FT                   YWTGISGAAMMSGRLVTHALLGRMRHAGMNLQQVAVAACGDHCDEIIRKIEMSPAAGFR
FT                   ANALYNLHPDCCVSPHPSVQVFEQQAAFARYVREQQIGEVWLALPLTEERAILKLVAEF
FT                   RNDLINVRFMPDVRSLALFEGSMTELLGLPTINLAASPLPPKALVQKDLFDRLFALVAL
FT                   IAISPILLGCAIAVKLSSRGPVFFKQRRKGADGRVFTIYKFRTMRLHEQKPGILEQATR
FT                   DDPRITSVGAFLRRTSLDELPQFFNVLRGDMSVVGPRPHALEHDDLYQNIVSGYIHRYR
FT                   IKPGITGWAQINGYRGETDRLEKMEGRVAHDLYYLRNWSFWLDMKIILATIFKGLHHPN
FT                   AY"
FT                   /protein_id="YP_003606873.1"
FT   misc_feature    140792..142141
FT                   /note="Undecaprenyl-phosphate glucose phosphotransferase;
FT                   Region: WcaJ_sugtrans; TIGR03023"
FT                   /db_xref="CDD:163109"
FT                   /locus_tag="BC1002_3322"
FT   misc_feature    141566..142141
FT                   /note="Bacterial sugar transferase; Region: Bac_transf;
FT                   cl00939"
FT                   /db_xref="CDD:154099"
FT                   /locus_tag="BC1002_3322"
FT   gene            142147..143232
FT                   /db_xref="GeneID:9112626"
FT                   /locus_tag="BC1002_3323"
FT   CDS_pept        142147..143232
FT                   /locus_tag="BC1002_3323"
FT                   /gene_family="HOG000056252" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4605"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4605 hypothetical protein"
FT                   /db_xref="GI:295698981"
FT                   /db_xref="GeneID:9112626"
FT                   /translation="MMLSGVENVVRRSAKRVSLYRFHHDHGLQARRILERLESKYGKAD
FT                   PNNLRLADTYARDVFGDPVYAPWLRVYTAFCGTFKEGWIPDNYYGIVVVPHMKGWYGKI
FT                   SSLKPISRLIFDGDELPDLAYFANGLFFTDKSVVVPERDLKDVVFEHTERVAFKLDGSG
FT                   QGNGVYFFDRANFDPAVIRSLGNGVIQTFIDQHSLFTAFASKPVATLRFTTVVDDAGRI
FT                   SVRACYLRLGRAEDTHVLADREICVSVNLETGELCDQGYMSDWGAVEAHPDSGVHFAGV
FT                   KIPCFDKCKATVLRLHRKIPFARCIGWDLTVDANDQVKLMEWNGKHNDVKFSEATQGPC
FT                   FADLNWERLRAEPDFGRLPPV"
FT                   /protein_id="YP_003606874.1"
FT   gene            143268..143603
FT                   /db_xref="GeneID:9112627"
FT                   /locus_tag="BC1002_3324"
FT   CDS_pept        143268..143603
FT                   /locus_tag="BC1002_3324"
FT                   /gene_family="HOG000058978" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_3723"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3723 hypothetical protein"
FT                   /db_xref="GI:295698982"
FT                   /db_xref="GeneID:9112627"
FT                   /translation="MSEQLWCVHIEGLNDFIAFDSEESARHEASAINAYIDRADRSSRA
FT                   ARLRAVVVEWPFSADGHARALDTDWHDLQRMPHRQQAGARSDSVLSNLARRVKEVLGVA
FT                   RADRDDA"
FT                   /protein_id="YP_003606875.1"
FT   gene            complement(143626..144039)
FT                   /db_xref="GeneID:9112628"
FT                   /locus_tag="BC1002_3325"
FT   CDS_pept        complement(143626..144039)
FT                   /locus_tag="BC1002_3325"
FT                   /gene_family="HOG000195382" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6119"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6119 hypothetical protein"
FT                   /db_xref="GI:295698983"
FT                   /db_xref="GeneID:9112628"
FT                   /translation="MAHYLNTATLLDLARAAQRRLEQQPAAAPCDCTRTLLDGWQSQPL
FT                   SLDETLFEEIGTLMPEDDPEPTFSEYLPNKTSYWSADAPIAPRYFPYNRCGVWQCSMCA
FT                   RLYLRYVEGGGYFVDRRIRALNADLIEDVPLPA"
FT                   /protein_id="YP_003606876.1"
FT   gene            complement(144259..144591)
FT                   /db_xref="GeneID:9112629"
FT                   /locus_tag="BC1002_3326"
FT   CDS_pept        complement(144259..144591)
FT                   /locus_tag="BC1002_3326"
FT                   /gene_family="HOG000059126" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6104"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6104 hypothetical protein"
FT                   /db_xref="GI:295698984"
FT                   /db_xref="GeneID:9112629"
FT                   /translation="MKRVVVSALVALCIAQPATQAVAQTVSNQCFALGDIAGQVASWRA
FT                   HKKTKAQALDQAAHYYKDPSDRAAVNAIIEKIYRPDAPHMTPDQASMAVTSECANQHKG
FT                   QAAPAQ"
FT                   /protein_id="YP_003606877.1"
FT   gene            complement(144757..144948)
FT                   /db_xref="GeneID:9112630"
FT                   /locus_tag="BC1002_3327"
FT                   /pseudo
FT   gene            144944..145363
FT                   /db_xref="GeneID:9112631"
FT                   /locus_tag="BC1002_3328"
FT                   /pseudo
FT   gene            complement(145484..146842)
FT                   /db_xref="GeneID:9112632"
FT                   /locus_tag="BC1002_3329"
FT   CDS_pept        complement(145484..146842)
FT                   /locus_tag="BC1002_3329"
FT                   /gene_family="HOG000114541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_6102 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:295698985"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112632"
FT                   /translation="MNRSPAVNVQTFINEHPFSPFQWLIFFMCFIIVLLDGFDTAAIGF
FT                   IAPSLVTEWGIEKPALAPVLSAALFGLACGALGSGPLSDRLGRRSMLIGSVLLFGLACL
FT                   ASAFSTSIDQLTVLRFITGVGLGAAMPNAVTMMGEYCPDRRRATVINLMFCGFPLGAAF
FT                   GGFLAAWMIPHLGWRSVLILGGVTPLLLLVLLLAKMPESVRYMVANNKPADRIRAALAR
FT                   ISGDAVQAVGFTMTETAPQTGGKGLGVVLSRSYIVGSVMLWLAYFMGLVIFYASINWMP
FT                   ILLKDAGLTPQRATLISALFPLGGVGAVLAGVLMDRFNANRVIAACYALTAISVYFIGQ
FT                   AAGNVGALVLIVFIAGVLMNTAQSSMPALAAAFYPTAGRGTGVAWMLGVGRFGGIAGSF
FT                   LVAELTRRHFSFGGIFTTIAAAGLLSCVALLIKQAARPQASEAGASKTQSFGH"
FT                   /protein_id="YP_003606878.1"
FT   misc_feature    complement(145631..146821)
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BC1002_3329"
FT   misc_feature    complement(<146306..146767)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3329"
FT   misc_feature    complement(order(146360..146362,146378..146383,
FT                   146390..146395,146429..146431,146438..146443,
FT                   146450..146455,146462..146467,146603..146608,
FT                   146612..146617,146627..146629,146636..146641,
FT                   146648..146650,146699..146704,146708..146716,
FT                   146723..146725))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3329"
FT   misc_feature    complement(145550..>146104)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3329"
FT   gene            complement(147215..148201)
FT                   /db_xref="GeneID:9112633"
FT                   /locus_tag="BC1002_3330"
FT   CDS_pept        complement(147215..148201)
FT                   /locus_tag="BC1002_3330"
FT                   /gene_family="HOG000225611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /codon_start="1"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bxe:Bxe_B1484
FT                   hypothetical protein"
FT                   /db_xref="GI:295698986"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="GeneID:9112633"
FT                   /translation="MSREAYPIEVEFPDIAQHEQSSSGIAYVHTFDSGMPGPHVMINAL
FT                   THGNEVCGAIIVDELLRRALRPRRGQLTLSFANVAAYRRFDPKNPDAARFVDQDFNRVW
FT                   TAAVLDDTSRTSSELKRARAMRPVIDSVDALLDLHSMHERCKPLIVAGPLEKGIDLAVR
FT                   LGTPATVICDEGHPEGRRMRDYEGFGDAASPKNALLIECGQHWERSAVAVARDTTARFL
FT                   LLAGVVDETDLPPGWLAPLPPEQNIVRVTQPVVATSMDFSFAAAYTGLEVFAKAGAVIG
FT                   WSNGEEVRTPYDNCMLVMPSLRQLRPGVTVVRLGRIERTVARPGVTG"
FT                   /protein_id="YP_003606879.1"
FT   misc_feature    complement(147260..148090)
FT                   /note="A functionally uncharacterized subgroup of the
FT                   Succinylglutamate desuccinylase (ASTE)/aspartoacylase
FT                   (ASPA) subfamily which is part of the M14 family of
FT                   metallocarboxypeptidases. ASTE catalyzes the fifth and last
FT                   step in arginine catabolism by the...; Region:
FT                   M14_ASTE_ASPA_like_7; cd06910"
FT                   /db_xref="CDD:133120"
FT                   /locus_tag="BC1002_3330"
FT   misc_feature    complement(order(147299..147301,147599..147601,
FT                   147635..147637,147647..147649,147755..147757,
FT                   147782..147787,147896..147901,147920..147922,
FT                   148052..148054,148061..148063))
FT                   /note="active site"
FT                   /db_xref="CDD:133120"
FT                   /locus_tag="BC1002_3330"
FT   misc_feature    complement(order(147785..147787,148052..148054,
FT                   148061..148063))
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133120"
FT                   /locus_tag="BC1002_3330"
FT   gene            complement(148406..149488)
FT                   /db_xref="GeneID:9112634"
FT                   /locus_tag="BC1002_3331"
FT   CDS_pept        complement(148406..149488)
FT                   /locus_tag="BC1002_3331"
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02089"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.73"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tartrate dehydrogenase; KEGG: bxe:Bxe_B1486
FT                   tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="GI:295698987"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="GeneID:9112634"
FT                   /translation="MANKYRIAVIPGDGIGVEVMPEALRVLEVATQRFGIELEYQHIEW
FT                   ASCDYYAKHGKMMPDDWKAQLQSADAILFGAVGWPDTVPDHISLWGSLLKFRREFDQYV
FT                   NLRPARLFAGVPSPLAGRKAGDIDFWIVRENTEGEYSSVGGVMFEGTEREFVLQESVFT
FT                   RHGSERVLKFAFDLAQRRARKKITVATKSNGIAISMPWWDKCAAGVAAQYPDVTWDKQH
FT                   IDILCARFVLNPDRFDVVVATNLFGDILSDLGPACTGTIGLAPSGNLNPDRKFPSLFEP
FT                   VHGSAPDIAGKHIANPIAMIWSAAMMLDFLGHSSGKERDAHDAILKAIEATLIEGPHTG
FT                   DLGGKASTSEVGKAIAAKLA"
FT                   /product="tartrate dehydrogenase"
FT                   /protein_id="YP_003606880.1"
FT   misc_feature    complement(148412..149482)
FT                   /note="isocitrate dehydrogenase; Validated; Region:
FT                   PRK06451"
FT                   /db_xref="CDD:168554"
FT                   /locus_tag="BC1002_3331"
FT   misc_feature    complement(148412..149476)
FT                   /note="Isocitrate/isopropylmalate dehydrogenase; Region:
FT                   Iso_dh; cl00445"
FT                   /db_xref="CDD:174206"
FT                   /locus_tag="BC1002_3331"
FT   gene            149733..150503
FT                   /db_xref="GeneID:9112635"
FT                   /locus_tag="BC1002_3332"
FT   CDS_pept        149733..150503
FT                   /locus_tag="BC1002_3332"
FT                   /gene_family="HOG000162423" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dae:Dtox_0138 hypothetical protein"
FT                   /db_xref="GI:295698988"
FT                   /db_xref="GeneID:9112635"
FT                   /translation="MTSLSLGSYHEVRERRYGRFFSISLYRSFNLHIRSPWLFDVDRWF
FT                   HFALPASVPREAHDDIVQGMEEARAAWLRYSPSMLLSHQSYELRDMLGRSDNRFHMYRM
FT                   RDDEVAKALYNEVKDGSLIFVPERDEMRKCVQAIREQPERASRPVPARPQPTSTEMASL
FT                   LYGKNPRAPQNLSNAQPFNYQPDMPDADAMQLAGADGRPGNNQAQNKQFKAVVKALGLN
FT                   KDEARRLHYDIQEDDLEYHGMVERALDLFGDKSK"
FT                   /protein_id="YP_003606881.1"
FT   gene            150500..150982
FT                   /db_xref="GeneID:9112636"
FT                   /locus_tag="BC1002_3333"
FT   CDS_pept        150500..150982
FT                   /locus_tag="BC1002_3333"
FT                   /gene_family="HOG000162424" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Avi_3476"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: avi:Avi_3476 hypothetical protein"
FT                   /db_xref="GI:295698989"
FT                   /db_xref="GeneID:9112636"
FT                   /translation="MIDTKEQVARHLSTLIGLDVSGVAHATDMLTLQFGPLREVRTSRG
FT                   TIKHLGDWALHIQCDWRIEQGNAIVTSHSDFAASEESTRTTTHRIRDLLVNQGPTAVLD
FT                   IEAGENGNAVISLARGMRLVILADAIADDEDWRLFPSNPDAKHFVIEGGKVDPSSL"
FT                   /protein_id="YP_003606882.1"
FT   gene            151274..151465
FT                   /db_xref="GeneID:9112637"
FT                   /locus_tag="BC1002_3334"
FT                   /pseudo
FT   gene            151784..152187
FT                   /db_xref="GeneID:9112638"
FT                   /locus_tag="BC1002_3335"
FT                   /pseudo
FT   gene            152240..152716
FT                   /db_xref="GeneID:9112639"
FT                   /locus_tag="BC1002_3336"
FT   CDS_pept        152240..152716
FT                   /locus_tag="BC1002_3336"
FT                   /gene_family="HOG000061273" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5054 hypothetical protein"
FT                   /db_xref="GI:295698990"
FT                   /db_xref="GeneID:9112639"
FT                   /translation="MRIDECGNRRPSGSNGRDAQTTVLGVSNLPDYHHLLRGRPHDHPS
FT                   SFNGKWTVTDVVGYSDVSGGIPEAKRLLGKVLSLSTDQIEFAGERCRPHGGFSLRSVDT
FT                   GPKLKDYYGINLDDTGLPRKTLLLDSDNCAAVFRMDAHRVVFGWNGVIVRAVQP"
FT                   /protein_id="YP_003606883.1"
FT   gene            complement(152750..154708)
FT                   /db_xref="GeneID:9112640"
FT                   /locus_tag="BC1002_3337"
FT   CDS_pept        complement(152750..154708)
FT                   /locus_tag="BC1002_3337"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02329"
FT                   /codon_start="1"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: propionate catabolism operon regulatory
FT                   protein PrpR; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; Propionate catabolism activator
FT                   domain protein; PAS fold-4 domain protein; helix-turn-helix
FT                   Fis-type; KEGG: bxe:Bxe_B2303 sigma-54 dependent
FT                   trancsriptional regulator; SMART: AAA ATPase; PAS domain
FT                   containing protein"
FT                   /db_xref="GI:295698991"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="GeneID:9112640"
FT                   /translation="MSTSLYEPPQRPRVWALSISRLRDLFFDIAGEYVDRADVRIVSHA
FT                   FEDAVREIEGAGAARPDVVLAGGSNGAYLKTRVSVPVVRISPTGYDVMHALARARREGA
FT                   RVALVTHGDTPDEVRRFTAAYALDVTFASYQSAQDAESVVLDLSDRGIDVVVGPGMVTD
FT                   LAANAGMDAVFLYSRASVRAGFDTALEVAQATRRETVRRQRLDTLLQHLRDGVVALDAQ
FT                   GRVELMNQRLASVLGIDAAKAVGRALLELAPDLAGSLPDAEGDSFCTVRGASYVVHRGP
FT                   LASSGAAPGTVLTFQESRAVERLDRTLRARQRVQQFTARYRLDDIVGASESIERVRALV
FT                   ARYARSDATVLILGESGTGKEMVAQSMHQLSARRDFAFVAINCGAFPEALLESELFGYE
FT                   EGAFTGARKGGKAGLIEVAHRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPMR
FT                   VDIRVVAATHRALTDAVAAGSFRADLYYRLNILSIALPPLRERPNDLLPLAAELLRQAA
FT                   AREPRLAARVPDAQTASCMLEGLGAALRRYAWPGNVRELQNVIERIVVELADSDADTDE
FT                   SAALVTRDMLRVIAPEIVEPITRAKPAALTLRERSRHVEADEIRAVLAAHEGDRDAACA
FT                   ALGISKTTLWRKLNGGR"
FT                   /protein_id="YP_003606884.1"
FT   misc_feature    complement(154121..154627)
FT                   /note="Propionate catabolism activator; Region: PrpR_N;
FT                   pfam06506"
FT                   /db_xref="CDD:148236"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(152762..154501)
FT                   /note="Transcriptional regulator containing PAS, AAA-type
FT                   ATPase, and DNA-binding domains [Transcription / Signal
FT                   transduction mechanisms]; Region: RocR; COG3829"
FT                   /db_xref="CDD:33622"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(<153947..154102)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(153239..153709)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(153626..153649)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(order(153305..153307,153431..153433,
FT                   153623..153646))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(153428..153445)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(153248..153250)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3337"
FT   misc_feature    complement(152765..152869)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="BC1002_3337"
FT   gene            154953..156122
FT                   /db_xref="GeneID:9112641"
FT                   /locus_tag="BC1002_3338"
FT   CDS_pept        154953..156122
FT                   /locus_tag="BC1002_3338"
FT                   /gene_family="HOG000021225" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /codon_start="1"
FT                   /EC_number="2.3.3.5"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 2-methylcitrate synthase/citrate synthase
FT                   II; KEGG: bxe:Bxe_B2302 methylcitrate synthase; PFAM:
FT                   Citrate synthase"
FT                   /db_xref="GI:295698992"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="GeneID:9112641"
FT                   /translation="MSEADNSTPNTGAFKPKKSVALSGVTAGNTALCTVGKTGNDLHYR
FT                   GYDILDIAEACEFEEVAYLLVHGKLPTQAELTAYKTRLKSMRGLPANVKAALEWIPAAA
FT                   HPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADKLMASLGSMLLYWYHYSHNGKRIEVE
FT                   TDDDSIGGHFLHLLHGVEPSKAWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDMYSA
FT                   ITGAIGALRGPKHGGANEAAFEIQSRYQTPDEAEADIRRRVENKEVVIGFGHPVYTISD
FT                   PRNKVIKEVAKKLSKEAGNTKLFSIAERLESVMWEAKKMFPNLDWFSAVSYHMMGVPTA
FT                   MFTPLFVISRTAGWSAHIIEQRIDNKIIRPSANYTGPDDLPFVPLAKRV"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /protein_id="YP_003606885.1"
FT   misc_feature    154953..156116
FT                   /note="Citrate synthase [Energy production and conversion];
FT                   Region: GltA; COG0372"
FT                   /db_xref="CDD:30721"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    155010..156107
FT                   /note="Subgroup of Escherichia coli (Ec) 2-methylcitrate
FT                   synthase (2MCS)_like. 2MCS catalyzes the condensation of
FT                   propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form
FT                   2-methylcitrate and coenzyme A (CoA) during propionate
FT                   metabolism. Citrate synthase (...; Region: Ec2MCS_like_1;
FT                   cd06117"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155010..155018,155025..155039,155223..155228,
FT                   155235..155240,155262..155264,155274..155276,
FT                   155286..155288,155295..155297,155439..155441,
FT                   155550..155564,155571..155576,155586..155588,
FT                   155595..155606,155613..155615,155634..155639,
FT                   155643..155654,155775..155777,156048..156080)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155019..155021,155550..155552,155559..155561,
FT                   155652..155660,155664..155666,155673..155675,
FT                   155754..155777,155784..155786,155799..155801,
FT                   155904..155906,155910..155912,155919..155921,
FT                   155925..155927,155988..155990,156000..156002,
FT                   156048..156050,156057..156059)
FT                   /note="active site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155019..155021,155550..155552,155559..155561,
FT                   155652..155657,155754..155759,155763..155777,
FT                   155799..155801,155919..155921,156000..156002)
FT                   /note="citrylCoA binding site; other site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155550..155552,155559..155561,155655..155660,
FT                   155772..155774,155799..155801,155925..155927,
FT                   155988..155990,156000..156002,156057..156059)
FT                   /note="oxalacetate/citrate binding site; other site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155652..155657,155664..155666,155673..155675,
FT                   155754..155771,155775..155777,155784..155786,
FT                   155904..155906,155910..155912,155919..155921,
FT                   155925..155927,156048..156050)
FT                   /note="coenzyme A binding site; other site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   misc_feature    order(155655..155657,155772..155774,155925..155927)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:99870"
FT                   /locus_tag="BC1002_3338"
FT   gene            156305..158902
FT                   /db_xref="GeneID:9112642"
FT                   /locus_tag="BC1002_3339"
FT   CDS_pept        156305..158902
FT                   /locus_tag="BC1002_3339"
FT                   /gene_family="HOG000025703" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02333"
FT                   /codon_start="1"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2301 aconitate hydratase; TIGRFAM:
FT                   2-methylisocitrate dehydratase, Fe/S-dependent; PFAM:
FT                   aconitate hydratase domain protein"
FT                   /db_xref="GI:295698993"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="GeneID:9112642"
FT                   /translation="MNTANRKRLPGTELDFFDTRAAVDAIEPGAYDKLPYTSRVLAENL
FT                   VRRCDPVTLTASLKQIIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIAAQGGD
FT                   PSLVNPVVPTQLVVDHSLAVECGGFDPDAFAKNRAIEDRRNEDRFDFINWTKRAFRNVD
FT                   VIPPGNGILHQINLERMSPVVQVKDGVAFPDTLVGTDSHTPMVDALGVIAIGVGGLEAE
FT                   SVMLGRASYMRLPDIVGVELSGKPGEGITATDVVLSLTEFLRKQKVVGAYLEFYGEGAA
FT                   NLTLGDRATIANMAPEFGATAAMFYIDEQTIRYLKLTGRDDELVKLVETYAKHTGLWAD
FT                   TLKRAEYERVLKFDLSTVVRTLAGPSNPHRRLPVSELAARGVSGKVENEPGLMPDGAVI
FT                   IAAITSCTNTNNPRNMIAAGLVARNANRRGLVRKPWVKSSLAPGSKAVTLYLEEAGLLP
FT                   ELEQLGFGVVAYACTSCNGMSGALDPVIQKEVIERDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVVAYAIAGTIRFDIEKDVLGVDADGHAVTLKDLWPSDAEIDAIVAASVKPE
FT                   QFRKVYEPMFALSADTGAKADPLYDWRAQSTYIRRPPYWEGALAGERTLQGMRALAVLG
FT                   DNITTDHLSPSNAILPDSAAGEYLTKMGLPEEDFNSYATHRGDHLTAQRATFANPTLKN
FT                   EMVLENGQVKAGSLARIEPEGKVTRMWEAIETYMERKQPLIVIAGADYGQGSSRDWAAK
FT                   GVRLAGTEAIVAEGFERIHRTNLVGMGVLPLEFKPGVNRLTLGIDGTETFDVIGERKPR
FT                   ADLTLVIHRRNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESTRAAA"
FT                   /protein_id="YP_003606886.1"
FT   misc_feature    156308..158881
FT                   /note="2-methylisocitrate dehydratase, Fe/S-dependent;
FT                   Region: 2met_isocit_dHY; TIGR02333"
FT                   /db_xref="CDD:131386"
FT                   /locus_tag="BC1002_3339"
FT   misc_feature    156530..157909
FT                   /note="Aconitase A catalytic domain; Region: AcnA_IRP;
FT                   cd01586"
FT                   /db_xref="CDD:153136"
FT                   /locus_tag="BC1002_3339"
FT   misc_feature    order(156542..156544,156551..156553,156902..156907,
FT                   157730..157732,157817..157819,157832..157834)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:153136"
FT                   /locus_tag="BC1002_3339"
FT   misc_feature    order(156908..156910,157520..157522,157718..157720,
FT                   157727..157732,157814..157816)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:153136"
FT                   /locus_tag="BC1002_3339"
FT   misc_feature    158201..158725
FT                   /note="Aconitase swivel domain. Aconitase (aconitate
FT                   hydratase) catalyzes the reversible isomerization of
FT                   citrate and isocitrate as part of the TCA cycle. This is
FT                   the aconitase swivel domain, which undergoes swivelling
FT                   conformational change in the enzyme...; Region:
FT                   Aconitase_swivel; cl00215"
FT                   /db_xref="CDD:174039"
FT                   /locus_tag="BC1002_3339"
FT   misc_feature    158540..158548
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73200"
FT                   /locus_tag="BC1002_3339"
FT   gene            159012..160196
FT                   /db_xref="GeneID:9112643"
FT                   /locus_tag="BC1002_3340"
FT   CDS_pept        159012..160196
FT                   /locus_tag="BC1002_3340"
FT                   /gene_family="HOG000220029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02334"
FT                   /codon_start="1"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6079 AcnD-accessory protein PrpF;
FT                   TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein of
FT                   unknown function DUF453"
FT                   /db_xref="GI:295698994"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="GeneID:9112643"
FT                   /translation="MHSPQIRIPATYMRGGTSKGVFFRLQDLPDDAQRPGAARDALLMR
FT                   VIGSPDPYGKQIDGMGGATSSTSKTVIISRSSRPDHDVDYLFGQVSIDKAFVDWSGNCG
FT                   NLSAAVGPFAISAGLVDASRVPRDGVAIVRIWQANIGKTIIAHVPMTDGAVQETGDFEL
FT                   DGVTFPAAEVPLEFMNPAADEEGAGGAMFPTGNLVDDLEVPGVGTLKATMINAGIPTIF
FT                   VDAEAIGYKGTELQDAINSDAKALAMFETIRAHGALRMGLIKNLDEIATRQHTPKVAFV
FT                   AKPVDYVASSGKPVRAGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIAGTLVNQAAG
FT                   GGERESVRFGHPSGTLRVGAQASLNDGEWVVTKAMMSRSARVLMEGWVRVPQRG"
FT                   /protein_id="YP_003606887.1"
FT   misc_feature    159021..160184
FT                   /note="probable AcnD-accessory protein PrpF; Region: prpF;
FT                   TIGR02334"
FT                   /db_xref="CDD:131387"
FT                   /locus_tag="BC1002_3340"
FT   gene            160207..160416
FT                   /db_xref="GeneID:9112644"
FT                   /locus_tag="BC1002_3341"
FT   CDS_pept        160207..160416
FT                   /locus_tag="BC1002_3341"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1780"
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1780 methyltransferase type 11"
FT                   /db_xref="GI:295698995"
FT                   /db_xref="GeneID:9112644"
FT                   /translation="MSANGSGTEGYAEQAEAVIERWRTLSFADRHRPILDWIPRAPSRI
FT                   VDIGAGIGTDAAALAALGQLASKA"
FT                   /protein_id="YP_003606888.1"
FT   gene            160627..161868
FT                   /db_xref="GeneID:9112645"
FT                   /locus_tag="BC1002_3342"
FT   CDS_pept        160627..161868
FT                   /locus_tag="BC1002_3342"
FT                   /gene_family="HOG000031307" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lch:Lcho_2156 major facilitator transporter"
FT                   /db_xref="GI:295698996"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112645"
FT                   /translation="MQNRLDADATNSADAARDNARAKRAVLVIAIAQLLGTSLWFSANG
FT                   AMRDLQTAWQLSASGIGWLTNAVQAGFIVGTLLSATTGLADRLSASKVFAVCGVLGATL
FT                   NALFALCSSGLASALVFRFGVGVALAGIYPLGMKLLVTWDPRRAAQTLALLVAMLTLGT
FT                   ASVHAIRALLSGVPWQTVVLTSSGLAVIGALLVFLLGEGPHARRSGNRRFGLSAGVGQV
FT                   VRISEFRSAALGYFGHMWELYAFWTLTPLLVQRAFVSGAPATPGTVALWSFLIIAIGAL
FT                   GCLFGGRLSQAVGSARTAALALTISGTLCAIYPLTTGFGTAAQLALLLVWGISVIADSP
FT                   QFSALSVKACPADKIGGALTLQNSFGFFLSACSILWSTSVFHVLDVRVAWLLLPGPIIG
FT                   LIAMSPLLRKHPRW"
FT                   /protein_id="YP_003606889.1"
FT   misc_feature    160702..161796
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3342"
FT   misc_feature    160711..161739
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="BC1002_3342"
FT   misc_feature    order(160744..160746,160753..160761,160765..160770,
FT                   160819..160821,160828..160833,160840..160842,
FT                   160852..160857,160861..160866,161011..161016,
FT                   161023..161028,161035..161040,161047..161049,
FT                   161080..161085,161092..161097,161113..161115,
FT                   161341..161343,161350..161355,161362..161367,
FT                   161374..161376,161428..161430,161440..161442,
FT                   161452..161454,161461..161463,161473..161475,
FT                   161620..161622,161629..161634,161641..161643,
FT                   161653..161658,161665..161667,161698..161703,
FT                   161710..161715,161722..161727,161734..161736)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3342"
FT   gene            complement(161882..162277)
FT                   /db_xref="GeneID:9112646"
FT                   /locus_tag="BC1002_3343"
FT   CDS_pept        complement(161882..162277)
FT                   /locus_tag="BC1002_3343"
FT                   /gene_family="HOG000098555" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF305"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   bxe:Bxe_B2299 hypothetical protein"
FT                   /db_xref="GI:295698997"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="GeneID:9112646"
FT                   /translation="MKNLRSVRAICVFGGLAFAAAALPAHAQHQGMPGMDMAHSAHADA
FT                   GASTQAFKAADERMMHDMSAPHYTGDADRDFVAHMIPHHQGAIEMAQAELKYGKDPEIK
FT                   KLARNIIKAQHDEIAFMRRWQEKHGGE"
FT                   /protein_id="YP_003606890.1"
FT   misc_feature    complement(161906..162061)
FT                   /note="Domain of unknown function (DUF305); Region: DUF305;
FT                   pfam03713"
FT                   /db_xref="CDD:146378"
FT                   /locus_tag="BC1002_3343"
FT   gene            162469..162783
FT                   /db_xref="GeneID:9112647"
FT                   /locus_tag="BC1002_3344"
FT   CDS_pept        162469..162783
FT                   /locus_tag="BC1002_3344"
FT                   /gene_family="HOG000008026" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /codon_start="1"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bpy:Bphyt_6066 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="GI:295698998"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="GeneID:9112647"
FT                   /translation="MYIAMNRFKVAPGSEDAFEHLWTTRDTHLKEVPGFVEFHLLKGPR
FT                   KDDHVLYSSHTIWRDQPSFEAWTRSDAFRAAHRSAGNENRVLYLGHPEFEGFEVIQTVK
FT                   "
FT                   /protein_id="YP_003606891.1"
FT   misc_feature    162469..162768
FT                   /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
FT                   cl10022"
FT                   /db_xref="CDD:175061"
FT                   /locus_tag="BC1002_3344"
FT   gene            162882..163889
FT                   /db_xref="GeneID:9112648"
FT                   /locus_tag="BC1002_3345"
FT   CDS_pept        162882..163889
FT                   /locus_tag="BC1002_3345"
FT                   /gene_family="HOG000294692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bpy:Bphyt_6065 alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /db_xref="GI:295698999"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112648"
FT                   /translation="MKAVRIGSPATVDSLQVVDLPDPGQPGAGQIRVRIRASSLNYHDY
FT                   GVVSGNLPAEAGRIPMADGAGVVEAVGAGVREFKAGDHVVSCFFPHWENGSPAVGDFST
FT                   TPGDGVDGYAREVVVLPSHYFTHAPAGYSHAEAATLTTAGLTAWRALVVDGQLKAGSSV
FT                   LVLGTGGVSIFGLQMAKAMGASVIATSSSNAKLAKLRELGADHTINYRDNPEWGKEVRH
FT                   ITNGRGVDHVIEVGGPGTLPQSITACRIGGHIALIGVLTGRSGQVPTAHLMARQQRLQG
FT                   LIVGSRQDQIDMVRALETTGIKPVIDSTFELAKLADAFRHEASGAHFGKICVAI"
FT                   /protein_id="YP_003606892.1"
FT   misc_feature    162882..163886
FT                   /note="Medium chain dehydrogenases/reductase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR7; cd08276"
FT                   /db_xref="CDD:176237"
FT                   /locus_tag="BC1002_3345"
FT   misc_feature    162882..163886
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="BC1002_3345"
FT   misc_feature    order(163002..163010,163017..163019,163305..163307,
FT                   163317..163319,163380..163397,163449..163454,
FT                   163464..163466,163509..163511,163584..163589,
FT                   163593..163595,163650..163655,163725..163733)
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176237"
FT                   /locus_tag="BC1002_3345"
FT   gene            complement(163940..164563)
FT                   /db_xref="GeneID:9112649"
FT                   /locus_tag="BC1002_3346"
FT   CDS_pept        complement(163940..164563)
FT                   /locus_tag="BC1002_3346"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6064 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295699000"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9112649"
FT                   /translation="MLRFDNLSKRYSDRVLFEGLHFDATSGCVALNDESGSGKSTLLAI
FT                   LAGALEADSGAVWLGGHPLRTAPHAAQALLTYVPEDSMNWPDQTGRDYLRQIASARHTA
FT                   LTDDVLALAERFGLAPHLDKRFEQMSYGSRKKVFLTAAALGDTRVLIADEPAGGLDASA
FT                   RAVLAELFKTLGTTRTVFFTSYDEGFTQACEATRICFADLARHP"
FT                   /protein_id="YP_003606893.1"
FT   misc_feature    complement(163982..164563)
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(163964..164560)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(164444..164467)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(order(164009..164011,164102..164107,
FT                   164324..164326,164441..164449,164453..164458))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(164324..164335)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(164150..164179)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(164102..164119)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(164084..164095)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   misc_feature    complement(order(163994..163996,164006..164023))
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3346"
FT   gene            complement(164670..165518)
FT                   /db_xref="GeneID:9112650"
FT                   /locus_tag="BC1002_3347"
FT   CDS_pept        complement(164670..165518)
FT                   /locus_tag="BC1002_3347"
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /codon_start="1"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Shikimate dehydrogenase substrate binding
FT                   domain protein; Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   bpy:Bphyt_6063 shikimate dehydrogenase substrate binding
FT                   domain protein"
FT                   /db_xref="GI:295699001"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112650"
FT                   /translation="MQPAGNSSFTASLDAGLSGATRVYFIVGDPIAQVRSPSGVTAALR
FT                   SAGRDALVVPAHVAPADLPAFFAGVAPMRNVDGVIITVPHKFSAASYCATLAEEAAFLG
FT                   AVNTLRRNADGGWHGGMFDGTGFVAALVAAGCVLQGKRALLVGAGGAGSAIGHALIQSC
FT                   VGLLDVRDNDVERTGSLTARLNALGRGAARGAAAELESTRYDVVVNASPLGMRAGDPLP
FT                   IDVARLPTTTFVGDVVTKPPLTPLIEAARARGCPTVTGTQMFERVCDRMVEFLLEASPS
FT                   A"
FT                   /protein_id="YP_003606894.1"
FT   misc_feature    complement(165192..165443)
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="BC1002_3347"
FT   misc_feature    complement(164727..165152)
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_3347"
FT   misc_feature    complement(order(164727..164729,164802..164804,
FT                   165150..165152))
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_3347"
FT   misc_feature    complement(order(164727..164732,164739..164741,
FT                   164808..164810,164883..164891,165003..165008,
FT                   165066..165068,165075..165077))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_3347"
FT   gene            165727..167514
FT                   /db_xref="GeneID:9112651"
FT                   /locus_tag="BC1002_3348"
FT   CDS_pept        165727..167514
FT                   /locus_tag="BC1002_3348"
FT                   /gene_family="HOG000245848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /codon_start="1"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: pna:Pnap_2707 putative
FT                   FAD-binding dehydrogenase"
FT                   /db_xref="GI:295699002"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="GeneID:9112651"
FT                   /translation="MVETLSDLQQNEAFDVVVIGAGGAGMSAALFAAIDGARVLLVEST
FT                   EYVGGTTAYSAGTTWIPNSPHGPSINPDDSSANAEGFLRRAVGERSSEALRRAFLQAGP
FT                   RAVALIEANSDVKYRARPFHPDYLSELEGSTLRGRALEPLAFDGRKLGRHFALIRPPIP
FT                   EFTVLGGMMVDRDDVGHLLNMTKSFRSLRHAVKLLARHACDRISWPRGTRLVMGNALIG
FT                   RLLSSLLARDVTVLVSTKLEALRTNASGAIDGITLSQNGQRRQISVTGGVILASGGFNR
FT                   NPQRRRAMLPGADLTWCPGAPGHTGSAQDLALAAGARYGEGALSNAFWAPVSIRQRADG
FT                   TTAVFPHFIMDRGKPGMIVVNQQGRRFLNENTSYHLFGIAMQEAHRKSPSVPAYLVTDA
FT                   DGLRKYGLGMVRPGGKGLAPFLADGYLTQAATLDELAAQLDIDAAGLADSVARINDYAK
FT                   TGVDPEFQRGMTDYQRANGDANWPGPNPCLGPIVRAPFYAVRLYPGDIGAATGLVSDDK
FT                   ARVVNRDDQPIGGLYACGNDMQSVMGGVYPAPGITLGPGLAFAYLAARDAATRAKAARS
FT                   DAASFVARGKTEAANEKIV"
FT                   /protein_id="YP_003606895.1"
FT   misc_feature    165739..167394
FT                   /note="putative FAD-binding dehydrogenase; Reviewed;
FT                   Region: PRK12843"
FT                   /db_xref="CDD:139269"
FT                   /locus_tag="BC1002_3348"
FT   misc_feature    165742..167394
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3348"
FT   gene            167608..169401
FT                   /db_xref="GeneID:9112652"
FT                   /locus_tag="BC1002_3349"
FT   CDS_pept        167608..169401
FT                   /locus_tag="BC1002_3349"
FT                   /gene_family="HOG000245848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /codon_start="1"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: bph:Bphy_6102 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein
FT                   domain-containing protein"
FT                   /db_xref="GI:295699003"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="GeneID:9112652"
FT                   /translation="MAMMREPILECDVLVLGSGAAGLSAAVTAATRGLRVMVAEKADVF
FT                   GGTSAWSGGWMWIPRNPLATRAGIVEESEASRTYLRNELGAHYDPDKVDALLEHGPEMI
FT                   EFFERETAVRFIDGNRIPDFHTTPGAMTGGRSVCAMPFDGRELGALIDRLRPALDVVTL
FT                   KGMAIASGQDLAHFFNATRSPRSAVHVLRRLAAFATDKFRYGRSMHLVNGNALVARLLK
FT                   SAHDRAVDLRTNAKAVALLREGGAAGGRVTGARVEIDGVAHEVRAARGVVLACGGYPHD
FT                   VARRAQTFAYTPSGREHWSAAPLTNTGDGIRLGEAVGAHFDASLETPAAWAPVSLVPRK
FT                   SGEDAVAFPHLIERAKPGVIAVTREGRRFVNEASSYHDFINALIGTAPAGEEVCAWLIC
FT                   DHRFQRRYGLGFSKPFPFPTAPYLRSGYLRRANSLAELASQCGIDPQGLQTTVAAYNSY
FT                   AKDGFDPQFHKGSTPYNRVQGDARHKPNPCNAPLEHGPFYAVKLLPGSLGTFAGLATDA
FT                   AARVLDDAGRPVPGLYAVGNDSASMMGGCYPSGGITLGPAMTFGYLAGLSLAGAPQADG
FT                   TVRAARTEPTPNSSIPSQGRI"
FT                   /protein_id="YP_003606896.1"
FT   misc_feature    167608..169323
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3349"
FT   misc_feature    167701..169329
FT                   /note="putative FAD-binding dehydrogenase; Reviewed;
FT                   Region: PRK12843"
FT                   /db_xref="CDD:139269"
FT                   /locus_tag="BC1002_3349"
FT   gene            169401..170012
FT                   /db_xref="GeneID:9112653"
FT                   /locus_tag="BC1002_3350"
FT   CDS_pept        169401..170012
FT                   /locus_tag="BC1002_3350"
FT                   /gene_family="HOG000266370" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /codon_start="1"
FT                   /product="NIPSNAP family containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   bph:Bphy_6103 NIPSNAP family protein"
FT                   /db_xref="GI:295699004"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="GeneID:9112653"
FT                   /translation="MTLYDLVTLTVKIGANAQVFENIQARGDAPGSKLLGCWYSDIGTL
FT                   GQVLVLRGFDSEASLIAERKRMLLEGNPFGCGEFITDVKIDSYALFPFLPPIEPAVHGG
FT                   IYEMRVYGTKLASLQHTIDAWEEAVPERTRRSPLVGAMYALDGAVPRFLNIWPYASVDE
FT                   RSRVRAEAVKDGIWPPKGGPAHLTTMESTICVPAPFSPLR"
FT                   /protein_id="YP_003606897.1"
FT   misc_feature    169410..>169604
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="BC1002_3350"
FT   misc_feature    169716..170003
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="BC1002_3350"
FT   gene            170028..170879
FT                   /db_xref="GeneID:9112654"
FT                   /locus_tag="BC1002_3351"
FT   CDS_pept        170028..170879
FT                   /locus_tag="BC1002_3351"
FT                   /gene_family="HOG000250881" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /codon_start="1"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /transl_table="11"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bph:Bphy_6104 xylose isomerase domain-containing
FT                   protein"
FT                   /db_xref="GI:295699005"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="GeneID:9112654"
FT                   /translation="MTQPNSRALSLSALTVLELSPPQMVECAAQAGYDYVGLRLVPATD
FT                   HEVRHDIISPGALKRETLARVRDTGVKVLDVEILRLKPDTDVHAWLPMLDTAAELGARY
FT                   VLVAGNDPDEARTAERLAQLCELAEPRGLAPSLEPMPWTEVKDVTQGARIAKAAARRNT
FT                   GLIVDPIHFDRAGTSTDTLRALPREYFGYVQFCDAPAERPTDLDTLLFQARCERLIPGE
FT                   GGLDLAGILRALPDDLPISLEVPMQQWAQTASALERARKLREATLALLERTYTATPSSI
FT                   TS"
FT                   /protein_id="YP_003606898.1"
FT   misc_feature    170109..170702
FT                   /note="Xylose isomerase-like TIM barrel; Region:
FT                   AP_endonuc_2; pfam01261"
FT                   /db_xref="CDD:144742"
FT                   /locus_tag="BC1002_3351"
FT   gene            170995..172392
FT                   /db_xref="GeneID:9112655"
FT                   /locus_tag="BC1002_3352"
FT   CDS_pept        170995..172392
FT                   /locus_tag="BC1002_3352"
FT                   /gene_family="HOG000114541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6105 major facilitator transporter"
FT                   /db_xref="GI:295699006"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112655"
FT                   /translation="MEPSNKAPRHGTSASRALDVQQWLDERRIGRFQILVLLMCMFIVT
FT                   LDGLDTVMVGFIAPALSSAWAIPRDALGPVMSGGLLGLAFGALCAGPLADRFGRKTVMT
FT                   SAVLFFGVWSFGAAFATNIGELTVLRFLTGLGLGASMPNAATLMAEYAPQRCRALTVTT
FT                   VFCGFTLGAAGGGFISAWLIAAYGWQSVLILGGVLPVLYVPLMVRWLPESARFLALTET
FT                   RRERLVAVLNRIERGIADHATRFVVPAVAQQASNSERSPVRLILSRDYAFGTVMLWICY
FT                   FAGLLTVYLLGSWLPTLIRGAGFTLGEAALVGALFQAGGTIGSLAIGWLMDRFDAHRAL
FT                   GATVFAGGVLAWAMGLPGHGLTMMAVLAFFMGYCMNGSNTGFCALAASSYPTPMRATGT
FT                   SWMLGIGRFGGIAGAMLGAGMLHANWGFSQVFTSLALPAAVGAAAVLLKGARHRGPLLR
FT                   VSAGIGH"
FT                   /protein_id="YP_003606899.1"
FT   misc_feature    171049..172218
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BC1002_3352"
FT   misc_feature    171103..>171564
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3352"
FT   misc_feature    order(171145..171147,171154..171162,171166..171171,
FT                   171220..171222,171229..171234,171241..171243,
FT                   171253..171258,171262..171267,171403..171408,
FT                   171415..171420,171427..171432,171439..171441,
FT                   171475..171480,171487..171492,171508..171510)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3352"
FT   misc_feature    <171811..172218
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3352"
FT   gene            172482..173336
FT                   /db_xref="GeneID:9112656"
FT                   /locus_tag="BC1002_3353"
FT   CDS_pept        172482..173336
FT                   /locus_tag="BC1002_3353"
FT                   /gene_family="HOG000228895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6106 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:295699007"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9112656"
FT                   /translation="MAGNLERALAIIELLAKQGGSMQLAAIADTLNIPRSGTHRLLAEL
FT                   SDEGYVRQDEHGEYVLALKLVSLGLMWLSTAGVLDISQPVLDRLASASGELARLGVIED
FT                   DHITFVGKAQGARSGLRYDPDMGSSPPLHCTASGQAWLASMSDEEALELVSRQGGIGKA
FT                   GPRGPKAPKTIQQFLQDLAGARKRGYGIASETYEAGMTSMAAAIRHPVTGLVVGTVSLA
FT                   GPTSRLPDARLKELAPALLEAASDMSTATLSSPYFKRAPRVAPPVEVVRPVEPKRKGRP
FT                   RAA"
FT                   /protein_id="YP_003606900.1"
FT   misc_feature    172530..172751
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3353"
FT   misc_feature    172839..173165
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_3353"
FT   gene            173628..173909
FT                   /db_xref="GeneID:9112657"
FT                   /locus_tag="BC1002_3354"
FT   CDS_pept        173628..173909
FT                   /locus_tag="BC1002_3354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5784"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5784 hypothetical protein"
FT                   /db_xref="GI:295699008"
FT                   /db_xref="GeneID:9112657"
FT                   /translation="MSLTGRQTAAQRGGRLPARFADSHLQHLESVLGYATRKRATRSGE
FT                   LDRVYWERRIRALEDTHHLIDSQRTRIAKLRDMLRLQTHASVARRTAA"
FT                   /protein_id="YP_003606901.1"
FT   gene            174547..176445
FT                   /db_xref="GeneID:9112658"
FT                   /locus_tag="BC1002_3355"
FT   CDS_pept        174547..176445
FT                   /locus_tag="BC1002_3355"
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /codon_start="1"
FT                   /product="AAA ATPase central domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6052 AAA ATPase central domain
FT                   protein; PFAM: AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; peptidase M41; SMART: AAA ATPase"
FT                   /db_xref="GI:295699009"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="GeneID:9112658"
FT                   /translation="MKPGNTSLGKKRARKFAVAAVAVLIAVLVGWSVWYFQHRAEPQAP
FT                   ALSGIASQMRDDASAWTHQEKDASTMLRDIHDANVAAIGVSPSAILVSLRDGSKYFVTD
FT                   HNATFSHALLLGERSDAAAYQLVWLPDVDIHSDGARWTQLFDQFRDALSVLLPLALIGG
FT                   MAWFMRREMKGGATLLSETPTLRFDDVIGANEAKAALADIRGYLSDPKQFSSLGVRAPC
FT                   GILMVGAPGVGKTRLAQALAGECGANFISITGSYFSAKYYGVGIQKVRHLFELARKNAP
FT                   TVIFIDEADGLAKRTDTGGGPVEAESNRIINQLLAEMDGFESNEGVIVVAATNHPDNLD
FT                   EALRRPGRFDRTVQVRLPDREDRAKIFRFYAQRLKSKAADIDYDQLARLTTGLSPATVA
FT                   MVVNQAGLIARKAGDNEIAAKHFMEAIKIARIGDVSGAERALTEDERKRIAVHEAGHGL
FT                   VAALLGTGVLEEVTILPRGGALGVALITKAQDKHLYRETEIRNEIQVLLGGRNAEILMF
FT                   SEASSGAASDLQEASRISLDMVSKFGFNSDGDLFSLAALPSQYAGLQMKSAIGHANVLL
FT                   KELNELCYGLLHAYEPVLRDISEQLLEHETVPGDTVYRLIAEHKSTLKIVHEPAAA"
FT                   /protein_id="YP_003606902.1"
FT   misc_feature    175000..176397
FT                   /note="ATP-dependent metalloprotease FtsH; Region:
FT                   FtsH_fam; TIGR01241"
FT                   /db_xref="CDD:162266"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    175201..175617
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    175228..175251
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    order(175231..175254,175405..175407,175546..175548)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    175393..175410
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    175588..175590
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="BC1002_3355"
FT   misc_feature    175861..176391
FT                   /note="Peptidase family M41; Region: Peptidase_M41;
FT                   pfam01434"
FT                   /db_xref="CDD:144872"
FT                   /locus_tag="BC1002_3355"
FT   gene            complement(176462..176722)
FT                   /db_xref="GeneID:9112659"
FT                   /locus_tag="BC1002_3356"
FT   CDS_pept        complement(176462..176722)
FT                   /locus_tag="BC1002_3356"
FT                   /gene_family="HOG000058829" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6051 hypothetical protein"
FT                   /db_xref="GI:295699010"
FT                   /db_xref="GeneID:9112659"
FT                   /translation="MSNTANSPSEPDRPADEAPGSPPAEVSKPIGDAIPTPVEPGLDQP
FT                   LPKKGETPAPEPNKPGTGSGDPLGDTGAPPGVPDPGPSDFA"
FT                   /protein_id="YP_003606903.1"
FT   gene            complement(176812..177957)
FT                   /db_xref="GeneID:9112660"
FT                   /locus_tag="BC1002_3357"
FT   CDS_pept        complement(176812..177957)
FT                   /locus_tag="BC1002_3357"
FT                   /gene_family="HOG000162380" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: bpy:Bphyt_6049
FT                   acyltransferase 3"
FT                   /db_xref="GI:295699011"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:9112660"
FT                   /translation="MKNRIAGFDGLRAIAVLMVFLQHRLFGDIGEIGHLGVWIFFALSG
FT                   FLIIGILSSQRARIESRDSRFGVELGRFLLRRTVRIFPIYYLMLVVMCALMAFDLANPE
FT                   LASGMPFHFAYLSNFWIGSVLRYWPGRYSHLWSLAIEEQFYLVVAPLLLLLATRRHRAA
FT                   CWAIVALGLAALFAMRAAHWDQITIYTHPLSNVWLLALGGIGGLVIADDRGRVRAWLGH
FT                   GLTLFALSLAVIGLCAAEPRWNMLDDPLLFTAISATYGLCIAALVASIACCRNAAVMAL
FT                   LQTPWLAGLGRISYGFYLYHNLIPDLTRNRHAEALFGGTVPMWAHMLGVVASFAISLGI
FT                   ALLSWRLIEAPMLRLRGSHHDSASPARSSPGALRGSEPAKR"
FT                   /protein_id="YP_003606904.1"
FT   misc_feature    complement(176836..177957)
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:174391"
FT                   /locus_tag="BC1002_3357"
FT   misc_feature    complement(176932..177945)
FT                   /note="Acyltransferase family; Region: Acyl_transf_3;
FT                   pfam01757"
FT                   /db_xref="CDD:145093"
FT                   /locus_tag="BC1002_3357"
FT   gene            178287..179402
FT                   /db_xref="GeneID:9112661"
FT                   /locus_tag="BC1002_3358"
FT   CDS_pept        178287..179402
FT                   /locus_tag="BC1002_3358"
FT                   /gene_family="HOG000201407" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10129"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bpy:Bphyt_6048 hypothetical protein"
FT                   /db_xref="GI:295699012"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="GeneID:9112661"
FT                   /translation="METSGRGRGRSVEVDFFRGVVLIVIVLDHIPGSALSHLMLHAYAL
FT                   CDSAEVFVFLGGYASAAAYTAVLAHRGEHAAQLRFVKRCWEIYRAYLLTAMLMLVSGAV
FT                   LARLDLNRAMVEMTGWPPFALQPWRQAFDIALLRRQPYLSSVLPMYVLFALCVPVMVPL
FT                   ARRSVSLALAVSLAVWAVARPLAALFSIDDVADWAFNPFAWQLMFVLGMLCRVQPISER
FT                   FHASCAAQWLTRVAVVAVLAFAIVKLFVLTQPLPGTHKQNLSVERVINFIVIAWLAAQF
FT                   VRTGSVAWLAKQLPAVVTVGRAGLVCFVTGTLVSLIIDTATPHTFHGFSAVLVGLGGDL
FT                   AAIGALLMIARGWSGWKGQQPRAQAKGAGCG"
FT                   /protein_id="YP_003606905.1"
FT   misc_feature    178314..179249
FT                   /note="OpgC protein; Region: OpgC_C; cl10497"
FT                   /db_xref="CDD:158884"
FT                   /locus_tag="BC1002_3358"
FT   gene            179399..181093
FT                   /db_xref="GeneID:9112662"
FT                   /locus_tag="BC1002_3359"
FT   CDS_pept        179399..181093
FT                   /locus_tag="BC1002_3359"
FT                   /gene_family="HOG000220605" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07519"
FT                   /codon_start="1"
FT                   /product="Tannase and feruloyl esterase"
FT                   /transl_table="11"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bpy:Bphyt_6047 feruloyl esterase"
FT                   /db_xref="GI:295699013"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="GeneID:9112662"
FT                   /translation="MTRRERRVRITTTMRTTRKLVGLATVVSVVLLAWLAIHRTAAQAE
FT                   EAPFAMHCAEFAGAVLSPELIEMPTAGALIESAAMIGATAQGNQQGGEYCRITGRIKAL
FT                   NPTTPDIRFDLNLPRRWNGRALQIGGGGYNGVVVSGTGVMPFSPDRAPLAQGYATFGDD
FT                   SGHVGDSSLAEFGFVDEAVTNFGYAHLKKTHDVALALIANAYGRPPQRMYFAGGSTGGR
FT                   EGYTVMQRFPDDYDGVIANSPALNFSGVRLIGVKLGQAEYATPGGFVPPALLESVYQRT
FT                   LEVCDRLDGTADGIVSDVEACRAHQAQIIDSLRCALRPSSHDACLTDAQLATLLVMRDG
FT                   LSLPYRLAWGVSGYRGYNVFQGTQLTGALGLAHQSGRQPAPTFYANGYLFTQGDGYLRY
FT                   FVARDANFDSLTFDPQRPGKYRSQLVALSATIGSMNPDLSRYIAHGGKLITLQGLADEV
FT                   ISPNQTIAYHDALVARFGKDEVDRFMRLYMVPGFQHGNGVFIPSVDLLGALDAWVTRGV
FT                   APETLTATDLAAATNGRSRPLCRYPGFPRFIGKGNVNLASSFVCAQP"
FT                   /protein_id="YP_003606906.1"
FT   misc_feature    179681..181084
FT                   /note="Tannase and feruloyl esterase; Region: Tannase;
FT                   pfam07519"
FT                   /db_xref="CDD:116138"
FT                   /locus_tag="BC1002_3359"
FT   gene            complement(181194..181652)
FT                   /db_xref="GeneID:9112663"
FT                   /locus_tag="BC1002_3360"
FT   CDS_pept        complement(181194..181652)
FT                   /locus_tag="BC1002_3360"
FT                   /gene_family="HOG000061250" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6046"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6046 hypothetical protein"
FT                   /db_xref="GI:295699014"
FT                   /db_xref="GeneID:9112663"
FT                   /translation="MKRMTRTIFASALVMALSGGVYAQAGGAAGAGAGGSAGGAGGGAA
FT                   GGMSGGGGGAGGTGTGIGAGGGTTGGAGGTATPGVGPGSVRTPGNTGSGYGSPGVTGTG
FT                   GGMGTGTGASPNSPATGGSTGGMGNNMNNGMRSGTGNDMNNGRMQNGQ"
FT                   /protein_id="YP_003606907.1"
FT   gene            181780..182007
FT                   /db_xref="GeneID:9112664"
FT                   /locus_tag="BC1002_3361"
FT                   /pseudo
FT   gene            182004..183935
FT                   /db_xref="GeneID:9112665"
FT                   /locus_tag="BC1002_3362"
FT   CDS_pept        182004..183935
FT                   /locus_tag="BC1002_3362"
FT                   /gene_family="HOG000217841" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   PAS fold-3 domain protein; histidine kinase A domain
FT                   protein; KEGG: reh:H16_B2354 signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; PAS domain containing protein;
FT                   PAC repeat-containing protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="GI:295699015"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="GeneID:9112665"
FT                   /translation="MTDANANLILNVDDNEGARYAKTRILSRAGFIVIEAGNGAQAIER
FT                   ARISQPDLVLLDVNLPDLNGFEVCRRIKAAPETSGVLVIHTSAAAVQSMDRVRGLEGGA
FT                   DSYLTEPIEPAELIAQVRALLRVRRAEGALRESEERFRQMAENIDDVFWMLDPSSAQLL
FT                   YVSPAYRRLWGDAAHQPTPTGRHWANHIDPQDEAAVETAYRALATGVAYEIEYRIVRPD
FT                   GETRWAVERGFPVRDARGHIYRLAGIVNDISDRKANEMALRDADRRKDEFLAMLAHELR
FT                   NPLAPIRNAIELLDPSRAPSQQSFEAMRAVIGRQVKHLSRLVDDLLDVARITQGKITLR
FT                   HEIVELAAALEAAIETVRPALNRKGHTLTTDLPAEPLFVVGDGVRIAQVLGNVLSNAAK
FT                   YTPQRGDIRIEVREAGDDVLISVRDNGVGIDAETIPHIFDLFVQSEISIERSEGGLGIG
FT                   LPLARTLVELHGGGIEAFSAGPGRGSEFVVRLPLTRLADAEQASTAAPEAVPNNCGEAL
FT                   RVLLVDDSVDAALALSLVLQADGYDVRVAHEANTALELAAHFQPQIVLLDHGLPGMDGF
FT                   QLAQEMRRRPITVDALLIAVTGYGQATDRQHSREAGFDHHLVKPVSVEDIQKVIASRFR
FT                   GAQHSASA"
FT                   /protein_id="YP_003606908.1"
FT   misc_feature    182037..182360
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(182040..182045,182172..182174,182196..182198,
FT                   182259..182261,182322..182324,182331..182336)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182172..182174
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(182181..182186,182190..182198)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182331..182339
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182418..183473
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182445..182759
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(182496..182498,182508..182510,182526..182528,
FT                   182571..182582,182655..182657,182670..182672)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(182562..182564,182574..182576,182598..182600,
FT                   182607..182612,182691..182693,182697..182699)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182799..182996
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(182817..182819,182829..182831,182841..182843,
FT                   182850..182852,182862..182864,182871..182873,
FT                   182925..182927,182937..182939,182946..182948,
FT                   182958..182960,182967..182969,182979..182981)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    182835..182837
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    183159..183473
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(183177..183179,183189..183191,183198..183200,
FT                   183267..183269,183273..183275,183279..183281,
FT                   183285..183290,183369..183380,183426..183428,
FT                   183432..183434,183450..183455,183459..183461)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    183189..183191
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(183279..183281,183285..183287,183369..183371,
FT                   183375..183377)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    183621..183893
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(183702..183704,183726..183728,183792..183794,
FT                   183849..183851,183858..183863)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    183702..183704
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    order(183711..183716,183720..183728)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   misc_feature    183858..183866
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3362"
FT   gene            184154..185080
FT                   /db_xref="GeneID:9112666"
FT                   /locus_tag="BC1002_3363"
FT   CDS_pept        184154..185080
FT                   /locus_tag="BC1002_3363"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6045 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295699016"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112666"
FT                   /translation="MQPIVSVTNLSKTYASGFRALKNINLAIHRGEIFALLGPNGAGKT
FT                   TLISIVCGIVNASEGSVTVDGHDIGANYRAARSLIGLVPQELTTDAFETVWATVSFSRG
FT                   LFGKPKNPAYIEKVLRDLSLWEKRNNKIVTLSGGMKRRVLIAKALSHEPRVLFLDEPTA
FT                   GVDVELRRDMWKLVRSLAASGVTIILTTHYIDEAEEMADRIGVINAGEIMLVEEKTELM
FT                   RKLGTKQLTLQLEYPLDDVPAALAGYGLAVANGGNELIYTYEGEGGRTDIIALLKSLDD
FT                   AGIRFKDLHTTQSSLEDIFVSLLRGNP"
FT                   /protein_id="YP_003606909.1"
FT   misc_feature    184154..185071
FT                   /note="ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]; Region: CcmA; COG1131"
FT                   /db_xref="CDD:31326"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184166..184792
FT                   /note="The ABCA subfamily mediates the transport of a
FT                   variety of lipid compounds.  Mutations of members of ABCA
FT                   subfamily are associated with human genetic diseases, such
FT                   as, familial high-density lipoprotein (HDL) deficiency,
FT                   neonatal surfactant deficiency...; Region: ABC_subfamily_A;
FT                   cd03263"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184265..184288
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    order(184274..184279,184283..184291,184406..184408,
FT                   184628..184633,184727..184729)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184397..184408
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184556..184585
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184616..184633
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184640..184651
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   misc_feature    184715..184735
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="BC1002_3363"
FT   gene            185077..185838
FT                   /db_xref="GeneID:9112667"
FT                   /locus_tag="BC1002_3364"
FT   CDS_pept        185077..185838
FT                   /locus_tag="BC1002_3364"
FT                   /gene_family="HOG000252768" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bpy:Bphyt_6044
FT                   ABC-2 type transporter"
FT                   /db_xref="GI:295699017"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR013526"
FT                   /db_xref="GeneID:9112667"
FT                   /translation="MNIYAMRAIYKFEMARTWRTLMQSIIAPVISTSLYFVVFGSAIGS
FT                   RIKEVEGISYGAFIVPGLIMLSLLSQSIANASFGIYFPRFTGTIYELLSAPVSYLEIVV
FT                   SYVGAAATKSILLGLIILATAALFVPLQIMHPFWMVLFLVLTAVTFSLLGFIIGIWADS
FT                   FEKLQLVPLLIVTPLTFLGGAFYSVDMLPPFWRAVTLFNPIVYLVSGFRWSFFELGDVG
FT                   VGLSLGMTLLFLAVFLVIVGWIFRTGYRLKS"
FT                   /protein_id="YP_003606910.1"
FT   misc_feature    185086..185724
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="BC1002_3364"
FT   gene            complement(185923..186924)
FT                   /db_xref="GeneID:9112668"
FT                   /locus_tag="BC1002_3365"
FT   CDS_pept        complement(185923..186924)
FT                   /locus_tag="BC1002_3365"
FT                   /gene_family="HOG000061212" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6042 transcriptional regulator, LuxR
FT                   family; PFAM: Autoinducer-binding domain protein;
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="GI:295699018"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:9112668"
FT                   /translation="MEHECDTLPQWLNGSPQGEAGHASAAHPRAASAQPAYPAGARHAA
FT                   KSAHAAEAVKMSPRAANGAGRSGFLTLFTEEEIGTPSPAARRSAPLISPLGRFGSAQDR
FT                   MEFVRQRIRQLGFDSFSYTATRTSSHHKTMFVLTSYESQAWLTRYFRERYFELDPRVAH
FT                   ASPTGMPFLWNTADLRADLPRAQLRSERLGALIDMLEAAGRKSGILTQMPLPEPELSAS
FT                   LCFNSEIGNPRWMTESIVAETLMFAHSIHEFIWTHAKSVIGIAPAQQQRIALSKLQHAV
FT                   LKAVVQGQRDKEIAYFLGLSPHNVDYHLRRLRQLFNVRNRVQLINVAQAYLS"
FT                   /protein_id="YP_003606911.1"
FT   misc_feature    complement(185935..186636)
FT                   /note="DNA-binding transcriptional activator SdiA;
FT                   Provisional; Region: PRK10188"
FT                   /db_xref="CDD:170303"
FT                   /locus_tag="BC1002_3365"
FT   misc_feature    complement(186163..186627)
FT                   /note="Autoinducer binding domain; Region: Autoind_bind;
FT                   pfam03472"
FT                   /db_xref="CDD:146226"
FT                   /locus_tag="BC1002_3365"
FT   misc_feature    complement(185941..186105)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3365"
FT   misc_feature    complement(order(185962..185964,185995..186009,
FT                   186013..186018,186022..186027,186049..186057,
FT                   186094..186102))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3365"
FT   misc_feature    complement(order(185947..185949,185956..185964,
FT                   186055..186057,186061..186063,186067..186069))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="BC1002_3365"
FT   gene            187107..188018
FT                   /db_xref="GeneID:9112669"
FT                   /locus_tag="BC1002_3366"
FT   CDS_pept        187107..188018
FT                   /locus_tag="BC1002_3366"
FT                   /gene_family="HOG000061211" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6041 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295699019"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9112669"
FT                   /translation="MARIPKLTTTLAYDRYMAGQRLVSSVDREWRHLVLRSYLEPVRQD
FT                   LLEAPGLRDFTLMTLASGAEHLERNLGGAWESADMRVNDLWFVPPTPISWRWHSISDEP
FT                   LSTLHVHIERELIDSVAQQMGLDASRELSLGHAMRFNDPLIAAMLAALHRAARDPADSR
FT                   LYVDTLVHALAAHLLQHYSSGNDARRDSATGPGRLVPRRIRRVTDYIRANLAEDLAIAE
FT                   LAEQAGLSSFHFARVFRRETGETPHQFVTRLRLEEAARLLRATDRTVLQIALEVGFENA
FT                   SHFSVQFKRGYGATPLAYRLRG"
FT                   /protein_id="YP_003606912.1"
FT   misc_feature    187788..188006
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="BC1002_3366"
FT   misc_feature    <187917..188009
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_3366"
FT   gene            188297..188722
FT                   /db_xref="GeneID:9112670"
FT                   /locus_tag="BC1002_3367"
FT   CDS_pept        188297..188722
FT                   /locus_tag="BC1002_3367"
FT                   /gene_family="HOG000042517" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6040"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6040 hypothetical protein"
FT                   /db_xref="GI:295699020"
FT                   /db_xref="GeneID:9112670"
FT                   /translation="MTRLKMTACGHTFIAETHPDAPQTVAAFLKLLPYRQKLIHVRWSG
FT                   EGCWVPLGEFKLENDGVAVGFENHTSHPSVGDILFYPGGYSETEIILAYGSCCFASKMG
FT                   QLAGNHFLTIVEGKEKLRELGTKVLWEGAQEVVFDRL"
FT                   /protein_id="YP_003606913.1"
FT   gene            188844..189878
FT                   /db_xref="GeneID:9112671"
FT                   /locus_tag="BC1002_3368"
FT   CDS_pept        188844..189878
FT                   /locus_tag="BC1002_3368"
FT                   /gene_family="HOG000263964" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /codon_start="1"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /transl_table="11"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bpy:Bphyt_6733 lipolytic protein G-D-S-L family"
FT                   /db_xref="GI:295699021"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="GeneID:9112671"
FT                   /translation="MRRINDKVRAVVFAMSIVLLSACGGGGSGSSGSNSGGSTAAGPAG
FT                   GVKLQVVSFGDSLSDVGTYAPLARAVGGGRFTTNPGQVWAQNVAQYYGDTLSAAFMIDF
FT                   THKLSAQSGLGYAEGGSTVATPANQYDYLSDVIGNIEMPVNQQLSSYLSAHGSFNANQL
FT                   VLVWVGSNDVLRAGNLPAAAPVVQAAATTLAQLVGQIVQNGGVHVVVINLPNIGLSPKG
FT                   LTSPDGGANLTQLSQLFNATLNSALQTDGLQSKVIEVDSYTWTNQVIGNFQANGFTVSN
FT                   TGQACDPKKTPDDTALLCSPATYVSANADQTYMFADDLHPTTHMHALFAQFVEQQIAHS
FT                   GLGR"
FT                   /protein_id="YP_003606914.1"
FT   misc_feature    188991..189854
FT                   /note="Triacylglycerol lipase-like subfamily of the SGNH
FT                   hydrolases, a diverse family of lipases and esterases. The
FT                   tertiary fold of the enzyme is substantially different from
FT                   that of the alpha/beta hydrolase family and unique among
FT                   all known hydrolases; its...; Region:
FT                   Triacylglycerol_lipase_like; cd01847"
FT                   /db_xref="CDD:58522"
FT                   /locus_tag="BC1002_3368"
FT   misc_feature    order(189012..189014,189201..189203,189354..189356,
FT                   189792..189794,189801..189803)
FT                   /note="active site"
FT                   /db_xref="CDD:58522"
FT                   /locus_tag="BC1002_3368"
FT   misc_feature    order(189012..189014,189792..189794,189801..189803)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:58522"
FT                   /locus_tag="BC1002_3368"
FT   misc_feature    order(189012..189014,189201..189203,189354..189356)
FT                   /note="oxyanion hole; other site"
FT                   /db_xref="CDD:58522"
FT                   /locus_tag="BC1002_3368"
FT   gene            complement(189954..190082)
FT                   /db_xref="GeneID:9112672"
FT                   /locus_tag="BC1002_3369"
FT   CDS_pept        complement(189954..190082)
FT                   /locus_tag="BC1002_3369"
FT                   /gene_family="HOG000254770" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4688 hypothetical protein"
FT                   /db_xref="GI:295699022"
FT                   /db_xref="GeneID:9112672"
FT                   /translation="MSTVQTVHPTNKLMLAVFWLYVMIPLAWGVINTLTQATKLFK"
FT                   /protein_id="YP_003606915.1"
FT   gene            complement(190093..191496)
FT                   /db_xref="GeneID:9112673"
FT                   /locus_tag="BC1002_3370"
FT   CDS_pept        complement(190093..191496)
FT                   /locus_tag="BC1002_3370"
FT                   /gene_family="HOG000058265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2270 major facilitator superfamily
FT                   (MFS)oxalate/formate antiporter"
FT                   /db_xref="GI:295699023"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112673"
FT                   /translation="MSSISEPGSQQGSAPFFSKQATIAQPGFSRWMVPPAALAVHLCIG
FT                   QAYAFSVFNGPLTKVIGITQSAPDDWSLTALGWIFSLAIVFLGLSAAFAGKWLEHVGPR
FT                   RTMFTAACCFGGGFLVSALGVYLHQIALLYLGYGVIGGIGLGLGYVSPVSTLIRWFPDR
FT                   RGMATGMAIMGFGGGAMIAAPLSVALMKHFQSATSIGVAETFIVLGIVYFISMTIGALA
FT                   IRVPPADWKPAGWTPPAATQHRLITSNHVHIDQALKTPQFYLIWLVLFLNVTAGIGILG
FT                   QASVMIQESFKNTVTAAAAAGFVGLLSLFNMGGRFVWASASDWIGRKNTYYIFFALGAV
FT                   LYYLVPSFAANGQIALFVLTYCIILSMYGGGFATVPAYLADMFGTTFVGGIHGRLLTAW
FT                   AAAGVAGPVLVNYIRAYEVANGVAKADAYTMTVHIMAVLLVIGFICNLLVKRVDEKHHM
FT                   TDAQVAKGA"
FT                   /protein_id="YP_003606916.1"
FT   misc_feature    complement(190258..191409)
FT                   /note="Oxalate/Formate Antiporter; Region: 2A0111;
FT                   TIGR00890"
FT                   /db_xref="CDD:162091"
FT                   /locus_tag="BC1002_3370"
FT   misc_feature    complement(190162..>190719)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3370"
FT   gene            complement(191909..193070)
FT                   /db_xref="GeneID:9112674"
FT                   /locus_tag="BC1002_3371"
FT                   /pseudo
FT   gene            193328..193603
FT                   /db_xref="GeneID:9112675"
FT                   /locus_tag="BC1002_3372"
FT   CDS_pept        193328..193603
FT                   /locus_tag="BC1002_3372"
FT                   /gene_family="HOG000059062" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6034 hypothetical protein"
FT                   /db_xref="GI:295699024"
FT                   /db_xref="GeneID:9112675"
FT                   /translation="MRRCSIQLRNYLLNRSELHVEFVPLALFAIAVLGLGCAATVLLTD
FT                   WIPDSIGALASQHGRFVGQGEQRGKAVAPNRARVQAEAMNVVRTSN"
FT                   /protein_id="YP_003606917.1"
FT   gene            193581..194300
FT                   /db_xref="GeneID:9112676"
FT                   /locus_tag="BC1002_3373"
FT   CDS_pept        193581..194300
FT                   /locus_tag="BC1002_3373"
FT                   /gene_family="HOG000273990" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6033 transcriptional regulator, GntR
FT                   family; PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295699025"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112676"
FT                   /translation="MSSELPTETVATPLTLSLQPIGASASLRDQAYAMLRQAIADADIY
FT                   QNREEIRLDERVLSESLGVSRTPVREAMTLLEQEGFLRMVPRRGIYIVRKSKREIVEMI
FT                   QMWAALESMAARLATLHATDEEIGRLRHMFDNFRDTTPAEHIAEYSDANIAFHQAIVEL
FT                   SKSQIILDTIKNIFIHVRAIRRMTISQSDRAARSIVDHLRIIEALEKRDTELAERLTRQ
FT                   HSLDLAAFVEANCDFLD"
FT                   /protein_id="YP_003606918.1"
FT   misc_feature    193656..193856
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3373"
FT   misc_feature    order(193656..193658,193662..193664,193740..193742,
FT                   193743..193748,193770..193784,193788..193793,
FT                   193800..193802,193830..193835,193839..193850)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3373"
FT   misc_feature    193884..194249
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_3373"
FT   gene            194741..196501
FT                   /db_xref="GeneID:9112677"
FT                   /locus_tag="BC1002_3374"
FT   CDS_pept        194741..196501
FT                   /locus_tag="BC1002_3374"
FT                   /gene_family="HOG000010642" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: rme:Rmet_4360 thiamine pyrophosphate
FT                   enzyme-like TPP binding region"
FT                   /db_xref="GI:295699026"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="GeneID:9112677"
FT                   /translation="MSAVVSSLSPATTTTADDTLKQKTRDAGVVSGGHLVAKALKNEGI
FT                   DTIFTLCGGHIIDIYDGCVDEGIRIIDVRHEQVAAHAADGYARQTGKLGCVVTTAGPGC
FT                   TNAVTGIATAFRSESPILHIGGQGALTQHKMGSLQDLPHVDIMAPITKFAASVSSTERV
FT                   ADMISMAARECFNGAPGPAYLEIPRDVLDREVDATRAIVPRPGHYRASTKSIGDPRDIE
FT                   KLADILVDAERPAILYGQQVWTARGHDQAIALLRGIEIPGYFNGASRGLLPPGDPHHFD
FT                   RTRSQAFANADVLIVVGTPFDFRMGYGRRISKELTLVQIDMDYRTVGKNRDIDLGLVGD
FT                   PGAILAAVLQAASGRIKDDKRQARRKWMAQLRDAEATATEKLLPLFRSNSTPIHPYRVA
FT                   YELNEFLSDDTVYIGDGGDVVTISAQAVRPRRPGQWMDPGALGSLGVGTGFALAAKLAH
FT                   PHKEVLCYYGDGSFGMTAFDMETANRFGAPYLAVIGNNSAMNQIRYGQLAKYGEERGNV
FT                   GNLLGDVPFSKFAEMLGGYGEEVRDPAQIASALQRAREAIHRTGRSAVVNIWVDPREYA
FT                   PGTKNQTMYK"
FT                   /protein_id="YP_003606919.1"
FT   misc_feature    194831..196462
FT                   /note="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]; Region: IlvB; COG0028"
FT                   /db_xref="CDD:30378"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    194840..195304
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    order(194879..194881,194894..194899,194909..194911,
FT                   194921..194923,194945..194965,194972..194974,
FT                   194981..194986,194993..194998,195002..195010,
FT                   195044..195046,195065..195067,195077..195079,
FT                   195086..195091)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    order(194894..194902,194909..194911,194921..194923,
FT                   194948..194950,194954..194965,194969..194971,
FT                   195044..195046,195053..195058,195062..195067,
FT                   195074..195076,195176..195178,195185..195187)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    order(194894..194896,194966..194968,195044..195046,
FT                   195056..195058)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    195401..195781
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    195923..196453
FT                   /note="TPP-binding module; composed of proteins similar to
FT                   benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD)
FT                   and 2-hydroxyphytanoyl-CoA lyase (2-HPCL). Pseudomonas
FT                   fluorescens biovar I BZL cleaves the acyloin linkage of
FT                   benzoin producing 2 molecules...; Region:
FT                   TPP_BZL_OCoD_HPCL; cd02004"
FT                   /db_xref="CDD:48167"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    order(195923..195925,195986..195997,196064..196066,
FT                   196070..196072,196142..196153,196226..196228,
FT                   196232..196234,196238..196240)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48167"
FT                   /locus_tag="BC1002_3374"
FT   misc_feature    order(196061..196063,196145..196147,196157..196162,
FT                   196169..196171,196178..196180,196250..196252,
FT                   196286..196288,196292..196294,196304..196306,
FT                   196313..196318,196322..196324,196334..196339)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48167"
FT                   /locus_tag="BC1002_3374"
FT   gene            196526..197773
FT                   /db_xref="GeneID:9112678"
FT                   /locus_tag="BC1002_3375"
FT   CDS_pept        196526..197773
FT                   /locus_tag="BC1002_3375"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03253"
FT                   /codon_start="1"
FT                   /product="formyl-CoA transferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2267 formyl-coenzyme A transferase;
FT                   TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="GI:295699027"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="GeneID:9112678"
FT                   /translation="MAKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERAGAGDIT
FT                   REQLRDIPDVDSLYFTMLNHNKRSVTIDTKHPEGKQVLEALIQKCDVLVENFAPGALDR
FT                   MGFTWERIQELNPRMIVASVKGFGPGPYEDCKVYENVAQCAGGAASTTGFDDGPPVVTG
FT                   AQIGDSGTGLHLALGIVTALYQRTHTGRGQRVLAAMQDGVLNLCRVKLRDQQRLDRTGV
FT                   MKEYPQYPNGTFGDAVPRAGNASGGGQPGWILKCKGWEADPNAYIYFITQAPVWAKICN
FT                   VIGKEEWATHPDYATAPARLPRLKEIFAEIERWTMTKTKFEAMQILNKYDIPCGPILSM
FT                   KEIAEEPSLRKTGTIVEVDHPQRGKYLTVGNPIKLSDSPTDVKRSPLLGEHTDEVMAEL
FT                   GYSAEQITALRTAGAI"
FT                   /protein_id="YP_003606920.1"
FT   misc_feature    196526..197770
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:174385"
FT                   /locus_tag="BC1002_3375"
FT   gene            197783..198598
FT                   /db_xref="GeneID:9112679"
FT                   /locus_tag="BC1002_3376"
FT   CDS_pept        197783..198598
FT                   /locus_tag="BC1002_3376"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /codon_start="1"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bpy:Bphyt_6031 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:295699028"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9112679"
FT                   /translation="MQTWMRFMSGDGGIVFGRVEGAYLHEYESLAQPVPTGAVLSLRAL
FT                   TPLAPCAPGKIVALWNNYHALAAKLDKPVPTHPLFLMKPAASVIGAGEPIRRPRHYAGK
FT                   IVYEGELGIVIGQRCRDLDVQQAEAAIFGYTLVNDVTAADLLNENPHFPQWCRAKSFDT
FT                   FCCLGPAIVSGFDWRAARLLTTLDDVERQNYPLADMVFSPAEQVSLISQDLTLEPGDVI
FT                   ACGTSLGVGSIKDGATVSITIDGIGTLTNTLSAAQRDEPRRLGDTANMS"
FT                   /protein_id="YP_003606921.1"
FT   misc_feature    197807..198553
FT                   /note="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway) [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]; Region: MhpD; COG0179"
FT                   /db_xref="CDD:30528"
FT                   /locus_tag="BC1002_3376"
FT   misc_feature    197945..198541
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="BC1002_3376"
FT   gene            198652..199497
FT                   /db_xref="GeneID:9112680"
FT                   /locus_tag="BC1002_3377"
FT   CDS_pept        198652..199497
FT                   /locus_tag="BC1002_3377"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6030"
FT                   /codon_start="1"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6030 NAD(P) transhydrogenase beta
FT                   subunit"
FT                   /db_xref="GI:295699029"
FT                   /db_xref="GeneID:9112680"
FT                   /translation="MPQACGSAVLMDLLLLLAVTVAMALVPVLTVAVTALTRRRLGGQS
FT                   AHRHACVRERDPTRRPRMLALLGSGIGLVVASIGFTRYLLAAARENTERIELFSAVLIG
FT                   ALIFAACAIAFCKLRGVLQLEAAALPGHHVVNLFALLLCGWLGYSFVTEQAQPFGLAAL
FT                   LATGALALAMGVHLMLSREYRGNPAHAAHHDSCAPRMRAFAARSDGLALGKPGLLANIE
FT                   WHGGEEQTWALRDVAPALMRLSAYADRRNGRDGRRSNGRPRDCSCKCTHKRPAHFTTRR
FT                   "
FT                   /protein_id="YP_003606922.1"
FT   misc_feature    198823..>199104
FT                   /note="NAD(P) transhydrogenase beta subunit; Region: PNTB;
FT                   cl00566"
FT                   /db_xref="CDD:174288"
FT                   /locus_tag="BC1002_3377"
FT   gene            complement(199588..199908)
FT                   /db_xref="GeneID:9112681"
FT                   /locus_tag="BC1002_3378"
FT   CDS_pept        complement(199588..199908)
FT                   /locus_tag="BC1002_3378"
FT                   /gene_family="HOG000058952" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2264"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2264 hypothetical protein"
FT                   /db_xref="GI:295699030"
FT                   /db_xref="GeneID:9112681"
FT                   /translation="MNHAPVESRISTRNARAAAVDHENHPDDAHLSAYNAAFSDLGLRF
FT                   RWDRATLDMLKEFNGELARITAYIERYHSHLHRAYDADFLAQLILHRKMQYYSEFAAAV
FT                   GE"
FT                   /protein_id="YP_003606923.1"
FT   misc_feature    complement(199711..>199905)
FT                   /note="Autophagy protein Apg6; Region: APG6; pfam04111"
FT                   /db_xref="CDD:112906"
FT                   /locus_tag="BC1002_3378"
FT   gene            complement(200005..200952)
FT                   /db_xref="GeneID:9112682"
FT                   /locus_tag="BC1002_3379"
FT   CDS_pept        complement(200005..200952)
FT                   /locus_tag="BC1002_3379"
FT                   /gene_family="HOG000233518" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_6028 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295699031"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112682"
FT                   /translation="MTMRNATLRQLKVFETVARHLSFSRAAEELHLTQPAVSTQVRQLE
FT                   EHAGLPLFEQLGKKIYLTPAGTEMLHYSRAIMQQFHEVDEAMSQLKGVSGGKLNVAVIS
FT                   AGDYFFPRLLAEFTRRYSGVDLNLAVHNREELLHQLATNQTDLAVMVRPPHETDATNEP
FT                   FAPHPYVIVAAPTHPLAHKRNIRFSQLANEAFIVRERGSDTWNSMEEGFAGRLSNLKIA
FT                   MEIKSTETIKQAVIAGMGIAFLSAHTISLELQLGHLVVLDVESFPVMLNWYVVHRKNKR
FT                   LPPVAVAFKRFLMEEGASLIEKITRVKELSVHKP"
FT                   /protein_id="YP_003606924.1"
FT   misc_feature    complement(200053..200934)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_3379"
FT   misc_feature    complement(200755..200931)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3379"
FT   misc_feature    complement(200074..200664)
FT                   /note="The C-terminal substrate binding of LysR-type
FT                   transcriptional regulator (CbbR) of RubisCO operon, which
FT                   is involved in the carbon dioxide fixation, contains the
FT                   type 2 periplasmic binding fold; Region:
FT                   PBP2_CbbR_RubisCO_like; cd08419"
FT                   /db_xref="CDD:176111"
FT                   /locus_tag="BC1002_3379"
FT   misc_feature    complement(order(200242..200247,200251..200256,
FT                   200272..200289,200563..200583,200587..200589,
FT                   200599..200601,200608..200613,200617..200622))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176111"
FT                   /locus_tag="BC1002_3379"
FT   gene            201320..202669
FT                   /db_xref="GeneID:9112683"
FT                   /locus_tag="BC1002_3380"
FT   CDS_pept        201320..202669
FT                   /locus_tag="BC1002_3380"
FT                   /gene_family="HOG000254640" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2262 major facilitator superfamily
FT                   (MFS)oxalate/formate antiporter"
FT                   /db_xref="GI:295699032"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112683"
FT                   /translation="MNDITQQSTTGMSWRNRWSQLVIGMICMALVANLQYAWTLFVAPM
FT                   HARHHWSEASIQLAFSIFILTETWLVPFEGWLVDRFGPRPVVAGGAICAGLSWILNSYA
FT                   TTLGMLYFAAVIGGIGAGGVYGTCVGNALKWFPDRRGLAAGLTAAGFGAGAALTVIPIA
FT                   NMITSRGYEATFLFFGIVQGVSILLLAMLLTRPILRQAGVRKSRFAVSKVDFTSRQMIK
FT                   TPVFWVIYASFVAVAAGGLMATAQIGPIAKDWGLARIPMSVFGATLPLLTLTLSIDNIF
FT                   NGLTRPLCGFISDKIGRENTMFVIFIGEGLALLGMMQFGSNPYAFMVFAALIFLFWGEI
FT                   FSIFPATCADTFGSKYAAANAGTLYTAKGTASLLVPIASVLAATGGWNLVFIVSAVITI
FT                   AAGISAKFILEPMRTRWIESHDEPQGALAVAGHGNGNASRMSHWPEQSGE"
FT                   /protein_id="YP_003606925.1"
FT   misc_feature    201368..202522
FT                   /note="Oxalate/Formate Antiporter; Region: 2A0111;
FT                   TIGR00890"
FT                   /db_xref="CDD:162091"
FT                   /locus_tag="BC1002_3380"
FT   misc_feature    201380..202543
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3380"
FT   misc_feature    order(201422..201424,201431..201439,201443..201448,
FT                   201497..201499,201506..201511,201518..201520,
FT                   201530..201535,201539..201544,201680..201685,
FT                   201692..201697,201704..201709,201716..201718,
FT                   201752..201757,201764..201769,201785..201787,
FT                   202028..202030,202037..202042,202049..202054,
FT                   202061..202063,202130..202132,202142..202144,
FT                   202154..202156,202163..202165,202175..202177,
FT                   202319..202321,202328..202333,202340..202342,
FT                   202352..202357,202364..202366,202397..202402,
FT                   202409..202414,202421..202426,202433..202435)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3380"
FT   gene            202700..203689
FT                   /db_xref="GeneID:9112684"
FT                   /locus_tag="BC1002_3381"
FT   CDS_pept        202700..203689
FT                   /locus_tag="BC1002_3381"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_6026 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295699033"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112684"
FT                   /translation="MNVSLQQLKVFVAVARERSFTRAAREFDLTQSAISRCVRELEDAV
FT                   ELKLFDRTTRQVELTNAGASLERRIGRLLDEIELTLLEERAAYDGHTGVVLFASNPVLS
FT                   SGWVSRALAQCASVFPELVVSVKDQPQCSVLASVEQGEVDFGAVCVTAPVDSPLLHAQV
FT                   LFTTPLHAVLPSVHPLAQHDSIGWHALRESPLITLNADTGVRAALEPVLAANELKRRPM
FT                   QQLGHVAAVARMVELGLGVGVLPVDAHWPSPGASLVSRPLVPETTLTTVLVHRRNRSLR
FT                   PNAAAAWAQFVASTTDHSRSAGEMPAAVAAATQSFSWQSVRQSLLPEP"
FT                   /protein_id="YP_003606926.1"
FT   misc_feature    202712..202888
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3381"
FT   misc_feature    202991..203566
FT                   /note="TThe C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator,
FT                   contains the type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_like_4; cd08440"
FT                   /db_xref="CDD:176131"
FT                   /locus_tag="BC1002_3381"
FT   misc_feature    order(203024..203029,203033..203038,203045..203047,
FT                   203057..203059,203063..203083,203363..203380,
FT                   203396..203401,203405..203410)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176131"
FT                   /locus_tag="BC1002_3381"
FT   gene            203782..205233
FT                   /db_xref="GeneID:9112685"
FT                   /locus_tag="BC1002_3382"
FT   CDS_pept        203782..205233
FT                   /locus_tag="BC1002_3382"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="1.2.1.8"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6025 aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="GI:295699034"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="GeneID:9112685"
FT                   /translation="MDIQSDLRQHDLLIDGKRMPPGTGEYSVDINPATEESIALVAQGS
FT                   SADVDAAVRAARSALKVWNSIRAAERGRILQRLAGLMRENMEELAALESLDCGKPIAAV
FT                   MRQDVPAAIDTVEYYAGWCDKINGQVVPTRPDALTYTLREPVGVVAAIVPWNFPLMIGM
FT                   WKIAPALACGCTLIVKPAEITPLTALRIGELALEAGVPPGVLNIVTGKGSVVGDALVSH
FT                   PGIDKVTFTGSPSVGRGILQGAAGNFKRVTLELGGKSANVIFADANLDNAVRAAASGVF
FT                   FNTGQVCSAGSRILAHRDVYDEVVERLATRAKSIKVGDPSLRETSMGPLISAAQMKTVL
FT                   SYVDTGRSEGASLVTGGARVGDRGFFVEPTVFANVEHEMRISQEEIFGPVASVIRFNDE
FT                   ADAIRIANGTSYSLAAGVWSADLSRVHRVARDLKAGTVWINTYGYTDVRLPWGGAGDSG
FT                   FGREHGDLAIENFTEPKAVWVAIDQ"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /protein_id="YP_003606927.1"
FT   misc_feature    203815..205212
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="BC1002_3382"
FT   misc_feature    203872..205224
FT                   /note="Pseudomonas fluorescens 4-hydroxymuconic
FT                   semialdehyde dehydrogenase-like; Region: ALDH_HMSADH_HapE;
FT                   cd07115"
FT                   /db_xref="CDD:143433"
FT                   /locus_tag="BC1002_3382"
FT   misc_feature    order(204235..204249,204271..204273,204316..204318,
FT                   204322..204327,204469..204480,204487..204489,
FT                   204496..204501,204541..204549,204643..204645,
FT                   204934..204936,204940..204942,205018..205020,
FT                   205132..205134)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143433"
FT                   /locus_tag="BC1002_3382"
FT   misc_feature    order(204247..204249,204541..204543,204634..204636,
FT                   204643..204645)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143433"
FT                   /locus_tag="BC1002_3382"
FT   gene            complement(205318..206295)
FT                   /db_xref="GeneID:9112686"
FT                   /locus_tag="BC1002_3383"
FT   CDS_pept        complement(205318..206295)
FT                   /locus_tag="BC1002_3383"
FT                   /gene_family="HOG000050222" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.169"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   bxe:Bxe_B2259 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="GI:295699035"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112686"
FT                   /translation="MKICIFGAGAIGGLLGVQLARAGADVSFIARGPHLAAMREHGARL
FT                   IMDGETFSAPVRCTSDPSELGVQDVVIVTLKAHSLPGVVDSMQPLLGKHTAIVTGVNGI
FT                   PYWYFYQHGGRFAGTRLASVDPDGSQWTKLGPERAIGCVLYPAAEIVEPGVIKHVYGKK
FT                   FPIGEPSGERTPRIQQLHEIMQAAGFEAPIRDNIRDEIWLKLWGNLCFNPISALTHATL
FT                   DVLTSDPGTRAVSRTMMLEAKRIAEQFGVHFRVDVERRIDGAGAVGAHKTSTLVDLENR
FT                   RPMEIDPLLTVVQEMGRLVAEPTPTIDVVLALIKLREKMALQGN"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /protein_id="YP_003606928.1"
FT   misc_feature    complement(205333..206295)
FT                   /note="2-dehydropantoate 2-reductase; Reviewed; Region:
FT                   PRK06522"
FT                   /db_xref="CDD:168592"
FT                   /locus_tag="BC1002_3383"
FT   misc_feature    complement(<205984..206289)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3383"
FT   misc_feature    complement(205342..205710)
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="BC1002_3383"
FT   gene            complement(206423..207073)
FT                   /db_xref="GeneID:9112687"
FT                   /locus_tag="BC1002_3384"
FT   CDS_pept        complement(206423..207073)
FT                   /locus_tag="BC1002_3384"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_6011 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="GI:295699036"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:9112687"
FT                   /translation="MSLTAWLFFLPACFAINLAPGPNNLLSINVAARHGFIKAFVGGSG
FT                   RLLAFAMMLALAATGLAVVLHASEWIFLTIKLAGAAYLIWLAIQLWRSDAPAIDTSQPQ
FT                   EPALTRIARQEFFVAAGNPKAILVFTAFLPQFVDVAQPILPQFAALGASFLVLEWVAIA
FT                   LYSWAGMYLGKWLMRAKIRRWFNRCCGGFLAAIGVSFLLVRRARGVGFCITNS"
FT                   /protein_id="YP_003606929.1"
FT   misc_feature    complement(206459..207073)
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="BC1002_3384"
FT   gene            complement(207182..207730)
FT                   /db_xref="GeneID:9112688"
FT                   /locus_tag="BC1002_3385"
FT   CDS_pept        complement(207182..207730)
FT                   /locus_tag="BC1002_3385"
FT                   /gene_family="HOG000059063" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6010"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6010 hypothetical protein"
FT                   /db_xref="GI:295699037"
FT                   /db_xref="GeneID:9112688"
FT                   /translation="MLKGCGAVLLPTLLSACSWSWFGLNSSASATHPKTHGTGSLSVAP
FT                   ASDFAYLPARDGHVSPNRIENTGMTGLVLKDDVSLVVRNGVANSLRVAGFRIDDNKRVL
FT                   SGSIETFTVDDKRSPAIWTLKMHYVVIDAASQKVMYTTTRTVKQKSPKFTGNTIAIEDT
FT                   VKLSVDTLIGDPGFIKAVN"
FT                   /protein_id="YP_003606930.1"
FT   gene            complement(207999..208640)
FT                   /db_xref="GeneID:9112689"
FT                   /locus_tag="BC1002_3386"
FT   CDS_pept        complement(207999..208640)
FT                   /locus_tag="BC1002_3386"
FT                   /gene_family="HOG000075267" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0029"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: bpy:Bphyt_6009 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="GI:295699038"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:9112689"
FT                   /translation="MSDIAPRTACFLSSTDVSALPTYTLPAPLSAELEIRKSRFIAYAL
FT                   PVAARDAAMAELQRLRDEHPAATHVCWALLAGGQSGMSDDGEPSGTAGRPILEVLRHHD
FT                   LDGVLAAVVRYYGGVKLGAGGLVRAYTDAIASALLDAPRVERIAQVSLGVEVSYADEAK
FT                   VRRWMDAEGYALVDSAYGMLVKMTMRVPANALDAARATLTDITQGKAGFF"
FT                   /protein_id="YP_003606931.1"
FT   misc_feature    complement(208005..208580)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1739"
FT                   /db_xref="CDD:31925"
FT                   /locus_tag="BC1002_3386"
FT   misc_feature    complement(208227..208538)
FT                   /note="Uncharacterized protein family UPF0029; Region:
FT                   UPF0029; pfam01205"
FT                   /db_xref="CDD:144705"
FT                   /locus_tag="BC1002_3386"
FT   misc_feature    complement(208017..208181)
FT                   /note="Domain of unknown function (DUF1949); Region:
FT                   DUF1949; pfam09186"
FT                   /db_xref="CDD:150017"
FT                   /locus_tag="BC1002_3386"
FT   gene            208755..209381
FT                   /db_xref="GeneID:9112690"
FT                   /locus_tag="BC1002_3387"
FT   CDS_pept        208755..209381
FT                   /locus_tag="BC1002_3387"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_6008 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="GI:295699039"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:9112690"
FT                   /translation="MLDLSTLGTFVAVVLGLFLIPGPAVLLVLTRTMHGGRKAGILTGL
FT                   GIAAGDFVHTLGAAVGLSALLMTSALAFNAVKFVGAAYLVYLGIRALREKQASAHLPVV
FT                   APVSGSKAFLQAIPAEVLNPKTALFFLAFLPQFVRPEHGSTFLQFATLGLIFVAMSALY
FT                   TTLIVLTMRPLGKLVKRLTWLTRWQNKLIGVLFISLGLRVAVQTR"
FT                   /protein_id="YP_003606932.1"
FT   misc_feature    208761..209378
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="BC1002_3387"
FT   gene            209411..210040
FT                   /db_xref="GeneID:9112691"
FT                   /locus_tag="BC1002_3388"
FT   CDS_pept        209411..210040
FT                   /locus_tag="BC1002_3388"
FT                   /gene_family="HOG000219768" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /codon_start="1"
FT                   /product="DSBA oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bpy:Bphyt_6005 DsbA
FT                   oxidoreductase"
FT                   /db_xref="GI:295699040"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="GeneID:9112691"
FT                   /translation="MNENPSSTARAIEFWFDFGSNYSYLSMMRIEALAAARRVTIVWRP
FT                   FLLGPVFRQLGFDNSPFVLQKEKGAYVWKDMERQCRKYGIALTRPSTFPRAALLAMRVA
FT                   LLGANEPWIGVWCRKIMQLNFVDDRDIGSIDVVSEALDSLGLPVQSVIDAAQSDANKLR
FT                   LREQTELAINKGIFGAPTFFVGGEMFWGNDRLEDAFDYCDAIAARH"
FT                   /protein_id="YP_003606933.1"
FT   misc_feature    209417..210001
FT                   /note="2-hydroxychromene-2-carboxylate isomerase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: NahD; COG3917"
FT                   /db_xref="CDD:33703"
FT                   /locus_tag="BC1002_3388"
FT   misc_feature    209444..209998
FT                   /note="DsbA family, 2-hydroxychromene-2-carboxylate (HCCA)
FT                   isomerase subfamily; HCCA isomerase is a glutathione (GSH)
FT                   dependent enzyme involved in the naphthalene catabolic
FT                   pathway. It converts HCCA, a hemiketal formed spontaneously
FT                   after ring cleavage of 1,2-; Region: DsbA_HCCA_Iso;
FT                   cd03022"
FT                   /db_xref="CDD:48571"
FT                   /locus_tag="BC1002_3388"
FT   misc_feature    209468..209470
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:48571"
FT                   /locus_tag="BC1002_3388"
FT   gene            complement(210057..210311)
FT                   /db_xref="GeneID:9112692"
FT                   /locus_tag="BC1002_3389"
FT   CDS_pept        complement(210057..210311)
FT                   /locus_tag="BC1002_3389"
FT                   /gene_family="HOG000219509" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2240"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2240 hypothetical protein"
FT                   /db_xref="GI:295699041"
FT                   /db_xref="GeneID:9112692"
FT                   /translation="MVEEMVVEHLRAMPGHQWTRQIHSCKVSDPLQQPWGRSYRLVEWT
FT                   MKHEPESSRRVVPAESTPLEIAQAVVSHVPGRRFCQQAD"
FT                   /protein_id="YP_003606934.1"
FT   misc_feature    complement(210060..210254)
FT                   /note="Protein of unknown function (DUF2866); Region:
FT                   DUF2866; pfam11065"
FT                   /db_xref="CDD:151510"
FT                   /locus_tag="BC1002_3389"
FT   gene            210657..211772
FT                   /db_xref="GeneID:9112693"
FT                   /locus_tag="BC1002_3390"
FT   CDS_pept        210657..211772
FT                   /locus_tag="BC1002_3390"
FT                   /gene_family="HOG000272062" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bxe:Bxe_B2239 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="GI:295699042"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="GeneID:9112693"
FT                   /translation="MTKLAQTPLSERLRSLVDTVQHNERTLRRFQNVELRLIGAPDFAS
FT                   FLDTLFSHLPREFALANVVLWLDDRAPMLLELLQPDNLHALEHAQLKTSREGGLIARSL
FT                   CEDDRPWLGRPAELADDARRAFFGAAPAHVPASAILLPLAAGKSVSGYLCLGSDDPARF
FT                   GAGMATDILERFASIVTASLDNVAHRERLKQLGMTDSLTGLANRRYFDERLREELMRAV
FT                   RYRAPVACLFIDIDGFKSINDSHGHQIGDRALAAVAACVRQQVRLGDTVARYGGEEFAA
FT                   LLQGDRSDALTVAERVRLAVENLDVRDEHGERIALSVSIGVAARVVAGSPADAMSLGQA
FT                   MMDEADRAMYQAKRNGRNRIEAQADALDEQG"
FT                   /protein_id="YP_003606935.1"
FT   misc_feature    <210681..211205
FT                   /note="Protein of unknown function, DUF484; Region: DUF484;
FT                   cl01228"
FT                   /db_xref="CDD:174590"
FT                   /locus_tag="BC1002_3390"
FT   misc_feature    211245..211739
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3390"
FT   misc_feature    order(211356..211358,211485..211487)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3390"
FT   misc_feature    order(211371..211373,211380..211385,211395..211397,
FT                   211407..211409,211473..211475,211479..211490)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3390"
FT   misc_feature    order(211461..211463,211542..211544)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3390"
FT   gene            complement(211800..213539)
FT                   /db_xref="GeneID:9112694"
FT                   /locus_tag="BC1002_3391"
FT   CDS_pept        complement(211800..213539)
FT                   /locus_tag="BC1002_3391"
FT                   /gene_family="HOG000049554" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.129"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6002 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; Penicillin-binding protein dimerisation
FT                   domain"
FT                   /db_xref="GI:295699043"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="GeneID:9112694"
FT                   /translation="MIRQKKPPSPDPYALAAKNPLLDARLPAWRSKFIVLLVFGAFATL
FT                   AARAFWVQVVNQDFYVDQGQKRYQRLLELDATRGGIVDRNGSMLAVSLATYEIWASPKL
FT                   VDESAFAPLAKLLDLPPADLRRRLNGERSFVLLKRQVDADTAEHLSRLGLAGIIQVADT
FT                   KRFYPEGESAAHVVGFTDIEDNGQEGVELSADAQLQGVPGQREVIRDRLGRVISETRPL
FT                   VPARNGATIQLTIDRRIQQLAYTQLKAAIAEHRAEAGSVVVLDARNGEILALANYPSFD
FT                   PNDRTHLSGRQLRNRAVIDTFEPGSTIKPLVVALSIDEGKVRPQSIIDTAPGWYRIGPA
FT                   VIHDTSNHGAMTVAEAVQKSSNIALAKLALNLPAETIWTKYQQYGLGVKPELPFPGVAA
FT                   GKLRPYNRWRPIEQATMAYGYGLSVSLLQIAQVYTAYAGDGALRRVSLLRQPLDADDPT
FT                   SFAARSEPVTTPGTARAIRNMLEMATGEGGTGRAASVAGYRVGGKTGTARKQIGAGYAP
FT                   NRYRALFVGMAPMSNPHLIVAVMIDDPAGKAFYGGTVAGPVFSGVMGGALQLLGVPPDA
FT                   AGV"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /protein_id="YP_003606936.1"
FT   misc_feature    complement(211809..213488)
FT                   /note="Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane];
FT                   Region: FtsI; COG0768"
FT                   /db_xref="CDD:31111"
FT                   /locus_tag="BC1002_3391"
FT   misc_feature    complement(212883..213320)
FT                   /note="Penicillin-binding Protein dimerization domain;
FT                   Region: PBP_dimer; pfam03717"
FT                   /db_xref="CDD:146381"
FT                   /locus_tag="BC1002_3391"
FT   misc_feature    complement(211851..212765)
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="BC1002_3391"
FT   gene            complement(213862..215403)
FT                   /db_xref="GeneID:9112695"
FT                   /locus_tag="BC1002_3392"
FT   CDS_pept        complement(213862..215403)
FT                   /locus_tag="BC1002_3392"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2237 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   Cache type 2 domain protein; SMART: chemotaxis sensory
FT                   transducer"
FT                   /db_xref="GI:295699044"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013163"
FT                   /db_xref="GeneID:9112695"
FT                   /translation="MTLNRKLTSMIAVLWVGLILIGAFGAWQNRASMISDRREQLRSLI
FT                   EEANHVTAHYYALAQQHALSEDEAKKQALATLGAMRYGKDGYLSINDSQPVMLMHPFKP
FT                   ELVGKNLAQFTDPAGNHLFVDIVNAGNHDGGGFVDYLWAKPGSEQPVAKTSYSMHFAPW
FT                   DMYLVTGMYMDDLQSAFYRNLLRWLAITVALGALSTAVMLVVLRSIRRSLGGELEAAVK
FT                   HARLMAQGNLATPVPIAPHDNGSLLHALRTMQAGLVETVSRVRQGTENINVGANEIAAG
FT                   NTDLSQRTEEQAAALVQTASSMDQMTVNVKQNADSASQAAQLASDAANVATRGSRVVDD
FT                   VVRTMGEITASSRQIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEVRS
FT                   LAQRSATAAKEIKALIETSTDTVETGASLVANAGATMGEIVQSVRRVNEILEEISHASR
FT                   EQSAGIEQVNRAVGEMDQVTQQNAALVEEAAAAAHSLKDQVGVLRDAIASFALPA"
FT                   /protein_id="YP_003606937.1"
FT   misc_feature    complement(<214717..215403)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: COG4564"
FT                   /db_xref="CDD:34202"
FT                   /locus_tag="BC1002_3392"
FT   misc_feature    complement(215032..215316)
FT                   /note="Cache domain; Region: Cache_2; pfam08269"
FT                   /db_xref="CDD:149365"
FT                   /locus_tag="BC1002_3392"
FT   misc_feature    complement(213871..>214950)
FT                   /note="methyl-accepting protein IV; Provisional; Region:
FT                   PRK09793"
FT                   /db_xref="CDD:170098"
FT                   /locus_tag="BC1002_3392"
FT   misc_feature    complement(213877..214410)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="BC1002_3392"
FT   gene            215955..217682
FT                   /db_xref="GeneID:9112696"
FT                   /locus_tag="BC1002_3393"
FT   CDS_pept        215955..217682
FT                   /locus_tag="BC1002_3393"
FT                   /gene_family="HOG000171929" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02320"
FT                   /codon_start="1"
FT                   /product="phosphoenolpyruvate phosphomutase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoenolpyruvate phosphomutase; KEGG:
FT                   bxe:Bxe_B2235 2,3-dimethylmalate lyase"
FT                   /db_xref="GI:295699045"
FT                   /db_xref="InterPro:IPR012698"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="GeneID:9112696"
FT                   /translation="MNAREPAFVSQSRSARLRQMLVSSELEFMMEAHNGLSARIVREAG
FT                   FKAIWGSGLAISAQFGVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRR
FT                   LVRKLEQRGIAGVCIEDKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQNDEHFSIV
FT                   ARVEALIAGWGMDEALRRAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVP
FT                   TKYYSTPTEVFREAGISTVIWANHLIRAATSAMQAVAKEIHASETLVNVEDSIAAVNEI
FT                   FRLQDADEYSEAEDRYLSGGRAAGSAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRW
FT                   LVDAFKKQGVNDITVVGGYRADAIDTAGIRLVVNEQHAQTGELASLVCALDKLTGDTVV
FT                   SYGDLLFRSYILRDLVESEAAFSVVVDSSLTDTENASVRDFAWCSAADDRGLFGNKIVL
FT                   RHVASGREQSSAASAAQVPHGRWVGLLNVRGAGLERLQAVMRELQTRDDFASLDMPALL
FT                   NALIEAGESIEVQYVHGHWRGVNDLDDFRRAGDFAHAQAPFATAVGGATANDAHGGAQ"
FT                   /protein_id="YP_003606938.1"
FT   misc_feature    215982..216851
FT                   /note="PEP phosphonomutase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: PrpB;
FT                   COG2513"
FT                   /db_xref="CDD:32583"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    216003..216737
FT                   /note="Members of the ICL/PEPM enzyme family catalyze
FT                   either P-C or C-C bond formation/cleavage. Known members
FT                   are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
FT                   hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
FT                   oxaloacetate hydrolase (OAH), isocitrate...; Region:
FT                   ICL_PEPM; cd00377"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    order(216009..216011,216030..216032,216036..216047,
FT                   216051..216065,216069..216074,216081..216083,
FT                   216087..216095,216114..216116,216126..216131,
FT                   216138..216143,216150..216161,216165..216170,
FT                   216177..216182,216186..216191,216198..216203,
FT                   216243..216245,216261..216266,216276..216278,
FT                   216285..216287,216378..216383,216390..216392,
FT                   216399..216404,216411..216413,216702..216710,
FT                   216714..216722,216726..216734)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    order(216102..216104,216108..216116,216144..216146,
FT                   216225..216227,216231..216233,216312..216314,
FT                   216447..216449,216540..216542,216615..216617,
FT                   216621..216623,216684..216686)
FT                   /note="active site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    order(216144..216146,216225..216227,216231..216233,
FT                   216312..216314)
FT                   /note="Mg2+/Mn2+ binding site; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    216873..217598
FT                   /note="Phosphocholine cytidylyltransferases catalyze the
FT                   synthesis of CDP-choline; Region: PC_cytidylyltransferase;
FT                   cd02523"
FT                   /db_xref="CDD:133014"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    order(216882..216893,217095..217100,217107..217109,
FT                   217158..217163,217278..217280,217488..217490,
FT                   217494..217496,217566..217568,217572..217574)
FT                   /note="active site"
FT                   /db_xref="CDD:133014"
FT                   /locus_tag="BC1002_3393"
FT   misc_feature    order(217161..217163,217566..217568,217572..217574)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:133014"
FT                   /locus_tag="BC1002_3393"
FT   gene            217679..218842
FT                   /db_xref="GeneID:9112697"
FT                   /locus_tag="BC1002_3394"
FT   CDS_pept        217679..218842
FT                   /locus_tag="BC1002_3394"
FT                   /gene_family="HOG000171928" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03297"
FT                   /codon_start="1"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2234 putative thiamine pyrophosphate
FT                   enzyme; TIGRFAM: phosphonopyruvate decarboxylase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding"
FT                   /db_xref="GI:295699046"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017684"
FT                   /db_xref="GeneID:9112697"
FT                   /translation="MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDESLHYVSA
FT                   ANEGDAVALIAGVTLGAKNGRRGITMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQ
FT                   PGVADEPQHALMGPITPAMLDTMEIPWETFPTEAEAIGPALDRAIAHMDATGRPYALVM
FT                   QKGSVAPYELKDGGAPARRTPVEPRAQFRGVAANELPTRHDALQKVIAHTPPDSTVVLA
FT                   STGFCGRELYAIDDRANQLYMVGSMGCVTPFALGLALARPDLRVVALDGDGAALMRMGV
FT                   FATLGAYGPSNLTHVLLDNGAHDSTGGQATVSSQVSFAGVAAACGYASAVESDDPSVID
FT                   ELFAAPPLEGPRFARLTIRRGTPDGLPRPTITPPDVKARLMRHIGAI"
FT                   /protein_id="YP_003606939.1"
FT   misc_feature    217697..218152
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    217721..218830
FT                   /note="phosphonopyruvate decarboxylase; Region:
FT                   Ppyr-DeCO2ase; TIGR03297"
FT                   /db_xref="CDD:132340"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    order(217730..217732,217745..217750,217760..217762,
FT                   217772..217774,217799..217819,217826..217828,
FT                   217835..217840,217847..217852,217856..217861,
FT                   217868..217870,217901..217903,217922..217924,
FT                   217934..217936,217943..217948)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    order(217745..217753,217760..217762,217772..217774,
FT                   217802..217804,217808..217819,217823..217825,
FT                   217901..217903,217910..217915,217919..217924,
FT                   217931..217933,218021..218023,218030..218032)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    order(217745..217747,217820..217822,217901..217903,
FT                   217913..217915)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    218282..218830
FT                   /note="TPP-binding module; composed of proteins similar to
FT                   phosphonopyruvate decarboxylase (PpyrDC) proteins. PpyrDC
FT                   is a homotrimeric enzyme which functions in the
FT                   biosynthesis of C-P compounds such as bialaphos tripeptide
FT                   in Streptomyces hygroscopicus...; Region: TPP_PpyrDC;
FT                   cd03371"
FT                   /db_xref="CDD:48182"
FT                   /locus_tag="BC1002_3394"
FT   misc_feature    order(218417..218419,218489..218500,218576..218578,
FT                   218582..218584)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48182"
FT                   /locus_tag="BC1002_3394"
FT   gene            218866..219933
FT                   /db_xref="GeneID:9112698"
FT                   /locus_tag="BC1002_3395"
FT   CDS_pept        218866..219933
FT                   /locus_tag="BC1002_3395"
FT                   /gene_family="HOG000171816" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03301"
FT                   /codon_start="1"
FT                   /product="2-aminoethylphosphonate aminotransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5997 2-aminoethylphosphonate
FT                   aminotransferase; TIGRFAM: 2-aminoethylphosphonate
FT                   aminotransferase; PFAM: aminotransferase class V"
FT                   /db_xref="GI:295699047"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017688"
FT                   /db_xref="GeneID:9112698"
FT                   /translation="MLLLNPGPVTLTERVRNSLLQTDLCHRESEFFDLQEEARTRLVDV
FT                   YGLDPNEWQAVLMTGSGTAAVESMTAALVPHNGKLLVVENGVYGERITQIAAQYGIAHE
FT                   ALKHDWMATPDLAKIAERLDADQSFTHVAVIHHETTTGRLNDIAALGALCRERGLRLLV
FT                   DGVSSFGAEAIDFADASLDALAATANKCLHGVPGASFVLVRRAALARAASRTYYLDLAR
FT                   LARLQDQRNTPFTPSVHAYYALVEALRELADEGGWRARHARYAALAEQVRAGLAARGIG
FT                   SVLPAGESSVVLRAYRLPNGIAYPQLHDALKARGFVIYAGQGGLSAELFRISTMGNIHA
FT                   ADIDRLLQGFSDLAG"
FT                   /protein_id="YP_003606940.1"
FT   misc_feature    218869..219924
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="BC1002_3395"
FT   misc_feature    order(219049..219054,219061..219063,219268..219270,
FT                   219355..219357,219364..219366,219424..219426,
FT                   219433..219435)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="BC1002_3395"
FT   misc_feature    219433..219435
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="BC1002_3395"
FT   gene            complement(219975..220127)
FT                   /db_xref="GeneID:9112699"
FT                   /locus_tag="BC1002_3396"
FT   CDS_pept        complement(219975..220127)
FT                   /locus_tag="BC1002_3396"
FT                   /gene_family="HOG000250209" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5996"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5996 hypothetical protein"
FT                   /db_xref="GI:295699048"
FT                   /db_xref="GeneID:9112699"
FT                   /translation="MSYDMHTSPIPDPNADPNRDPEADPLVPPSPGHHVEEPQRPDGPP
FT                   DKDPV"
FT                   /protein_id="YP_003606941.1"
FT   gene            complement(220255..220962)
FT                   /db_xref="GeneID:9112700"
FT                   /locus_tag="BC1002_3397"
FT   CDS_pept        complement(220255..220962)
FT                   /locus_tag="BC1002_3397"
FT                   /gene_family="HOG000268300" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /codon_start="1"
FT                   /product="LmbE family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LmbE family protein; KEGG: bpy:Bphyt_5995 LmbE
FT                   family protein"
FT                   /db_xref="GI:295699049"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="GeneID:9112700"
FT                   /translation="MSETTPRLFIVSPHFDDAVFSCGALLAAHPDAAVCTVFAAPPEHD
FT                   MHTEWDQKAGFANAHEAVRERTVEDNRALEVLDAIPLRMPFRDSQYADSPSISQMAAAL
FT                   EETIYRTTANTLLMPLGLHHEDHARVFEACCEILPRLTHLDWFGYEEAIHRLTPGAVQA
FT                   RLADLAQRGIVATPATPSAGHTIDVQRRAHLKREAVNAYASQLRAFGPGNYEDVFATER
FT                   YWQLSVGRKRARK"
FT                   /protein_id="YP_003606942.1"
FT   misc_feature    complement(220585..220935)
FT                   /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929"
FT                   /db_xref="CDD:163934"
FT                   /locus_tag="BC1002_3397"
FT   gene            221355..222998
FT                   /db_xref="GeneID:9112701"
FT                   /locus_tag="BC1002_3398"
FT   CDS_pept        221355..222998
FT                   /locus_tag="BC1002_3398"
FT                   /gene_family="HOG000229980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_B1335 acyl-CoA synthetase (AMP-forming)/AMP-acid
FT                   ligase II"
FT                   /db_xref="GI:295699050"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:9112701"
FT                   /translation="MRDNATAAAPSAYAYPLLIKQLLHTPFVQAPDQQIVYRGQHRMTY
FT                   TTLRERIARLANGLSRLGARHGSTVAVMDWDSHRYLECYFAVPMMGAVLQTVNVRLSPD
FT                   EIAYTINHAGAEILFVHTDFLPLVEAIKGQLETVRTFVWIDEQGSEAAAHSIPFSAEYE
FT                   AMLEESSDRYEFPDFDENTRATTFYTTGTTGLPKGVYFSHRQLVLHTITGMAALASPES
FT                   GQRFHRGDVYMPLTPMFHVHAWGMPYIATMLGVKQVYPGRYLPDRLVKLVRDEGVTFSH
FT                   CVSTILHMILGCEQARSVDFSKWKIVIGGGALTHGLARAALERGIDIFAGYGMSETCPL
FT                   LSLAQLPPGAEALDADEQLRLRCTTGRPIPLVDLRIVDQSMEEAAHDGSAYGEIVVRAP
FT                   WLTQGYLNNPEASVQLWSGGYLHTQDIATISPSGSIQITDRLKDVIKSGGEWISSLEIE
FT                   SLISLYPGVSEVAVIGISDEKWGERPVALVVLSEGAAVSEDDIKRHVLTFSESGRISKY
FT                   AVPQIVRFVDALEKTSVGKLNKKWLRAQFA"
FT                   /protein_id="YP_003606943.1"
FT   misc_feature    221403..222995
FT                   /note="long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK06187"
FT                   /db_xref="CDD:168450"
FT                   /locus_tag="BC1002_3398"
FT   misc_feature    221403..222992
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="BC1002_3398"
FT   gene            complement(223194..223781)
FT                   /db_xref="GeneID:9112702"
FT                   /locus_tag="BC1002_3399"
FT   CDS_pept        complement(223194..223781)
FT                   /locus_tag="BC1002_3399"
FT                   /gene_family="HOG000280424" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5992"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5992 hypothetical protein"
FT                   /db_xref="GI:295699051"
FT                   /db_xref="GeneID:9112702"
FT                   /translation="MAYASLATGVLLAAGFGSRFDPHGLHNKLLAQMPDGTLVAHEAAH
FT                   RLLQVVTRVLAVVRPGSDALARVLNDAGCDVVFAASAERGMGASLAAGIEASDDAEGWI
FT                   VALADMPRIAIPTIEAVARALDNGAPLVAPFYEGQRGHPVGFGSEHRDALLALDGDTGA
FT                   KALLKSRALTRIDVDDPGILRDVDTPDDLRTL"
FT                   /protein_id="YP_003606944.1"
FT   misc_feature    complement(223203..223760)
FT                   /note="GT_2_like_f is a subfamily of the
FT                   glycosyltransferase family 2 (GT-2) with unknown function;
FT                   Region: GT_2_like_f; cd04182"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="BC1002_3399"
FT   misc_feature    complement(order(223455..223457,223740..223742,
FT                   223746..223748))
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="BC1002_3399"
FT   misc_feature    complement(order(223221..223223,223227..223229,
FT                   223455..223457))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:133025"
FT                   /locus_tag="BC1002_3399"
FT   gene            complement(223914..226127)
FT                   /db_xref="GeneID:9112703"
FT                   /locus_tag="BC1002_3400"
FT   CDS_pept        complement(223914..226127)
FT                   /locus_tag="BC1002_3400"
FT                   /gene_family="HOG000244716" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /codon_start="1"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: bxe:Bxe_B2226 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein"
FT                   /db_xref="GI:295699052"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="GeneID:9112703"
FT                   /translation="MNLIGQPLDRVDGLLKVTGDARYAAEFPGARLAHAVLVTSTIPAG
FT                   TISSIDASRAEAVPGVLLVMTYQNAPRLPNGGKPALSPPAGRHLSLLQDNEVHYSNEPV
FT                   AVVVADTLEHATDAARQLRIVYQPGAAALDFEQAKPHAHAPDKPQGRQTDTQRGSFEDG
FT                   MQSGDVHIEATYTTPIEHHNPMEPHATMAHWDGPQLTVYDSTQGVSGTAQVLAKTFAIP
FT                   VSDVRVISPLIGGGFGCKGSSWSHVSLCAMAARQTGRPVRLVLERPQMFGPVGARPRTE
FT                   QHFVIAARHDGTLSAMRHDSISNTSMIEDWTETCCMVTRMLYAVPNQVTTHRLVQLNVG
FT                   TPTFMRAPGETTGSFALESAMDELAVALKMDPLALRLKNYADSDPQEHKPWSGKSLREC
FT                   YQIGAEKFGWSRRSQTPRSMRNGNTLIGMGMATATYPANRSEASALAQILPDGTAVVAS
FT                   GTQDIGTGTYTVMTQVAADALGFTPEQIHFALGDSSLPRAPVSGGSQSAASVSPAVRDA
FT                   ASQARSQLIALALADAASPVHGLPLDDVIVESGWVVSRSQPGKRDPAAAIIARAGGKPI
FT                   EATATVKPGDEKQKYSFHSFGAVFVEVHVDAELGTIRVPRVVAVYDVGRVLNHKTARSQ
FT                   MMGGIVWGIGAAMQEESTLDERFGRFTNANLAEYHVPVNADIGTIDITFIDRPDPYINS
FT                   LGVRGIGEIGITAVVAAIANAVYNATGVRVRDLPITLDKVVRT"
FT                   /protein_id="YP_003606945.1"
FT   misc_feature    complement(223920..226127)
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit CoxL/CutL homologs [Energy production and
FT                   conversion]; Region: CoxL; COG1529"
FT                   /db_xref="CDD:31718"
FT                   /locus_tag="BC1002_3400"
FT   misc_feature    complement(225744..226076)
FT                   /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
FT                   hammerhead domain; Region: Ald_Xan_dh_C; pfam01315"
FT                   /db_xref="CDD:144787"
FT                   /locus_tag="BC1002_3400"
FT   misc_feature    complement(224097..225707)
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="BC1002_3400"
FT   gene            complement(226124..227125)
FT                   /db_xref="GeneID:9112704"
FT                   /locus_tag="BC1002_3401"
FT   CDS_pept        complement(226124..227125)
FT                   /locus_tag="BC1002_3401"
FT                   /gene_family="HOG000244727" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /codon_start="1"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   bxe:Bxe_B2225 oxidoreductase"
FT                   /db_xref="GI:295699053"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="GeneID:9112704"
FT                   /translation="MDAISYERAGDVASAVRAAQQPGAVFIGGGTNLLDLMKGGVARPV
FT                   RLIDITHIGGLDSVTTLPGGGLRIGALVRNSDAANHALVREQYPLLSQALLAGASPQLR
FT                   NMATVGGNLLQRTRCGYFYDTAFTHCNKRLPGSGCAALDGHNRAHAILGASPQCIAVNP
FT                   SDMSVALAALDALVRVNGPGGERTIAFADFHRLPGDRPDVDTTLQPGELITAVDLPPPL
FT                   FSAHSHYLKVRDRASYAFALVSVAAALQMDGERVQSARIALGGVAHKPWRANVAEHMLS
FT                   GQPLSQATLKNAAAAALSGAQPRHDNAFKVQLAQRAIVRAVNQAAGNAGGVA"
FT                   /protein_id="YP_003606946.1"
FT   misc_feature    complement(226166..227125)
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM homologs [Energy production and
FT                   conversion]; Region: CoxM; COG1319"
FT                   /db_xref="CDD:31510"
FT                   /locus_tag="BC1002_3401"
FT   misc_feature    complement(226463..227122)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="BC1002_3401"
FT   misc_feature    complement(226166..226444)
FT                   /note="CO dehydrogenase flavoprotein C-terminal domain;
FT                   Region: CO_deh_flav_C; pfam03450"
FT                   /db_xref="CDD:146206"
FT                   /locus_tag="BC1002_3401"
FT   gene            complement(227137..227916)
FT                   /db_xref="GeneID:9112705"
FT                   /locus_tag="BC1002_3402"
FT   CDS_pept        complement(227137..227916)
FT                   /locus_tag="BC1002_3402"
FT                   /gene_family="HOG000166647" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /codon_start="1"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: bxe:Bxe_B2224 2Fe-2S ferredoxin"
FT                   /db_xref="GI:295699054"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9112705"
FT                   /translation="MRWTSTRRQPALTFQWSQQIVMTTPTECQHCGDTPASESTAEPNT
FT                   TPSQPSRRRFLQSAAAAATIGAAPHLRAQEQAPASTAPQSNPVVPPHAVTLTVNGRAYA
FT                   LQLEPRVTLLDALREYAGLMGTKKGCDRGQCGACTVLVDGRRINSCLTLAVMHEGENIT
FT                   TVEGLASNGTLSPVQAAFIEHDAFQCGYCTPGQLCSATALLGEFRNGTASTVTADVRAR
FT                   PAALTDDEIRERMSGNICRCGAYVNIVAAVRAAHEHA"
FT                   /protein_id="YP_003606947.1"
FT   misc_feature    complement(227161..227790)
FT                   /note="putative xanthine dehydrogenase iron-sulfur-binding
FT                   subunit; Provisional; Region: PRK11433"
FT                   /db_xref="CDD:171112"
FT                   /locus_tag="BC1002_3402"
FT   misc_feature    complement(<227488..227637)
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3402"
FT   misc_feature    complement(order(227503..227514,227518..227520,
FT                   227527..227529,227536..227541))
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3402"
FT   misc_feature    complement(order(227503..227505,227512..227514,
FT                   227527..227529))
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3402"
FT   misc_feature    complement(227155..227427)
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="BC1002_3402"
FT   gene            complement(228129..228638)
FT                   /db_xref="GeneID:9112706"
FT                   /locus_tag="BC1002_3403"
FT   CDS_pept        complement(228129..228638)
FT                   /locus_tag="BC1002_3403"
FT                   /gene_family="HOG000228250" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /codon_start="1"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: bxe:Bxe_B0324 putative hydrogenase/oxidoreductase
FT                   subunit"
FT                   /db_xref="GI:295699055"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="GeneID:9112706"
FT                   /translation="MWQLIRQFARTDFPGEPAPAAEDAWLHEERRIREDILDLLGRALC
FT                   IRQIDAGSCNGCELEIHALNNPYYNIEGLGIKFVASPRHADLLLVTGPVTLNMRAALLA
FT                   AYDATPAPKLVVAAGECACTGGIFANSYAVCGPVSSILPVDVTIPGCPPPPIDLLRGIL
FT                   TACRAR"
FT                   /protein_id="YP_003606948.1"
FT   misc_feature    complement(228144..228533)
FT                   /note="NADH ubiquinone oxidoreductase, 20 Kd subunit;
FT                   Region: Oxidored_q6; cl00419"
FT                   /db_xref="CDD:174193"
FT                   /locus_tag="BC1002_3403"
FT   gene            complement(228638..230200)
FT                   /db_xref="GeneID:9112707"
FT                   /locus_tag="BC1002_3404"
FT   CDS_pept        complement(228638..230200)
FT                   /locus_tag="BC1002_3404"
FT                   /gene_family="HOG000228265" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B0325"
FT                   /codon_start="1"
FT                   /product="putative formate hydrogenlyase subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B0325 putative formate hydrogenlyase
FT                   subunit"
FT                   /db_xref="GI:295699056"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="GeneID:9112707"
FT                   /translation="MRLESMQLAATRLTHRAGQIPAAVVSADESAWLGLARTARSEQGR
FT                   LVAMWGSEAAEEGFSVNAAYECDDGIVWVRLPIGRKQKAGGDYPDLATVFPCATRMQRA
FT                   IFDLTGLRARGAQDTRPWLNHGNWPDDYFPLQRQASGVEAFESSEADYPFVQVAGDGVH
FT                   EIAVGPIHAGTIEPGHFRFSVVGEKVLRLEERLGYVHRGVERLFERTPASHGHRVAARI
FT                   AGDSTVAFAWAFSMALEQASGTQLSKRALYLRALLLERERVANHLGDLGALGNDAGFGF
FT                   GLAQFSRLKEDWIRTNARLFGHRYLMDRIVPGGVSVDVRGDDAAVLTRQCERIEREVHV
FT                   MRKVYEDQSGLQDRFLGTGRLTPAVVEHFGVRGMAARASGRIFDVRANLRAAPYDDIAV
FT                   NAIGDARGDVAARVAVRFAEIDESLRLIRTLLTNLPDDGPAVVAMRPATAPAQGVGWVE
FT                   GWRGDVFVALDLAPGDVIGRCHCHDPSWQNWPALEHAIIGNIVPDFPLINKSFNLNYAG
FT                   HDL"
FT                   /protein_id="YP_003606949.1"
FT   misc_feature    complement(229790..230098)
FT                   /note="Respiratory-chain NADH dehydrogenase, 30 Kd subunit;
FT                   Region: Complex1_30kDa; cl00539"
FT                   /db_xref="CDD:174274"
FT                   /locus_tag="BC1002_3404"
FT   misc_feature    complement(228641..229735)
FT                   /note="Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   Region: Complex1_49kDa; cl00417"
FT                   /db_xref="CDD:174191"
FT                   /locus_tag="BC1002_3404"
FT   gene            complement(230204..231667)
FT                   /db_xref="GeneID:9112708"
FT                   /locus_tag="BC1002_3405"
FT   CDS_pept        complement(230204..231667)
FT                   /locus_tag="BC1002_3405"
FT                   /gene_family="HOG000020533" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /codon_start="1"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bxe:Bxe_B0326 hydrogenase 4 subunit F"
FT                   /db_xref="GI:295699057"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="GeneID:9112708"
FT                   /translation="MNDAHVVLAVLGIPLVAAASLAAVRPAGVARNLNAGFSFVTFAAT
FT                   LVLAARTVEHGPSFAFDRAFFVDPLNVYLVALTAFVGWTTSLFSRPYMQIEEARGRMTA
FT                   PRMRLYHSMYQLFMFAMLLALLTNNLGVLWVAMEGATLATVLLVSVYRTAASLEAAWKY
FT                   FILCGVGIAQALFGTILLYLAASRQLSDGDALLWTSLAAVRTHLDPSIVSIAFVFLLVG
FT                   YGTKVGLVPMHNWLPDAHAEGPTPISAVLSGLLLNVALYAVLRCKVLADGALGNGLPGR
FT                   LLVGFGLVSVLIASFSLFRQKDVKRLFSYSSIEHMGLMTFAFGLGGPVATFAGLLHMTV
FT                   HSLVKSAIFFAVGHAAQKTGTQAIEGIRGLLQVSPTVGWSMMLGALAILGLPPFGVFAS
FT                   EFLILTTAMNTLPWTAPLLLLGLAVAFAAIFARVQRMVFGETTTAKPLEHRPAPLPVFV
FT                   HLGLGLMLGLYVPPYLATWYRQAATMLAG"
FT                   /protein_id="YP_003606950.1"
FT   misc_feature    complement(230207..231667)
FT                   /note="hydrogenase 4 subunit F; Validated; Region:
FT                   PRK06458"
FT                   /db_xref="CDD:168559"
FT                   /locus_tag="BC1002_3405"
FT   misc_feature    complement(230456..231286)
FT                   /note="NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; Region: Oxidored_q1; cl14187"
FT                   /db_xref="CDD:175557"
FT                   /locus_tag="BC1002_3405"
FT   gene            complement(231660..232319)
FT                   /db_xref="GeneID:9112709"
FT                   /locus_tag="BC1002_3406"
FT   CDS_pept        complement(231660..232319)
FT                   /locus_tag="BC1002_3406"
FT                   /gene_family="HOG000046791" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BURPS668_A1615"
FT                   /codon_start="1"
FT                   /product="putative hydrogenase, membrane subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bpd:BURPS668_A1615 putative hydrogenase,
FT                   membrane subunit"
FT                   /db_xref="GI:295699058"
FT                   /db_xref="GeneID:9112709"
FT                   /translation="MHAYATQLINFLAAVLLMLSFAMLSQRRILSLIHLYTLQGVALVL
FT                   AILILGFVTGDAHLYVSAGLTLVLKVGVIPWILYRLVRRLDIQADVEPLINIPTTLLIG
FT                   IVLVIIAFNVASPISQLATSAARGTLGIALACVLLSFMAMITRAKAVPQVIGFLSMENG
FT                   LFFAATAATNGMPMIVELGIGLDVLVGILILGVFMFQIREQFDSLDIHHLEKLKDE"
FT                   /protein_id="YP_003606951.1"
FT   misc_feature    complement(<231831..232304)
FT                   /note="Hydrogenase 4 membrane component (E) [Energy
FT                   production and conversion]; Region: HyfE; cl12087"
FT                   /db_xref="CDD:175400"
FT                   /locus_tag="BC1002_3406"
FT   gene            complement(232320..233270)
FT                   /db_xref="GeneID:9112710"
FT                   /locus_tag="BC1002_3407"
FT   CDS_pept        complement(232320..233270)
FT                   /locus_tag="BC1002_3407"
FT                   /gene_family="HOG000228278" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BTH_II1262"
FT                   /codon_start="1"
FT                   /product="formate hydrogenlyase subunit 4"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_II1262 formate hydrogenlyase subunit
FT                   4"
FT                   /db_xref="GI:295699059"
FT                   /db_xref="GeneID:9112710"
FT                   /translation="MVTLSGVLSQSLEIIVALAAAPLLTGWVNQCRAWLQNRRAPSIWQ
FT                   PYRMLHKLFNKESVVAHGASPVFRGAPYVVWAAMTLACAVVPTLSTELPLSPAADAIAL
FT                   VGLFAFARVALSLAAMDVGTAFGTLGARREMLVGFLAEPALLMVLLSASLITQSTLLTS
FT                   IVATLGHSELTIYPSLAFAGIAFTLVSLAENARLPVDNPTTHLELTMIHEALILEYSGR
FT                   HLALMEWAASLKLFAYSCIGIALFMPWGIAAAGNPLALVFAVPALFVKLMVGGAALAVV
FT                   ETANAKMRIFRVPEFLATAFLLAVIGMLVHLLLGA"
FT                   /protein_id="YP_003606952.1"
FT   misc_feature    complement(232332..233270)
FT                   /note="NADH dehydrogenase; Region: NADHdh; cl00469"
FT                   /db_xref="CDD:174224"
FT                   /locus_tag="BC1002_3407"
FT   gene            complement(233264..235270)
FT                   /db_xref="GeneID:9112711"
FT                   /locus_tag="BC1002_3408"
FT   CDS_pept        complement(233264..235270)
FT                   /locus_tag="BC1002_3408"
FT                   /gene_family="HOG000278686" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /codon_start="1"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bpd:BURPS668_A1617 hydrogenase 4 subunit B"
FT                   /db_xref="GI:295699060"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="GeneID:9112711"
FT                   /translation="MAPFPVVHFVLLVAAAWLAVGTLGLGVLHRTRFVAHGLFPLGALG
FT                   GLLLGAAGLAGIFTEPTIAVLPIGLPGLPFHLRVDALSGYFLFVLGVVSAGIGAFSAGY
FT                   FRKGEGSAPGLICFEYHVCIASIALVLIADDAYGFMVAWETLTLSATFLVMTNHRIAEI
FT                   RRAGYLYFLISHVGALALLLCFGILQARTGDYTFANLRAQSPDAFWASLAFLFALVGFG
FT                   AKAGVFPLHVWLPDAHPAAPSPVSALLSGFVLKVGLYGLIRTVFDLLHLPIAWWGALLL
FT                   VLGIGTALLGVVFSTIQVDMKRLLAYSSIDNVGLMIVALGLAVLFRAYGMTELSALALT
FT                   AMLYQIVAHAAFKSLLFLGTGAVLHATGERNLGKLGGLIRVMPWTAWAVLTGVAASAGL
FT                   PPMSGFVAEWLLLQSFLFTPGLQNSVLAMTVPIAAALVAMTAALAGYTMVKFFGIVFLG
FT                   QPREAKLSRAYDANRWERLAFCWFAVAGVLLGLMPTQFVKVLDRVTRVLVGAGIGAENH
FT                   GWLIFVPVSSARASYMPVVFMLFFVACCGLAWVLVRRFYHGRLRRAAPWSCGFPFTTAR
FT                   MQDTAEGFGQPIREIFAPLLRIERQLPSPFDAQPAYRVSVADRTWSILYDRIAALTQRA
FT                   AEWAGRLQTGRIAVYLTYSFAVLILLLMLVRRW"
FT                   /protein_id="YP_003606953.1"
FT   misc_feature    complement(233273..235186)
FT                   /note="hydrogenase 4 subunit B; Validated; Region:
FT                   PRK06521"
FT                   /db_xref="CDD:168591"
FT                   /locus_tag="BC1002_3408"
FT   misc_feature    complement(234029..234874)
FT                   /note="NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; Region: Oxidored_q1; cl14187"
FT                   /db_xref="CDD:175557"
FT                   /locus_tag="BC1002_3408"
FT   gene            235460..236227
FT                   /db_xref="GeneID:9112712"
FT                   /locus_tag="BC1002_3409"
FT   CDS_pept        235460..236227
FT                   /locus_tag="BC1002_3409"
FT                   /gene_family="HOG000268664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1275"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bcm:Bcenmc03_6165 hypothetical protein"
FT                   /db_xref="GI:295699061"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="GeneID:9112712"
FT                   /translation="MPAQYFRSLTGKHRSTSANRQLGFSLAFVAGATNAGGFLAVRQYT
FT                   SHMSGIVSAIADQAALGDLRLVLAGIGSLASFLVGAGCSAVLVNWGRRRSLQSQYVLPL
FT                   VVEAALLLLFGLLGSHLALREAFFVPLTVILLCFIMGLQNAMITKLSGAEIRTTHMTGI
FT                   VTDLGIELGKLFYWNRSVLVDDEHAVIANRAKLRIHGTMLAAFFVGGLLGAIGFKHVGY
FT                   VSTVPLAGVLVTLAIVPVVDDLLTYLCRFERRH"
FT                   /protein_id="YP_003606954.1"
FT   misc_feature    235517..236179
FT                   /note="Protein of unknown function (DUF1275); Region:
FT                   DUF1275; cl01453"
FT                   /db_xref="CDD:154409"
FT                   /locus_tag="BC1002_3409"
FT   gene            236336..236521
FT                   /db_xref="GeneID:9112713"
FT                   /locus_tag="BC1002_3410"
FT   CDS_pept        236336..236521
FT                   /locus_tag="BC1002_3410"
FT                   /gene_family="HOG000268643" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /codon_start="1"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: bac:BamMC406_6266 CopG/DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="GI:295699062"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="GeneID:9112713"
FT                   /translation="METKTARLTVLIDPAKKEAFEMLCSAQDLTPSQVVRQLIREYLER
FT                   HGVTYKTKSPLAKRGR"
FT                   /protein_id="YP_003606955.1"
FT   gene            complement(236545..237381)
FT                   /db_xref="GeneID:9112714"
FT                   /locus_tag="BC1002_3411"
FT   CDS_pept        complement(236545..237381)
FT                   /locus_tag="BC1002_3411"
FT                   /gene_family="HOG000263005" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BCAS0456"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:BCAS0456 hypothetical protein"
FT                   /db_xref="GI:295699063"
FT                   /db_xref="GeneID:9112714"
FT                   /translation="MAEDRTSYDAFVKFMSTPISDGQPFVLETQHAVSLHFDHFATQSF
FT                   MSLRNPEKLTLGYTRAMMGFLLLRPAPTHICMIGLGGGSLAKYCYRHLPEVAIDAVEIS
FT                   PEVIALRDVFRIPADDARFKVICADGADYLMQDDIRTDVILLDAFVAEGMASRCANLAF
FT                   FAACRERLTETGVLVINLTDDDPAIPQHLEWLRSVFGVCYAIARCGDDSNFVAFAWKSG
FT                   QRLPPRQVLFERALSFAFADELKLSATARHLKEGERLDPKRLVWREQGQGHWEIGG"
FT                   /protein_id="YP_003606956.1"
FT   misc_feature    complement(236590..237273)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="BC1002_3411"
FT   gene            complement(237471..237815)
FT                   /db_xref="GeneID:9112715"
FT                   /locus_tag="BC1002_3412"
FT   CDS_pept        complement(237471..237815)
FT                   /locus_tag="BC1002_3412"
FT                   /gene_family="HOG000228486" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00686"
FT                   /codon_start="1"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_6268 alkylphosphonate utilization
FT                   operon protein PhnA; TIGRFAM: alkylphosphonate utilization
FT                   operon protein PhnA; PFAM: PhnA protein"
FT                   /db_xref="GI:295699064"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="GeneID:9112715"
FT                   /translation="MNAAPACPQCAMENTYPDGTLYVCADCGHEWSANAGADASDEPTG
FT                   SVVKDANGNVLADGDSVVLIKDLRVKGSSITLKMGTKVKSIRIVGGDHEIDCKTDAGSF
FT                   MLKACFLKKV"
FT                   /protein_id="YP_003606957.1"
FT   misc_feature    complement(237474..237803)
FT                   /note="Uncharacterized Zn-ribbon-containing protein
FT                   involved in phosphonate metabolism [Inorganic ion transport
FT                   and metabolism]; Region: PhnA; COG2824"
FT                   /db_xref="CDD:32652"
FT                   /locus_tag="BC1002_3412"
FT   misc_feature    complement(237720..237803)
FT                   /note="PhnA Zinc-Ribbon; Region: PhnA_Zn_Ribbon; pfam08274"
FT                   /db_xref="CDD:116858"
FT                   /locus_tag="BC1002_3412"
FT   misc_feature    complement(237516..237677)
FT                   /note="PhnA protein; Region: PhnA; pfam03831"
FT                   /db_xref="CDD:146455"
FT                   /locus_tag="BC1002_3412"
FT   gene            238114..238923
FT                   /db_xref="GeneID:9112716"
FT                   /locus_tag="BC1002_3413"
FT   CDS_pept        238114..238923
FT                   /locus_tag="BC1002_3413"
FT                   /gene_family="HOG000034587" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /codon_start="1"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5986 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="GI:295699065"
FT                   /db_xref="InterPro:IPR000097"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="GeneID:9112716"
FT                   /translation="MAKLRIATFNINGIRSRQAALLQWLEREAPDVVCLQELKAVDSAF
FT                   PVDALREAGYGSVWQGQSAWNGVAILAKGDAPLERRRGLPGFEDDTHSRYIEAAVGGVL
FT                   IVCLYLPNGNPQPGPKFDYKLAWFDHLIAHAAQLYESGHPVVIAGDFNVVPTDEDIYNP
FT                   RSWLKDALLQPESRERYRKLLAQGWTDALRTHFGDERVYTFWDYFRRHWDTNSGLRIDH
FT                   LLLSADLAPRLRNAGVDRWVCGEPHASDHAPTWIELEMGAGRKKKSG"
FT                   /protein_id="YP_003606958.1"
FT   misc_feature    238123..238890
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:174238"
FT                   /locus_tag="BC1002_3413"
FT   gene            complement(239022..239288)
FT                   /db_xref="GeneID:9112717"
FT                   /locus_tag="BC1002_3414"
FT   CDS_pept        complement(239022..239288)
FT                   /locus_tag="BC1002_3414"
FT                   /gene_family="HOG000283481" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /codon_start="1"
FT                   /product="CsbD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CsbD family protein; KEGG: bxe:Bxe_B2220
FT                   hypothetical protein"
FT                   /db_xref="GI:295699066"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="GeneID:9112717"
FT                   /translation="MDTNSAAGAVKEVAGKVQSAVGDAVGDTSAQVAGKARELSGKAQQ
FT                   LCANTTSLVRDTTAENPFTTLAVVALAGFVMGALWSRGGRDYD"
FT                   /protein_id="YP_003606959.1"
FT   misc_feature    complement(239121..>239237)
FT                   /note="CsbD-like; Region: CsbD; cl01272"
FT                   /db_xref="CDD:174604"
FT                   /locus_tag="BC1002_3414"
FT   gene            complement(239470..240153)
FT                   /db_xref="GeneID:9112718"
FT                   /locus_tag="BC1002_3415"
FT   CDS_pept        complement(239470..240153)
FT                   /locus_tag="BC1002_3415"
FT                   /gene_family="HOG000252866" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5984"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5984 hypothetical protein"
FT                   /db_xref="GI:295699067"
FT                   /db_xref="GeneID:9112718"
FT                   /translation="MRPTLVPQRESELPLHTPSVSSLMLAAVIALIAWMAILAQADLTI
FT                   DRTLARGLTVFDALARMSSYLTNLTVLASAFCFTCVALWKHSSPLVRFFRQPTVVTAVV
FT                   AYMVFVGIAYNVLLRGLWPLSPYRLLLNESLHSVLPMLAALYWVLFVPRFHLRLRHCLL
FT                   WLVYPLAYLGITFWRGSLSDFYPYPFIDVETLGLRQVLVNSALLFGGFLMLLAVFVGIN
FT                   SRRRR"
FT                   /protein_id="YP_003606960.1"
FT   gene            complement(240230..241264)
FT                   /db_xref="GeneID:9112719"
FT                   /locus_tag="BC1002_3416"
FT   CDS_pept        complement(240230..241264)
FT                   /locus_tag="BC1002_3416"
FT                   /gene_family="HOG000254689" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /codon_start="1"
FT                   /product="OmpA/MotB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bpy:Bphyt_5983
FT                   OmpA/MotB domain protein"
FT                   /db_xref="GI:295699068"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:9112719"
FT                   /translation="MRERRSRAAQVEAPAPVIVRRSRKGDEHGAHHGGAWKIAYADFVT
FT                   AMMAFFLLMWLLGSTSKYDKQGIEDYFNTPLSSLLGGNEGTAAARPSVVQGGGRDISDT
FT                   RPGVGTKSQTEPTPPRAAMPAVTPMDAKRLQQLKAKLSALIEQSSVLNAFKDQIRISIT
FT                   NEGLRIEIVDSQNRPMFASGSSKLQPYAVTILTQIGAALNDVDNRISIAGHTDAVPYTA
FT                   GPEGYSNWELSSERANAARRALVAGGMHGDKLLQMRGLADVLPLNSHVADEPTNRRISI
FT                   LVLNKAAEQAFFHDGGRATLDESSPVGAALPARSARLLPGSRPALQPASQPAVQPVIAT
FT                   RSTP"
FT                   /protein_id="YP_003606961.1"
FT   misc_feature    complement(240254..241231)
FT                   /note="flagellar motor protein MotB; Validated; Region:
FT                   motB; PRK09041"
FT                   /db_xref="CDD:169629"
FT                   /locus_tag="BC1002_3416"
FT   misc_feature    complement(240416..240727)
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="BC1002_3416"
FT   misc_feature    complement(order(240434..240436,240446..240448,
FT                   240569..240571,240578..240580,240584..240586,
FT                   240596..240598,240617..240622,240716..240721))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="BC1002_3416"
FT   gene            complement(241279..241601)
FT                   /db_xref="GeneID:9112720"
FT                   /locus_tag="BC1002_3417"
FT                   /pseudo
FT   gene            complement(242196..243029)
FT                   /db_xref="GeneID:9112721"
FT                   /locus_tag="BC1002_3418"
FT   CDS_pept        complement(242196..243029)
FT                   /locus_tag="BC1002_3418"
FT                   /gene_family="HOG000260719" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /codon_start="1"
FT                   /product="polysaccharide deacetylase"
FT                   /transl_table="11"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bpy:Bphyt_5979 polysaccharide deacetylase"
FT                   /db_xref="GI:295699069"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="GeneID:9112721"
FT                   /translation="MNECPNPRRRWPRSRNSALLNGTIGWHVIVLIGVAVAPAAWPWWL
FT                   AAIVANHALFTVTGLLPRTTLLGPNWTRLPASPRNADAIALTIDDGPDPVVTPQVLDLL
FT                   DAFDVRATFFCIGSKVERYPQLAREIVARGHALENHSQMHVHTFSVTFPHALTREIAAA
FT                   QRTLETVSGARPMFFRAPAGLRNLFLEPVLRKLDLRLAAWTRRGYDTRERNPHVVARRL
FT                   LDGLAARDILLLHDGNAALTIEGQPLILAVLPSVIEAARERHLRFVTLREARVDA"
FT                   /protein_id="YP_003606962.1"
FT   misc_feature    complement(242214..242798)
FT                   /note="Polysaccharide deacetylase; Region: Polysacc_deac_1;
FT                   cl12061"
FT                   /db_xref="CDD:164326"
FT                   /locus_tag="BC1002_3418"
FT   gene            243305..244069
FT                   /db_xref="GeneID:9112722"
FT                   /locus_tag="BC1002_3419"
FT   CDS_pept        243305..244069
FT                   /locus_tag="BC1002_3419"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_5978 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295699070"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112722"
FT                   /translation="MWQSGNSKVALVTGAGSGIGRACALTLAKHGYSVVLAGRRQAALD
FT                   AVAQEARAQHGDALAVSCDVTEPDSVAALFDTIRARFGRLDVLFNNAGRNGSPVELDEV
FT                   SIDEWRSIVDTNLNGVFLCTRAAFGLMKTQNPRGGRIINNGSISAHAPRPNSAAYTATK
FT                   HAITGLTKAVSLDGRKHDIVCGQIDIGNAGTEMAARMARGVPQANGEIAVEPLMDVQHV
FT                   ADAVLHMASLPLSANVQFMTIMASKMPFVGRG"
FT                   /protein_id="YP_003606963.1"
FT   misc_feature    243320..244012
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3419"
FT   misc_feature    243320..243997
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="BC1002_3419"
FT   gene            244107..244448
FT                   /db_xref="GeneID:9112723"
FT                   /locus_tag="BC1002_3420"
FT   CDS_pept        244107..244448
FT                   /locus_tag="BC1002_3420"
FT                   /gene_family="HOG000263126" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5977"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5977 hypothetical protein"
FT                   /db_xref="GI:295699071"
FT                   /db_xref="GeneID:9112723"
FT                   /translation="MRVQLILGAPPSLRAKPRAVPRATPSDDPPPQPPVRPDLDDCCHS
FT                   GCTQCVFDLYDEALERYEIALAAWHKRQAHKARPARRPEAQGAQGAKSKPQADARRSTA
FT                   RRGKPNSHR"
FT                   /protein_id="YP_003606964.1"
FT   misc_feature    <244230..244322
FT                   /note="Oxidoreductase-like protein, N-terminal; Region:
FT                   Oxidored-like; pfam09791"
FT                   /db_xref="CDD:150458"
FT                   /locus_tag="BC1002_3420"
FT   gene            244477..245346
FT                   /db_xref="GeneID:9112724"
FT                   /locus_tag="BC1002_3421"
FT   CDS_pept        244477..245346
FT                   /locus_tag="BC1002_3421"
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /codon_start="1"
FT                   /product="Silent information regulator protein Sir2"
FT                   /transl_table="11"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: bpy:Bphyt_5976 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="GI:295699072"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="GeneID:9112724"
FT                   /translation="MTDLQLTPTESLADPHTLDDLHRFVQRHPRLFVLTGAGISTDSGI
FT                   PGYRDDNGAWKRSPPITLQEFLGTLAMRQRYWARSMVGWPLVARARPNAAHVALARLEA
FT                   AGHVPTLVTQNVDGLHQRAGSRDVIELHGGIDGVSCLDCGMQHSRAAIQQTLEADNPAL
FT                   LDVTAEAAADGDAHLEWHDLGGFRVPACSNCGGLLKPSVVFFGENVPKARVEAASHALD
FT                   AADAVLVAGSSLMVYSGYRFCVWAQRQGKPVAAINLGRTRADPLLSLKVAAPCGDTLSA
FT                   LAGLLAGD"
FT                   /protein_id="YP_003606965.1"
FT   misc_feature    244537..245313
FT                   /note="SIR2 superfamily of proteins includes silent
FT                   information regulator 2 (Sir2) enzymes which catalyze
FT                   NAD+-dependent protein/histone deacetylation, where the
FT                   acetyl group from the lysine epsilon-amino group is
FT                   transferred to the ADP-ribose moiety of NAD+...; Region:
FT                   SIR2; cl00195"
FT                   /db_xref="CDD:174025"
FT                   /locus_tag="BC1002_3421"
FT   gene            245393..246010
FT                   /db_xref="GeneID:9112725"
FT                   /locus_tag="BC1002_3422"
FT   CDS_pept        245393..246010
FT                   /locus_tag="BC1002_3422"
FT                   /gene_family="HOG000074973" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /codon_start="1"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bxe:Bxe_B2212 hypothetical protein"
FT                   /db_xref="GI:295699073"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="GeneID:9112725"
FT                   /translation="MLTTIEQLEALYAQPAERSLRKEIPYVNDDYRAFVAAAPFAVLAT
FT                   SGPDGLDCSPRGDAPGFVRVVDERTLALPDRPGNNRLDSLRNVIADPRLALLFVIPGVG
FT                   ETLRVNGRGRISNDAALLDSFAVDGKVPRTVLLIDVDAVYFHCSKAIVRSQLWDPARHI
FT                   ERSQLPGTGEILQHIFAASDGERFDAAAYDRELPERVRATLY"
FT                   /protein_id="YP_003606966.1"
FT   misc_feature    245399..245878
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:174160"
FT                   /locus_tag="BC1002_3422"
FT   gene            246045..246653
FT                   /db_xref="GeneID:9112726"
FT                   /locus_tag="BC1002_3423"
FT   CDS_pept        246045..246653
FT                   /locus_tag="BC1002_3423"
FT                   /gene_family="HOG000158804" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06080"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF938"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF938; KEGG:
FT                   bpy:Bphyt_5974 protein of unknown function DUF938"
FT                   /db_xref="GI:295699074"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="GeneID:9112726"
FT                   /translation="MTDARQHSPSAERNREPILAVLRDALPARGRVLEIASGTGEHAIW
FT                   FAAALPGLDWQPSDADEEARESIAAWTAHAGLANVRAPLALDVHQPDWGVDALDAVVCI
FT                   NMIHISPWSAARALIDGAGRRLVDGGVLYLYGPYRRGGAHTAPSNEAFEQWLKSRDPEW
FT                   GVRDLEAVVALGDAAGLTCERVVAMPANNFSLVFRKRAG"
FT                   /protein_id="YP_003606967.1"
FT   misc_feature    246057..246641
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="BC1002_3423"
FT   gene            246930..248339
FT                   /db_xref="GeneID:9112727"
FT                   /locus_tag="BC1002_3424"
FT   CDS_pept        246930..248339
FT                   /locus_tag="BC1002_3424"
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00873"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.44"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; KEGG: bxe:Bxe_B2210 6-phosphogluconate
FT                   dehydrogenase; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="GI:295699075"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112727"
FT                   /translation="MSKQAIGVVGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAE
FT                   YPDRKLVPAFTLEEFVDSLEKPRRILMMVKAGEPTDATIASLKPLLEKGDILIDGGNTP
FT                   FTDTIRRNQELAKAGLHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKA
FT                   PDGEPCVAYMGPDGAGHFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEW
FT                   NQGELDSYLIEITSKIFSKKDDETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLI
FT                   TEAVFARVLSSLKTQRVAASKVLEGPQAKPLEGAKEAFIESVRRALYFSKVISYAQGFA
FT                   QLRAASEEYKWDLDYGTIAKIFRAGCIIRARFLQKITDAYTKDKALANLLLDPYFRDIA
FT                   KNYQAALREVVVAAVNAGVPVPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERI
FT                   DKPGSFHAQWS"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /protein_id="YP_003606968.1"
FT   misc_feature    246945..247793
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3424"
FT   misc_feature    246969..248336
FT                   /note="6-phosphogluconate dehydrogenase; Validated; Region:
FT                   PRK09287"
FT                   /db_xref="CDD:169776"
FT                   /locus_tag="BC1002_3424"
FT   misc_feature    247464..248336
FT                   /note="6-phosphogluconate dehydrogenase, C-terminal domain;
FT                   Region: 6PGD; pfam00393"
FT                   /db_xref="CDD:109451"
FT                   /locus_tag="BC1002_3424"
FT   gene            248614..248949
FT                   /db_xref="GeneID:9112728"
FT                   /locus_tag="BC1002_3425"
FT   CDS_pept        248614..248949
FT                   /locus_tag="BC1002_3425"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2209"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2209 hypothetical protein"
FT                   /db_xref="GI:295699076"
FT                   /db_xref="GeneID:9112728"
FT                   /translation="MKTLISAVAIAAALVVPVASFAQANQPVTRAQVRAELVQLEKAGY
FT                   NPNTSDVDYPADIQAAQARVDAQRGTAVAANRADTSGYGAPAVGTSQAGHADLPAKANR
FT                   NSVYFGN"
FT                   /protein_id="YP_003606969.1"
FT   gene            complement(249111..249431)
FT                   /db_xref="GeneID:9112729"
FT                   /locus_tag="BC1002_3426"
FT   CDS_pept        complement(249111..249431)
FT                   /locus_tag="BC1002_3426"
FT                   /gene_family="HOG000158805" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2207"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2207 hypothetical protein"
FT                   /db_xref="GI:295699077"
FT                   /db_xref="GeneID:9112729"
FT                   /translation="MNKATFLAVQLNVDDVAASAGLVELLNTHLIFAADVAEAADALVQ
FT                   LASVARLSSGVEASVELPAVAIERLREALDNLSGYDESWLLALEPSRALFDDIGRRQRT
FT                   LH"
FT                   /protein_id="YP_003606970.1"
FT   gene            249661..249972
FT                   /db_xref="GeneID:9112730"
FT                   /locus_tag="BC1002_3427"
FT   CDS_pept        249661..249972
FT                   /locus_tag="BC1002_3427"
FT                   /gene_family="HOG000264121" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bxe:Bxe_B2206 hypothetical protein"
FT                   /db_xref="GI:295699078"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:9112730"
FT                   /translation="MKIIRSKSFTAPRAWGALDIANMNGITTRLHWTDQPYKWHVNDGE
FT                   EVFAVLDGRVEMRYREDGVERSTVLETGDVFYAAVGTEHVAHPLGAARVLVVETQGSV"
FT                   /protein_id="YP_003606971.1"
FT   misc_feature    249667..249963
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_3427"
FT   gene            250137..250940
FT                   /db_xref="GeneID:9112731"
FT                   /locus_tag="BC1002_3428"
FT   CDS_pept        250137..250940
FT                   /locus_tag="BC1002_3428"
FT                   /gene_family="HOG000159026" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /codon_start="1"
FT                   /product="Peptidase M23"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5969 peptidase M23; PFAM: Peptidase
FT                   M23; Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="GI:295699079"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="GeneID:9112731"
FT                   /translation="MTQQGQPTTIRLLMAVALGVAIAGCTTMPWESTPFYNNAPSATTT
FT                   LATVPVPAGYYRVNPGDTLAGIASAYGRKPQEIAAWNGLPVNAAVAPGQVLRVSPPMAS
FT                   GSVVTPPAAVAPGAPAAPGATANVPPGAVPGAPAPAAGPQQGVLQWPLHGPILRAFAPG
FT                   KSNGIVIGGQPGDPVKAAATGRVVYAGTGIEAYGPLIIIKHNDSLITAYGQNSQLLVKE
FT                   GDAVAQGQTIGEVGVDSRGAASIQFEVRQNGQPVDPLQWLPKPGG"
FT                   /protein_id="YP_003606972.1"
FT   misc_feature    250299..250433
FT                   /note="Lysin domain, found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function; Region: LysM;
FT                   cd00118"
FT                   /db_xref="CDD:29017"
FT                   /locus_tag="BC1002_3428"
FT   misc_feature    order(250302..250304,250311..250313,250320..250322,
FT                   250335..250337,250344..250346)
FT                   /note="putative peptidoglycan binding site; other site"
FT                   /db_xref="CDD:29017"
FT                   /locus_tag="BC1002_3428"
FT   misc_feature    250623..250910
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="BC1002_3428"
FT   gene            251123..252151
FT                   /db_xref="GeneID:9112732"
FT                   /locus_tag="BC1002_3429"
FT   CDS_pept        251123..252151
FT                   /locus_tag="BC1002_3429"
FT                   /gene_family="HOG000219824" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /codon_start="1"
FT                   /EC_number="4.1.2.5"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5968 threonine aldolase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="GI:295699080"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9112732"
FT                   /translation="MDAQGHTMIDLRSDTVTRPTPPMLAAMSAAEVGDDVWGDDPTVLR
FT                   LQATLAERTGKEAGLFFPSGTQSNLAALMAHCARGDEYIVGQLAHTYKYEGGGAAVLGS
FT                   IQPQPLENAADGSIPLDKIAAAIKPIDDHFARTRLLALENTIGGRVLPARYVADATQLA
FT                   RERGLATHLDGARVFNAAVASRKPVAALTEPFDSVSICFSKGLGAPVGSVLVGSRALID
FT                   VAHRWRKVLGGGMRQAGVLAAACLYALDHNVERLADDHANAAHLAAGLETIEQVKVQSV
FT                   ATNMVFAQFPQQHCAPLEAWLKERGILTQMLYASRFVTHRDVSRDDIDTFIGAVKDYFV
FT                   AR"
FT                   /product="Threonine aldolase"
FT                   /protein_id="YP_003606973.1"
FT   misc_feature    251150..252130
FT                   /note="Low-specificity threonine aldolase (TA). This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I).  TA catalyzes the
FT                   conversion of L-threonine or L-allo-threonine to glycine
FT                   and acetaldehyde in a...; Region: TA_like; cd06502"
FT                   /db_xref="CDD:99748"
FT                   /locus_tag="BC1002_3429"
FT   misc_feature    251150..251983
FT                   /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
FT                   pfam01212"
FT                   /db_xref="CDD:144709"
FT                   /locus_tag="BC1002_3429"
FT   misc_feature    order(251156..251158,251165..251176,251192..251194,
FT                   251201..251209,251309..251311,251318..251323,
FT                   251342..251344,251396..251419,251438..251446,
FT                   251729..251734,251750..251752,251795..251800,
FT                   251807..251812,251840..251845,252044..252046)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:99748"
FT                   /locus_tag="BC1002_3429"
FT   misc_feature    order(251315..251320,251327..251329,251549..251551,
FT                   251639..251641,251648..251650,251723..251725,
FT                   251732..251734)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99748"
FT                   /locus_tag="BC1002_3429"
FT   misc_feature    251732..251734
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99748"
FT                   /locus_tag="BC1002_3429"
FT   gene            complement(252295..253752)
FT                   /db_xref="GeneID:9112733"
FT                   /locus_tag="BC1002_3430"
FT   CDS_pept        complement(252295..253752)
FT                   /locus_tag="BC1002_3430"
FT                   /gene_family="HOG000239125" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2203 major facilitator superfamily multidrug
FT                   efflux transporter"
FT                   /db_xref="GI:295699081"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112733"
FT                   /translation="MPNPTSHALSDKLSPTVGVPAPTLPADGPMSAANRRAMAAIMLAV
FT                   ALATLDTAIANTALPAIAGDLHAAPAASVWIINAYQLAMVATLLPLAALGDIVGHRRIY
FT                   IGGIALFTLSSLGCALAPTLPLLTAARIVQGLGASAIMSVNTALIRYLYPPHRLGRGLG
FT                   TNALIVGVSFAVGPTVASLILSVATWPWLFAVNVPLGVLALSFAMPALPHTAQGRHQFD
FT                   PVAALLNVVTFAALIFALGEAAQRVSMQIVLSATAIAVVFGLLLIRREAGHPAPMLPVD
FT                   LFKRPVFALSAVTAVCSFAAQGLAFVSLPFYFEDVLLRSQVETGFLMTPWPVVVALAAP
FT                   LAGGLSDRYPPGLLGAIGLAVLSAGMASLAMLPAHPHVLDIGIRMAICGAGFGFFQSPN
FT                   LKALMASAPPERSGGASGIVATARLLGQATGAALVALCFGIAGRQHGPTLALGLGAFFA
FT                   GAASLASGLRLLAPSHRAGVQAKAAVK"
FT                   /protein_id="YP_003606974.1"
FT   misc_feature    complement(252460..253605)
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="BC1002_3430"
FT   misc_feature    complement(<253111..253605)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3430"
FT   misc_feature    complement(order(253234..253236,253252..253257,
FT                   253264..253269,253303..253305,253312..253317,
FT                   253324..253329,253336..253341,253477..253482,
FT                   253486..253491,253501..253503,253510..253515,
FT                   253522..253524,253573..253578,253582..253590,
FT                   253597..253599))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3430"
FT   misc_feature    complement(252427..>252909)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3430"
FT   gene            254377..256830
FT                   /db_xref="GeneID:9112734"
FT                   /locus_tag="BC1002_3431"
FT   CDS_pept        254377..256830
FT                   /locus_tag="BC1002_3431"
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glycogen/starch/alpha-glucan phosphorylase;
FT                   KEGG: bpy:Bphyt_5966 glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="GI:295699082"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="GeneID:9112734"
FT                   /translation="MTTVDLEFDQLHSTVDALRRSISNRMMYGVGKDAITAHPHDWLHA
FT                   AALAVRDRLVARWMKTTRLQYEQDVKRVYYLSMEFLIGRTFTNALLALGIHDQMKEALA
FT                   SLGVDMDALIDIEPDAALGNGGLGRLAACFLDSMATLGIPGFGYGIRYQYGMFRQEIVN
FT                   GEQVEAPDYWLRAGNPWEFPRPEIKYMVHFGGRTVQRGDKTEWIDTEHVNATAYDTVIP
FT                   GYATDATNTLRLWSARATEELDLGAFNRGDYRNAVDTKNMSENVSRLLYPDDSTPAGRE
FT                   LRLRQEYFFVSATMQDLIRRYQRTHSTFGRFSEKVAVHLNDTHPVLAIPELMRLLVDVH
FT                   NLPWDKAWKHVTQIFSYTNHTLMPEALETWDVEMLSRLLPRHLEIIFEINAQFLKHVSE
FT                   QSGHDVEMIRRISLVDEYGQRRVRMAYLAIVASHKVNGVSKLHSQLMTRDIFSDFARLY
FT                   PDRFTNVTNGITPRRWLAQASPSLSSLIDARIGTHWRSNLFELEQLRNLRKDDEFVDAF
FT                   REAKRQAKLRLVHRLAQHTKLHFNPNALFDLQVKRIHEYKRQLLNVLHVIVRYNEIRAN
FT                   PERDWVPRVVLFAGKAASAYRMAKTIIKLIGDVSEKVNHDPLIGDRLKVVFVPNYGVSV
FT                   AELIIPAADLSEQISMAGTEASGTGNMKLALNGALTIGTMDGANIEICDAVGRENIFIF
FT                   GHSADEVDDLRASGYRPRQIYEENEALRTALDQIRTGFFSPDDPLRFSDIFHTLVDWGD
FT                   HYMVLADFDAFAKAQNDVDARFVNRRAWAESAIENVAGMGQFSSDRTIGEYARNIWRVS
FT                   PLSLD"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /protein_id="YP_003606975.1"
FT   misc_feature    254431..256809
FT                   /note="This is a family of oligosaccharide phosphorylases.
FT                   It includes yeast and mammalian glycogen phosphorylases,
FT                   plant starch/glucan phosphorylase, as well as the
FT                   maltodextrin phosphorylases of bacteria. The members of
FT                   this family catalyze the breakdown of...; Region:
FT                   GT1_Glycogen_Phosphorylase; cd04300"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="BC1002_3431"
FT   misc_feature    order(254431..254433,254437..254439,254443..254448,
FT                   254452..254460,254527..254535,254926..254928,
FT                   255193..255195,255202..255204)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="BC1002_3431"
FT   misc_feature    254440..256809
FT                   /note="glycogen/starch/alpha-glucan phosphorylases; Region:
FT                   P_ylase; TIGR02093"
FT                   /db_xref="CDD:162698"
FT                   /locus_tag="BC1002_3431"
FT   misc_feature    order(254611..254613,254617..254619,254749..254757,
FT                   255187..255189,255196..255198,255202..255204,
FT                   255223..255225,255340..255342,255346..255348,
FT                   255454..255459,255469..255471,255775..255777,
FT                   255796..255798,256027..256032,256036..256047,
FT                   256147..256149,256162..256164,256168..256170,
FT                   256270..256275,256339..256341,256345..256356,
FT                   256363..256365)
FT                   /note="active site pocket"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="BC1002_3431"
FT   gene            complement(256905..257294)
FT                   /db_xref="GeneID:9112735"
FT                   /locus_tag="BC1002_3432"
FT   CDS_pept        complement(256905..257294)
FT                   /locus_tag="BC1002_3432"
FT                   /gene_family="HOG000219520" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2198"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2198 hypothetical protein"
FT                   /db_xref="GI:295699083"
FT                   /db_xref="GeneID:9112735"
FT                   /translation="MDIPFNDRGVSVTRNALSAAGQVFPLRDIVDVQVVTVPKNKVVPL
FT                   VISVAGLIGAIVGGVLHSASGLVSGAMLVVVGWLTWVTQDVTHRLMVKTAEGEREALMS
FT                   TDREFVERVGEAVHRAKAAAAAPKT"
FT                   /protein_id="YP_003606976.1"
FT   gene            257450..258652
FT                   /db_xref="GeneID:9112736"
FT                   /locus_tag="BC1002_3433"
FT   CDS_pept        257450..258652
FT                   /locus_tag="BC1002_3433"
FT                   /gene_family="HOG000282013" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /codon_start="1"
FT                   /product="sodium/glutamate symporter"
FT                   /transl_table="11"
FT                   /note="KEGG: cvi:CV_1105 sodium/glutamate symport carrier
FT                   protein; TIGRFAM: sodium/glutamate symporter; PFAM:
FT                   sodium/glutamate symporter"
FT                   /db_xref="GI:295699084"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="GeneID:9112736"
FT                   /translation="MTVGVYATLVATSLVLLLGEKLVQWIGVLRTYSIPAPVAGGLIVA
FT                   ICVLIARITTQVQVRFDSTLQAPLMLAFFSTIGLNAHLSNLKAGGPVLIRFLTLVSGLL
FT                   ILQNVIGILLAFALGVDPLLGILGGSVTMSGGHGTGAAWSQVFTERHGLESATEIAIGC
FT                   ATFGLVMGGVLGGPVARLLMRRISADELLRVQQLADETLVFEEPKAEQATTPAAIITTL
FT                   ALISICLAGGEVFADWIADTVFELPTFVCTLFIGVILNNVLALVRVRIDQHAVALVGNV
FT                   ALALFLAMALMRLDLWELAALALPIISILAAQTLLMALYAIFITFPAMGRNYDAVVLCA
FT                   AQCGLGLGATPTAIANMQAITNRFGHSHIAFLIVPMTGAFFMDIVNAIVIKLFLTLPFF
FT                   H"
FT                   /protein_id="YP_003606977.1"
FT   misc_feature    257504..258643
FT                   /note="Na+/glutamate symporter [Amino acid transport and
FT                   metabolism]; Region: GltS; cl12073"
FT                   /db_xref="CDD:159733"
FT                   /locus_tag="BC1002_3433"
FT   misc_feature    257504..258544
FT                   /note="Sodium/glutamate symporter; Region: Glt_symporter;
FT                   pfam03616"
FT                   /db_xref="CDD:112434"
FT                   /locus_tag="BC1002_3433"
FT   gene            258668..259528
FT                   /db_xref="GeneID:9112737"
FT                   /locus_tag="BC1002_3434"
FT   CDS_pept        258668..259528
FT                   /locus_tag="BC1002_3434"
FT                   /gene_family="HOG000205102" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /codon_start="1"
FT                   /product="methyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6184 methyltransferase; TIGRFAM:
FT                   methyltransferase; PFAM: O-methyltransferase domain
FT                   protein"
FT                   /db_xref="GI:295699085"
FT                   /db_xref="InterPro:IPR003455"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="GeneID:9112737"
FT                   /translation="MSNQPHIAPDSTAARVALWRALHVQADAPPHVLEDEVGLQLLAPA
FT                   ENWHSRGDMDPRYTRPFRASIVARARFIEDLVVEQAGRGVDQYVILGAGLDSFAQRRPD
FT                   IASRLTVFEVDPPGPQTWKRQRLSELGYGLPDWLRFVPVDFEAGDSWRQRLVAEGFDES
FT                   RPAVVVSTGVSMYLTREANAATLREVAGLARGSTFAMTFLLPLEMADPDVRPGLEMAEK
FT                   GARASGTPFISFFMPQQMIAMAREAGFDDAQHVSAADLTQRYFAARTDGLRPPDNAEEL
FT                   LVANT"
FT                   /protein_id="YP_003606978.1"
FT   misc_feature    258704..259237
FT                   /note="Leucine carboxyl methyltransferase; Region: LCM;
FT                   cl01306"
FT                   /db_xref="CDD:163969"
FT                   /locus_tag="BC1002_3434"
FT   gene            259612..260073
FT                   /db_xref="GeneID:9112738"
FT                   /locus_tag="BC1002_3435"
FT   CDS_pept        259612..260073
FT                   /locus_tag="BC1002_3435"
FT                   /gene_family="HOG000263199" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_7177"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_7177 hypothetical protein"
FT                   /db_xref="GI:295699086"
FT                   /db_xref="GeneID:9112738"
FT                   /translation="MKKIAAFALVACALAACSSTEKQAQRAQQEILHSEPNLLAAQRNA
FT                   VIDCTPANCDAAWAATKRYIEQHSDTHVIRSDAIAIDTDVPDDSGKAAFSATRANKSTG
FT                   GATLSLFAQCRGMYGPDSAKGDDYDECADKILKTQNGYVPYLRSHASAQ"
FT                   /protein_id="YP_003606979.1"
FT   gene            260197..261201
FT                   /db_xref="GeneID:9112739"
FT                   /locus_tag="BC1002_3436"
FT   CDS_pept        260197..261201
FT                   /locus_tag="BC1002_3436"
FT                   /gene_family="HOG000217016" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3935 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295699087"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:9112739"
FT                   /translation="MQAPGATVPISLVNGFLGSVGTRPDIVDRHLSGANIPRALLNQPG
FT                   ARVTEEQFSTLYRSLAIELDDEMPGVFSRPLRSGALKFLCLSLLDAPNLETAMHRFGQF
FT                   FHLVLDDFRFESRRGDLVATLALHPGSTGALPSMLAQELMLKLAHGIASWLIGQRIALL
FT                   QVQFSFPRPAHALEYLYLFPGPAKFDCNQTSMQFSSSYFDLPVRQRKANLRRFLARAPE
FT                   DWIFVSFNEQLFSHRVREHLASRLPDVPSIEEAAEGLHCSVRTLCRHLAAEGTAFQVLK
FT                   DELRRDIAIQRLTGTHEPIAIIAGDVGFGDPTAFHRAFRHWTGSTPAAYRRGG"
FT                   /protein_id="YP_003606980.1"
FT   misc_feature    260902..261192
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="BC1002_3436"
FT   misc_feature    261064..261192
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_3436"
FT   gene            261414..263216
FT                   /db_xref="GeneID:9112740"
FT                   /locus_tag="BC1002_3437"
FT   CDS_pept        261414..263216
FT                   /locus_tag="BC1002_3437"
FT                   /gene_family="HOG000258862" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bpy:Bphyt_2983 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="GI:295699088"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="GeneID:9112740"
FT                   /translation="MSYVAPLKDMVFAITELAGIDQLAGLPGCEDATADTARAVLEEAA
FT                   RLHEGVLAPLNVDGDRNPSTWKDGAVTATAGFKDAFRQFAEGGWQGLQHPSEYGGQDLP
FT                   KLLSTPCIEMLNAANLSLGLCPLLTDGAIEALLTAGSEELKQRYVPKMISGEWTGTMNL
FT                   TEPQAGSDLSLVRTRAEPQGDGSYRISGTKIFITWGEHDMTENIVHLVLARTPSAPEGV
FT                   KGISLFVVPKFLVNEDGSLGERNDVHCVSIEHKLGIKASPTAVLQFGDHGGAIGQLVGE
FT                   ENRGLEYMFIMMNAARFAVGVQGVAISDRAYQQAVAYAKERVQGRPVDGSAKQSVAIIQ
FT                   HPDVRRMLSTMRALTEGARALAYVSASHCDLAHRHPDRATRANHQAIYEYLVPIVKGWS
FT                   TEMSLEVTSLGVQVHGGMGFIEETGAAQYYRDARILPIYEGTTAIQANDLVGRKTMRDN
FT                   GEVAGMLLAQIDATLAAVQGHPSYGSNAAFQAMHRHLSAGRNALHSAVRYVVESVKRDP
FT                   NAVFAGSVSYLMLAGIVLAGWQVARSLVLAADKRDEDPGFYDAKIATAHTYATQVLPRA
FT                   IALEATIRGARDGEGALALREDQF"
FT                   /protein_id="YP_003606981.1"
FT   misc_feature    261414..261512
FT                   /note="Acyl-CoA dehydrogenase N terminal; Region:
FT                   AcylCoA_DH_N; pfam12418"
FT                   /db_xref="CDD:152852"
FT                   /locus_tag="BC1002_3437"
FT   misc_feature    261504..262790
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BC1002_3437"
FT   misc_feature    261531..262775
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BC1002_3437"
FT   misc_feature    order(261804..261806,261894..261896,261900..261902,
FT                   261996..261998,262002..262004,262722..262730,
FT                   262734..262736,262740..262742)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_3437"
FT   gene            263286..264035
FT                   /db_xref="GeneID:9112741"
FT                   /locus_tag="BC1002_3438"
FT   CDS_pept        263286..264035
FT                   /locus_tag="BC1002_3438"
FT                   /gene_family="HOG000247877" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /codon_start="1"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: bxe:Bxe_A0998 electron transfer
FT                   flavoprotein subunit beta"
FT                   /db_xref="GI:295699089"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="GeneID:9112741"
FT                   /translation="MRVLVAVKRVVDYNVKVRAKSDGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSAGVAQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKAL
FT                   VDKEQPQLVILGKQAIDDDSNQTGQMLAALANLPQATFASKVIVADGKATVSREVDGGA
FT                   ETLSLTLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLKTLKVAE
FT                   PPKRSAGVKVPDVKTLVEKLKTEAKVL"
FT                   /protein_id="YP_003606982.1"
FT   misc_feature    263289..263894
FT                   /note="The electron transfer flavoprotein (ETF) serves as a
FT                   specific electron acceptor for various mitochondrial
FT                   dehydrogenases. ETF transfers electrons to the main
FT                   respiratory chain via ETF-ubiquinone oxidoreductase. ETF is
FT                   an heterodimer that consists of an...; Region: ETF_beta;
FT                   cd01714"
FT                   /db_xref="CDD:30169"
FT                   /locus_tag="BC1002_3438"
FT   misc_feature    order(263301..263306,263391..263393,263400..263402,
FT                   263472..263474,263628..263633,263637..263642,
FT                   263655..263666)
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:30169"
FT                   /locus_tag="BC1002_3438"
FT   gene            264049..264996
FT                   /db_xref="GeneID:9112742"
FT                   /locus_tag="BC1002_3439"
FT   CDS_pept        264049..264996
FT                   /locus_tag="BC1002_3439"
FT                   /gene_family="HOG000247865" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /codon_start="1"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Electron transfer flavoprotein alpha subunit ;
FT                   Electron transfer flavoprotein alpha/beta-subunit; KEGG:
FT                   bxe:Bxe_A0999 electron transfer flavoprotein subunit alpha"
FT                   /db_xref="GI:295699090"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="GeneID:9112742"
FT                   /translation="MTNLVIAEHDNASIKAATLNTIAAAQKIGGDIHVLVAGHNAQAAA
FT                   DAAAKIAGVAKVLLADAPQLEAGLAENVEATVLTLVQDAAKNYTHILAPATAYGKNVAP
FT                   RIAAKLDVAQISDITAVDSADTFERPIYAGNAIATVQSQDAIKVITVRSTGFDAVAAEG
FT                   GSAAIEKIEAAADAGISQFVSREVTKLDRPELTSAKIIVSGGRGLGNGENYTKVLEPLA
FT                   DKLGAALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKIII
FT                   AINKDEEAPIFGVADYGLVGDLFTLVPELEQALG"
FT                   /protein_id="YP_003606983.1"
FT   misc_feature    264049..264993
FT                   /note="etfA (electron transfer flavoprotein alpha subunit);
FT                   Provisional; Region: PLN00022"
FT                   /db_xref="CDD:165604"
FT                   /locus_tag="BC1002_3439"
FT   misc_feature    264058..264525
FT                   /note="The electron transfer flavoprotein (ETF) serves as a
FT                   specific electron acceptor for various mitochondrial
FT                   dehydrogenases. ETF transfers electrons to the main
FT                   respiratory chain via ETF-ubiquinone oxidoreductase. ETF is
FT                   an heterodimer that consists of an...; Region: ETF_alpha;
FT                   cd01715"
FT                   /db_xref="CDD:30170"
FT                   /locus_tag="BC1002_3439"
FT   misc_feature    264622..264882
FT                   /note="Electron transfer flavoprotein FAD-binding domain;
FT                   Region: ETF_alpha; pfam00766"
FT                   /db_xref="CDD:144387"
FT                   /locus_tag="BC1002_3439"
FT   gene            265021..265491
FT                   /db_xref="GeneID:9112743"
FT                   /locus_tag="BC1002_3440"
FT   CDS_pept        265021..265491
FT                   /locus_tag="BC1002_3440"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bph:Bphy_6753 dehydratase"
FT                   /db_xref="GI:295699091"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9112743"
FT                   /translation="MNELNGYDFEDLRPGMSARFAKTITEADILFFASASGDINAIHIN
FT                   EQFAQTTPFKGRIAHGMLTASIISAALAGQLPGPGTIYLGQNLRFKAPVRPGETVQAEV
FT                   TVKELIHDKRRVVLSTVCTVGGKVVVEGDATVMPTSRHDRVVADAACAVSEA"
FT                   /protein_id="YP_003606984.1"
FT   misc_feature    265054..265434
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase]
FT                   catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway. (R)-hydratase
FT                   contains a hot-dog fold similar to those of...; Region:
FT                   R_hydratase; cd03449"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   misc_feature    order(265084..265086,265090..265092,265114..265116,
FT                   265120..265125,265129..265137,265216..265218,
FT                   265225..265230,265261..265266,265270..265278,
FT                   265282..265284,265288..265290)
FT                   /note="dimer interaction site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   misc_feature    order(265114..265116,265132..265134,265138..265140,
FT                   265147..265149,265198..265200,265204..265206,
FT                   265213..265215,265222..265224,265234..265236,
FT                   265267..265269,265276..265278,265282..265284,
FT                   265288..265290,265330..265332,265372..265374,
FT                   265378..265380,265408..265410,265426..265428)
FT                   /note="substrate-binding tunnel; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   misc_feature    order(265117..265119,265132..265134,265138..265140,
FT                   265147..265149,265192..265194,265201..265206)
FT                   /note="active site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   misc_feature    order(265132..265134,265138..265140,265147..265149,
FT                   265201..265203)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   misc_feature    order(265225..265227,265234..265236,265261..265263,
FT                   265267..265269)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_3440"
FT   gene            265506..267248
FT                   /db_xref="GeneID:9112744"
FT                   /locus_tag="BC1002_3441"
FT   CDS_pept        265506..267248
FT                   /locus_tag="BC1002_3441"
FT                   /gene_family="HOG000260911" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01838"
FT                   /codon_start="1"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6754 poly(R)-hydroxyalkanoic acid
FT                   synthase, class I; TIGRFAM: poly(R)-hydroxyalkanoic acid
FT                   synthase, class I; PFAM: Poly-beta-hydroxybutyrate
FT                   polymerase domain protein; alpha/beta hydrolase fold"
FT                   /db_xref="GI:295699092"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="GeneID:9112744"
FT                   /translation="MRMPFSMPHEFSTGWVKAGFDFWRFSPLKDEFDASVPDTGGSDFD
FT                   VDGPFARGSVTHTSAHYLQQQAQLWSDAVAGLIGGRTELKAVAAPEQGDRRFHADDWSS
FT                   NGWYSLLKQSYLINARALADLVEASTLDEKGKHKLRFFMRQFIDFASPANFLATNPEVL
FT                   REAVESGGSSLLSGVTHLLDDLGSGSISITDRSAFEVGRSVATSSGAVVYENDLFQLIQ
FT                   YEPLTPKVAARPLVIIPPCINKFYILDLQPENSFVRFASEQGLTVFVVSWRNPQQDMAQ
FT                   TTWDAYLEDGVMQALEVAREISRADQVNALGWCVGGTMLSSALAVMRANGDDSVASLTL
FT                   LTALLDFTDPGDLGVFIDEQGVTMREHTIGRGGLYPGRELGFVFQALRANDLIWPYVVN
FT                   NYLKGKTPAAFDLLYWNADTTNLPGPMYSFYLRNMYLENSLRVPNKLTFCNTPVDLGNI
FT                   DIPSYLMAAEEDHIVPWRSAYQSTQLLGGHTEFVLGASGHIAGVINPASKNKRSYRTND
FT                   TCNENADEWLATSVQQRGSWWNHWIEWVKQHSGEQVDARTKLGNRKYKAIESAPGRYVK
FT                   LRAE"
FT                   /protein_id="YP_003606985.1"
FT   misc_feature    265683..267236
FT                   /note="poly(R)-hydroxyalkanoic acid synthase, class I;
FT                   Region: PHA_synth_I; TIGR01838"
FT                   /db_xref="CDD:130897"
FT                   /locus_tag="BC1002_3441"
FT   misc_feature    265782..266282
FT                   /note="Poly-beta-hydroxybutyrate polymerase (PhaC)
FT                   N-terminus; Region: PhaC_N; pfam07167"
FT                   /db_xref="CDD:115798"
FT                   /locus_tag="BC1002_3441"
FT   misc_feature    266301..267038
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_3441"
FT   gene            complement(267322..268323)
FT                   /db_xref="GeneID:9112745"
FT                   /locus_tag="BC1002_3442"
FT   CDS_pept        complement(267322..268323)
FT                   /locus_tag="BC1002_3442"
FT                   /gene_family="HOG000289643" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00342"
FT                   /codon_start="1"
FT                   /product="Helix-turn-helix, AraC domain protein"
FT                   /transl_table="11"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   rme:Rmet_1715 AraC family transcriptional regulator"
FT                   /db_xref="GI:295699093"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:9112745"
FT                   /translation="METMVTSVAMSGYFEVTRRLGLNPVELAKQAGIDAGALANPDDRV
FT                   SATACCRLLEMTAQKASCPTFALQMAETRQTFGSGVINVLLAHKRTLREVLLAAAEYRH
FT                   LLNEALAVYVEDADKTVTIREELVVEPGTPTKQAIELALAVLARHSSALLGKFWKPREL
FT                   HFTHAAPKDLTFHRRFFGCPLQFGSDFNGFVCASADLDYPNPLADPELVRYAESLASPL
FT                   NASAAESAALEVRKAIYLLLPLEQANAELVARYLHLSVRTMQRQLNSAGTSFSDQVEEV
FT                   RGELAVRYMSNPTYPIGRVSALLGYAQQGSFTNWFVSRFHMTPRDWRASHAK"
FT                   /protein_id="YP_003606986.1"
FT   misc_feature    complement(267340..267570)
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="BC1002_3442"
FT   gene            268567..269622
FT                   /db_xref="GeneID:9112746"
FT                   /locus_tag="BC1002_3443"
FT   CDS_pept        268567..269622
FT                   /locus_tag="BC1002_3443"
FT                   /gene_family="HOG000226943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF849"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bph:Bphy_6358 hypothetical protein"
FT                   /db_xref="GI:295699094"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="GeneID:9112746"
FT                   /translation="MQFLDDSLHPENQDKVVITTAPYGPEWMPADFPEDIPVTMDQQIQ
FT                   KAVDCYNAGATVLHLHVRELDGKGSKRLSKFNELIAGVRAAVPDMIIQVGGSISFAPED
FT                   DGQAAKWLSDDTRHMLAELDPKPDQVTVAINTTQMNIMELLYPEYLAGTSLSNPAFMAA
FT                   YSEMTVPAGPAWVEEHLRRLQAAGIQPHFQLTGIHALETLERLVRKGVYKGPLNLTWIG
FT                   IGGGFDGPNPFNFFNFVHRAPDGCTLTAESLLKNVLPFNMMAMSMGLHPRCGIEDTIID
FT                   QHGKRFTSVQQIEQCVRVARELGREIASGKEAREIYRIGVQYETVEETLSANGMAPNRQ
FT                   AGVRNLPLRAA"
FT                   /protein_id="YP_003606987.1"
FT   misc_feature    268609..269523
FT                   /note="Prokaryotic protein of unknown function (DUF849);
FT                   Region: DUF849; cl01276"
FT                   /db_xref="CDD:154310"
FT                   /locus_tag="BC1002_3443"
FT   gene            269776..271098
FT                   /db_xref="GeneID:9112747"
FT                   /locus_tag="BC1002_3444"
FT   CDS_pept        269776..271098
FT                   /locus_tag="BC1002_3444"
FT                   /gene_family="HOG000226944" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6357 major facilitator transporter"
FT                   /db_xref="GI:295699095"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112747"
FT                   /translation="MLVQHAAPTAGEVSVAKTDVRAYAWVVFALTVGLLLSDYMSRQVL
FT                   NAVFPPLKAAWHLSDAQLGSLSSVVALMVGVLTFPLSVLADRWGRVKSIVLMAAMWSLA
FT                   TVGCAISANYGQLLLARAFVGIGEAAYGSVGIAVVLSIFPVRLRSTLTGTFMAGGAFGS
FT                   VLGMALGGAVAAHLGWRAAFGAMAAMGIVLVVIYRLVVTEKRLAPLQPASVTNQTQTRG
FT                   MRMSLRELMKGLFSTKSVVCAYVGSGLHLMVPAAVWAWMPSFLNRYYGMATGKAAMCAA
FT                   VFVLVTGVGMVVCGNLADRLSKNVRERKWSAAIAYCLACFVLLAIGFHMPAGPWQLIVI
FT                   GVGMFFCAGASGPSGAMVANLTPPTIHASAFATLTLANNLLGLAPAAVLAGIIADRIGL
FT                   LGALQLVPFAPLVAAAAFMIGKRNYSGDLDRLNTLREQATR"
FT                   /protein_id="YP_003606988.1"
FT   misc_feature    269857..270867
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3444"
FT   misc_feature    269890..270867
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="BC1002_3444"
FT   misc_feature    order(269899..269901,269908..269916,269920..269925,
FT                   269974..269976,269983..269988,269995..269997,
FT                   270007..270012,270016..270021,270157..270162,
FT                   270169..270174,270181..270186,270193..270195,
FT                   270229..270234,270241..270246,270262..270264,
FT                   270526..270528,270535..270540,270547..270552,
FT                   270559..270561,270601..270603,270613..270615,
FT                   270625..270627,270634..270636,270646..270648,
FT                   270805..270807,270814..270819,270826..270828,
FT                   270838..270843,270850..270852)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3444"
FT   gene            271205..272185
FT                   /db_xref="GeneID:9112748"
FT                   /locus_tag="BC1002_3445"
FT   CDS_pept        271205..272185
FT                   /locus_tag="BC1002_3445"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   reu:Reut_A2148 zinc-containing alcohol dehydrogenase
FT                   superfamily protein"
FT                   /db_xref="GI:295699096"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112748"
FT                   /translation="MAKAVRFHETGGPEVLRYEDVEVGNPGPGQVRLRHQAVGLNFADT
FT                   YFRSGLYPVPLPAGMGVEAAGVVEAVGPDVTNVAVGDRVTYTGFINTLGAYSTERLIPA
FT                   APLIRLPDAIDCETAAGMTMRGLTAAYLMRRIHDFKAGDTILLHAAAGGVGLIVSQWAK
FT                   LLGLTVIGTVSSEAKGEVARAHGCDHVINYSREDVARRVRELTDGVGVNVVFDSVGKDT
FT                   FEASLDSLKRRGLLVCVGTASGPIPPFNPQLLAMKGSLYLTRPALADYIADPAEKDELA
FT                   GEIFGLIASGRIKIELNQRYALEDAAQAHRDLESRKTTGSSVFII"
FT                   /protein_id="YP_003606989.1"
FT   misc_feature    271205..272179
FT                   /note="quinone oxidoreductase, NADPH-dependent;
FT                   Provisional; Region: PRK10754"
FT                   /db_xref="CDD:170687"
FT                   /locus_tag="BC1002_3445"
FT   misc_feature    271211..272182
FT                   /note="Quinone oxidoreductase (QOR); Region: QOR2; cd05286"
FT                   /db_xref="CDD:176189"
FT                   /locus_tag="BC1002_3445"
FT   misc_feature    order(271325..271330,271340..271342,271574..271576,
FT                   271586..271588,271595..271597,271649..271651,
FT                   271658..271666,271721..271726,271736..271738,
FT                   271781..271783,271853..271858,271919..271933,
FT                   271994..272005,272144..272146,272150..272152)
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:176189"
FT                   /locus_tag="BC1002_3445"
FT   misc_feature    order(271610..271612,271898..271903,271940..271957,
FT                   271979..272002,272009..272014)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176189"
FT                   /locus_tag="BC1002_3445"
FT   gene            272196..273044
FT                   /db_xref="GeneID:9112749"
FT                   /locus_tag="BC1002_3446"
FT   CDS_pept        272196..273044
FT                   /locus_tag="BC1002_3446"
FT                   /gene_family="HOG000165071" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.11.17"
FT                   /codon_start="1"
FT                   /EC_number="1.14.11.17"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7176 taurine dioxygenase; PFAM:
FT                   Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="GI:295699097"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="GeneID:9112749"
FT                   /translation="MRVEQLTYSIGAELTGVNVAHAIHDDGLFAEIRSALLKHRVLFLR
FT                   DQDITRAEHVAFARRFGELEDHPVAGSDPENPGLVRIYKTPDQPNDRYENAWHADATWR
FT                   EKPQFGAVLRCVECPPVGGDTMWANMVLAYENLPAYVKAQIADLRARHSIEASFGAAMP
FT                   IEKRLALKAQFPDAEHPVVRTHPETEEKVLFVSAFTSHFTNFHTPERVRFGQDANPGAG
FT                   DLLRYLISQAYIPEYQVRWRWQKNSIAIWDNRSTQHYAVMDYPPCHRKMERAGIIGDKP
FT                   Y"
FT                   /product="Taurine dioxygenase"
FT                   /protein_id="YP_003606990.1"
FT   misc_feature    272196..273041
FT                   /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
FT                   trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
FT                   carrying out three reactions in the biosynthesis of
FT                   clavulanic acid, an inhibitor of class A serine
FT                   beta-lactamases. In general, Fe(II)-2OG...; Region:
FT                   CAS_like; cl00184"
FT                   /db_xref="CDD:174021"
FT                   /locus_tag="BC1002_3446"
FT   misc_feature    272199..273041
FT                   /note="Probable taurine catabolism dioxygenase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: TauD; COG2175"
FT                   /db_xref="CDD:32358"
FT                   /locus_tag="BC1002_3446"
FT   gene            273063..273629
FT                   /db_xref="GeneID:9112750"
FT                   /locus_tag="BC1002_3447"
FT   CDS_pept        273063..273629
FT                   /locus_tag="BC1002_3447"
FT                   /gene_family="HOG000140046" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1234"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   rme:Rmet_1734 hypothetical protein"
FT                   /db_xref="GI:295699098"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="GeneID:9112750"
FT                   /translation="MNYELKPTILMVPGLRDHVSEHWQTLLQQRLPKALSVPPLEHDKL
FT                   SCAARVAALDAALAKIDGPVILVAHSAGVMITVHWAAQHKREIHGALLAAPADLETPMP
FT                   AGYPELDTLEQNGWLPIPRKRLPFPSIVGASRNDPLARFERVQDMAQDWGSRLVDLGEV
FT                   GHLNPASGFGEWPMAETLIRRLVLM"
FT                   /protein_id="YP_003606991.1"
FT   misc_feature    273087..273614
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_3447"
FT   gene            273662..274018
FT                   /db_xref="GeneID:9112751"
FT                   /locus_tag="BC1002_3448"
FT   CDS_pept        273662..274018
FT                   /locus_tag="BC1002_3448"
FT                   /gene_family="HOG000128541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /codon_start="1"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   bph:Bphy_7180 Rieske (2Fe-2S) domain-containing protein"
FT                   /db_xref="GI:295699099"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="GeneID:9112751"
FT                   /translation="MSRRIVVGVAGELAPGQRKLAFIDGRSIVLFNIAGTLHAIDNTCP
FT                   HNGAALSSGQLEGCMLRCPAHGLRFDVRTGCMAGAGGLSVTTFPVEIVDSKVMVSLDEP
FT                   NATPSHQRAGSAAT"
FT                   /protein_id="YP_003606992.1"
FT   misc_feature    273671..273961
FT                   /note="Rieske non-heme iron oxygenase (RO) family, Rieske
FT                   ferredoxin component; composed of the Rieske ferredoxin
FT                   component of some three-component RO systems including
FT                   biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase
FT                   (CARDO). The RO family comprise...; Region:
FT                   Rieske_RO_ferredoxin; cd03528"
FT                   /db_xref="CDD:58551"
FT                   /locus_tag="BC1002_3448"
FT   misc_feature    order(273791..273793,273797..273799,273848..273850,
FT                   273857..273859)
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58551"
FT                   /locus_tag="BC1002_3448"
FT   gene            274068..275693
FT                   /db_xref="GeneID:9112752"
FT                   /locus_tag="BC1002_3449"
FT   CDS_pept        274068..275693
FT                   /locus_tag="BC1002_3449"
FT                   /gene_family="HOG000229980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   lch:Lcho_2171 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:295699100"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:9112752"
FT                   /translation="MQGLMMQQSLLVSALLTHAERHHGEQEIVSRRVEGDIHRYSYRHL
FT                   AQRARRMANALATLGVGQGERVATLAWNGYRHMELYFAVSGSGSVLHTLNPRLHVDQLE
FT                   YIIEHAEDRVVFFDLTFLPLIESVAPRVKSPKVFVAMTDRAHMPQANELGGMLMCYEDL
FT                   LELHDDVFEWPLLDENSASSLCYTSGTTGNPKGVLYSHRSTVLHTYAAALPDALNCSAR
FT                   DVILPVVPMFHVNAWGLPYIACMVGAKLVFPGPALDGKSLYELIETEHVTLSSGVPTVW
FT                   QGLLTHVDAMGGTFSSMRRTVIGGAPCPTAMTEAFQKRHRVEVLHAWGMTELSPIGTVC
FT                   SFKAHQQSLPMDEQYQVQAKQGRALFGIDMRIVGSHGNELPWDGESAGDLQVRGHWVTQ
FT                   QYFGAGVESPLCDGWFPTGDIATIDRHGFMQITDRSKDVIKSGGEWISSAAIENVAYLH
FT                   PEVSTAVCIAARHPKWDERPLLLVVKKPGSELASDELLSFFNGRVARWWTPDAVVFVDT
FT                   VPIGATGKVLKNQLRDQFGNYYLP"
FT                   /protein_id="YP_003606993.1"
FT   misc_feature    274068..275690
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="BC1002_3449"
FT   misc_feature    274068..275690
FT                   /note="putative acyl-CoA synthetase; Provisional; Region:
FT                   PRK06018"
FT                   /db_xref="CDD:168349"
FT                   /locus_tag="BC1002_3449"
FT   gene            275832..276977
FT                   /db_xref="GeneID:9112753"
FT                   /locus_tag="BC1002_3450"
FT   CDS_pept        275832..276977
FT                   /locus_tag="BC1002_3450"
FT                   /gene_family="HOG000114654" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /codon_start="1"
FT                   /product="porin Gram-negative type"
FT                   /transl_table="11"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bcj:BCAL1734
FT                   putative porin protein"
FT                   /db_xref="GI:295699101"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="GeneID:9112753"
FT                   /translation="MKLKASSAIALAIFATAAHAQSSVTLYGVIDTGFLYQSTSAATFL
FT                   PHAPNTGKIYQLKDGGIYASFWGLKGSEDIGGGYKVNFKLQGVFNSTNGKFGLSDTPGT
FT                   TAIFNQFATIGVSGPFGTFDAGRQIIPMIYAMAETDVRGAQYFGSILTAWLGINQAAGW
FT                   PGTSTNAPIGALYDSNALVYNSPKFYGASLALEYAPGGVAGHFQGGTRESAVAKYSNYG
FT                   LNLSAVYYNGHDTNPFPITYPAAPAIPATGLANNRFYYFGAMYTIAGFSVSASYGAGKN
FT                   PAHSNTADFEMISGGLGYQFNPRFKVTSGYYYLKDKNNSANHSSEFAVGAEYNLSQRTK
FT                   AYAQVGYVANKGTMNQTIIYGAPVAPGVSTTAAMVGIRHTF"
FT                   /protein_id="YP_003606994.1"
FT   misc_feature    275895..276974
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3450"
FT   misc_feature    order(275895..275897,275901..275903,275919..275921,
FT                   275925..275933,276042..276056,276072..276074,
FT                   276078..276086,276090..276092,276096..276107,
FT                   276156..276161,276165..276179,276204..276212,
FT                   276315..276317,276363..276368,276834..276839,
FT                   276846..276848,276960..276962,276966..276968,
FT                   276972..276974)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3450"
FT   misc_feature    order(275916..275918,276027..276029,276159..276161,
FT                   276249..276251,276315..276317)
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3450"
FT   gene            277008..277388
FT                   /db_xref="GeneID:9112754"
FT                   /locus_tag="BC1002_3451"
FT   CDS_pept        277008..277388
FT                   /locus_tag="BC1002_3451"
FT                   /gene_family="HOG000130654" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /codon_start="1"
FT                   /product="transport-associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6356 transport-associated; PFAM:
FT                   transport-associated; SMART: Transport-associated and
FT                   nodulation region"
FT                   /db_xref="GI:295699102"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="GeneID:9112754"
FT                   /translation="MKSIQARVLAIAATLILATSGSAWAQSGQTASAASGAPAMSGSAA
FT                   APASPRQANRALRRQVYAAIGKHKEISAGNISVIAKGGAVTLSGTVTDASQINQVAEIA
FT                   KGVPGVTSVTNKLTVQKPFGGQ"
FT                   /protein_id="YP_003606995.1"
FT   misc_feature    277179..277367
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="BC1002_3451"
FT   gene            complement(277444..277887)
FT                   /db_xref="GeneID:9112755"
FT                   /locus_tag="BC1002_3452"
FT   CDS_pept        complement(277444..277887)
FT                   /locus_tag="BC1002_3452"
FT                   /gene_family="HOG000232027" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: hoh:Hoch_2580
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:295699103"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9112755"
FT                   /translation="MSAIHEVYPYLRVRNAAQAIEFYAQAFGGVEQFRLTEPGGRIGHA
FT                   EVKIGPATVMLSDEYPEHDMLGPSGDSRPGVLLHIHCDDVDQLFAQAVKAGAIVILPLS
FT                   DHFYGERSATVRDPFGHEWQLGAQIEALTPEEMQRRYTALFDS"
FT                   /protein_id="YP_003606996.1"
FT   misc_feature    complement(277504..277875)
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_8; cd07246"
FT                   /db_xref="CDD:176670"
FT                   /locus_tag="BC1002_3452"
FT   misc_feature    complement(order(277513..277524,277546..277548,
FT                   277561..277563,277624..277626,277642..277659,
FT                   277663..277671,277726..277734,277738..277743,
FT                   277762..277767,277807..277809,277852..277854,
FT                   277858..277875))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:176670"
FT                   /locus_tag="BC1002_3452"
FT   gene            278128..278919
FT                   /db_xref="GeneID:9112756"
FT                   /locus_tag="BC1002_3453"
FT   CDS_pept        278128..278919
FT                   /locus_tag="BC1002_3453"
FT                   /gene_family="HOG000261675" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05988"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF899 thioredoxin
FT                   family protein; KEGG: bph:Bphy_7225 protein of unknown
FT                   function DUF899 thioredoxin family protein"
FT                   /db_xref="GI:295699104"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="GeneID:9112756"
FT                   /translation="MTTNESPEKSGKDGQPAMKTPPIVSRQEWEAAREQLLVKEKALTR
FT                   ARDALAAERRRMPWLAVEKTYAFDGPEGRVSLLDLFDGRRQLVIYRAFFEPGVHGWPEH
FT                   ACIGCSLGADQVSHLAHLHARDTTLVYASRAPQADIARLKARMGWQMIPWYTITDSFDA
FT                   DFGVDQWHGHNAFIRDGDRVFRTYFINGRGDEAMGTVWSYLDMTALGRQETWEDSPEGY
FT                   PQTRPYKWWNWNDTYVPGAAPDPKWVEVSDAGEAAFRKRDD"
FT                   /protein_id="YP_003606997.1"
FT   misc_feature    278179..278838
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="BC1002_3453"
FT   gene            279066..279920
FT                   /db_xref="GeneID:9112757"
FT                   /locus_tag="BC1002_3454"
FT   CDS_pept        279066..279920
FT                   /locus_tag="BC1002_3454"
FT                   /gene_family="HOG000197503" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /codon_start="1"
FT                   /product="Abortive infection protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   bph:Bphy_5617 abortive infection protein"
FT                   /db_xref="GI:295699105"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="GeneID:9112757"
FT                   /translation="MFALPWIAIFLAAPATWASTFRWLGVGLLVIGYGTAFATGQLGPL
FT                   ASVAIALLGVAAYAVSPAHRRYVRYAGHLLFVALAIALSLHWLPGFHNPRVMGRVQFTP
FT                   DAVPFSMYLNFDKPLIGFWLLLALPWIRPPHALRTWLLAGIAGWLTTVAVCMAVALSLG
FT                   VVGWAPNRPADSVLWLVNNLFLVTLTEEALFRGYLQGGLTRLFARWNRADLLALCVAAV
FT                   LFGLAHSAGGWQWIVLGSVAGIGYGLAYRFGGLCAAVLAHFGLNVIHFFFFTYPMLQPA
FT                   GKL"
FT                   /protein_id="YP_003606998.1"
FT   gene            280042..280467
FT                   /db_xref="GeneID:9112758"
FT                   /locus_tag="BC1002_3455"
FT   CDS_pept        280042..280467
FT                   /locus_tag="BC1002_3455"
FT                   /gene_family="HOG000159805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08818"
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1801"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   bpy:Bphyt_7189 domain of unknown function DUF1801"
FT                   /db_xref="GI:295699106"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="GeneID:9112758"
FT                   /translation="MNASERIDELIAGLTDWRGATFARIRQCVLAADPAIVEEFKWMGS
FT                   PVWSRDGMIAVANAHKGKVKLTFAHGAGLADPDGLFNAGLEGNERRAIDFFESDDVDER
FT                   ALKALIRAAIDYNQSHLKKNTRGAQPKARRKQAAGDA"
FT                   /protein_id="YP_003606999.1"
FT   misc_feature    280048..280398
FT                   /note="Domain of unknown function (DU1801); Region:
FT                   DUF1801; cl01838"
FT                   /db_xref="CDD:154618"
FT                   /locus_tag="BC1002_3455"
FT   gene            280675..282426
FT                   /db_xref="GeneID:9112759"
FT                   /locus_tag="BC1002_3456"
FT   CDS_pept        280675..282426
FT                   /locus_tag="BC1002_3456"
FT                   /gene_family="HOG000173156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6714 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="GI:295699107"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="GeneID:9112759"
FT                   /translation="MHQGPSMSEKKRKLRSAEWFGTADKNGFMYRSWMKNQGIPDHEFD
FT                   GRPVIGICNTWSELTPCNAHFRKLAEHVKRGIYEAGGFPVEFPVFSNGESNLRPTAMLT
FT                   RNLAAMDVEEAIRGNPIDAVVLLTGCDKTTPALLMGAASCDVPAIVVTGGPMLNGKLDG
FT                   KNIGSGTAVWQLHESLKAGEIDLHQFLSAEAGMSRSAGTCNTMGTASTMACMAEALGTS
FT                   LPHNAAIPAVDSRRYVLAHMSGIRIVEMALEDLKLSKILTREAFMNAIRVNAAIGGSTN
FT                   AVIHLKAIAGRIGIDLELDDWVHIGRDTPTIVDLMPSGRFLMEEFYYAGGLPAVLRRLG
FT                   EANLLPHPDALTVNGKSLWDNVKDAPNTNDEVIRPLDKPLVADGGIRVLRGNLAPRGAV
FT                   LKPSAATPELLKHRGRAVVFENFEHYKSRIVDETLDVDANSVLVMKNCGPKGYPGMAEV
FT                   GNMGLPPKLLKQGVKDMVRISDARMSGTAYGTVVLHVTPEAAAGGPLAAVQDGDWIELD
FT                   CDAGTLHLDVSDAELERRLAKHVPPEPPEGGGYRRLYIDHVLQADEGCDLDFLVGCRGS
FT                   AVPRHSH"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /protein_id="YP_003607000.1"
FT   misc_feature    280687..282423
FT                   /note="Dehydratase family; Region: ILVD_EDD; cl00340"
FT                   /db_xref="CDD:174127"
FT                   /locus_tag="BC1002_3456"
FT   misc_feature    280786..282378
FT                   /note="dihydroxy-acid dehydratase; Region: ilvD; TIGR00110"
FT                   /db_xref="CDD:161713"
FT                   /locus_tag="BC1002_3456"
FT   gene            complement(282561..283613)
FT                   /db_xref="GeneID:9112760"
FT                   /locus_tag="BC1002_3457"
FT   CDS_pept        complement(282561..283613)
FT                   /locus_tag="BC1002_3457"
FT                   /gene_family="HOG000026770" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase; KEGG: bph:Bphy_1161
FT                   beta-lactamase"
FT                   /db_xref="GI:295699108"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="GeneID:9112760"
FT                   /translation="MQDHLQQAVQFAVDHESLWDRHVGGAWGVHVNDPPPWNRLLGPVH
FT                   DRGPVSGAIAVDGRVLTSWGEPDRADLTFSVAKMYLALLAGVAHDRGLLPDVDEPVRVR
FT                   VPNIGFDDEHNAPITWAHLLQQTSEWRGTYFGLSDQADHYRAVNFAAPPNGNKGDLRPL
FT                   QRPGSYWEYNDVRINQFSLALLHLFRQPLPEVFREAIMRPSGASESWQWLGYDDAWVEI
FT                   DGRRMQSVPGGTHWGGGMSVSANDQLKVAQMLLDDGVANGRRVLSSEWIARMRTPCAIA
FT                   PFYGYLVWLNTGRKVFPNVPESSYFGVGAGSSFTWVEPERRMTVVVRWLNPAAANEFFG
FT                   LVLDAVDKLR"
FT                   /protein_id="YP_003607001.1"
FT   misc_feature    complement(282633..283457)
FT                   /note="Beta-lactamase; Region: Beta-lactamase; cl01009"
FT                   /db_xref="CDD:176824"
FT                   /locus_tag="BC1002_3457"
FT   gene            complement(283657..284949)
FT                   /db_xref="GeneID:9112761"
FT                   /locus_tag="BC1002_3458"
FT   CDS_pept        complement(283657..284949)
FT                   /locus_tag="BC1002_3458"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_1160 major facilitator transporter"
FT                   /db_xref="GI:295699109"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9112761"
FT                   /translation="MSMDSATTADALARHTSRSSVSRLILATSIGNALEFYDLVVYGYF
FT                   AAVLSRTFFPVHDRTVSLLLTLGTFALSYLARPIGALALGSFSDRKGRKASLTLSIALM
FT                   TLGTGMIALMPSYAAIGVLAPIGVFASRLLQGFSAGGEFGSSTAFLIEHAPQRKGFMAS
FT                   WQFSSQGASTLLASLFGAVLTSTLSTAQLESWGWRIPFLFGLLIGPVGLYIRRRIDETP
FT                   EFERAEKSAAPVRELLAMQKERVLVSIGALVLTTTANYMLLYMPTYAARQLGLAPSSGF
FT                   IATLAAGLIMMVLTPIVGHLSDKVGRVRIMLCAGVLFFATVYPAFMLMNAHPSLGSLLA
FT                   AVTWVAILKATYFAPIPALMSELFPTRTRTTGMAFGYNIGTTVFGGFTPLAVAALIAAT
FT                   GNNLAPGLYLMLAAVLSLFTVTWARVRLHAR"
FT                   /protein_id="YP_003607002.1"
FT   misc_feature    complement(283681..284877)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3458"
FT   misc_feature    complement(283699..284859)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="BC1002_3458"
FT   misc_feature    complement(order(283795..283797,283804..283809,
FT                   283816..283821,283831..283836,283867..283869,
FT                   283876..283881,283891..283893,283900..283905,
FT                   283912..283914,284065..284067,284077..284079,
FT                   284086..284088,284098..284100,284110..284112,
FT                   284152..284154,284161..284166,284173..284178,
FT                   284185..284187,284431..284433,284449..284454,
FT                   284461..284466,284497..284499,284506..284511,
FT                   284518..284523,284530..284535,284695..284700,
FT                   284704..284709,284719..284721,284728..284733,
FT                   284740..284742,284809..284814,284818..284826,
FT                   284833..284835))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_3458"
FT   gene            complement(285254..286435)
FT                   /db_xref="GeneID:9112762"
FT                   /locus_tag="BC1002_3459"
FT   CDS_pept        complement(285254..286435)
FT                   /locus_tag="BC1002_3459"
FT                   /gene_family="HOG000114656" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /codon_start="1"
FT                   /product="porin Gram-negative type"
FT                   /transl_table="11"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_B2192
FT                   OmpC family outer membrane porin"
FT                   /db_xref="GI:295699110"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="GeneID:9112762"
FT                   /translation="MNKKILTAATFAVFASAAHAQSSVTLYGVIDAGISYVNNSKTSTG
FT                   NSSLTKYDDGVAQGSRWGLRGTEDLGNGLKALFVLENGFNSGNGTAGQGGAMFGRQAYV
FT                   GVSQNNIGSLTFGRQYSFSTDYLGSNYSTGGLTVAGNYAYHINDVDQLTSSRINNSVKF
FT                   SSANFSGLTFGAMYGFSNTAGGFAGTPATGTSAAPVAGSSRAYSFGANYANGPFGIGAA
FT                   YTDIRYPGQASPAFSTSLANVSFPSLGTGQIQDLRSFGVGGRYAFGPATLWALYTNTRL
FT                   APISGGSTTFAAYEAGAKYAVTPAITAGAGYTYMHLSGANVGHWNQVNLSGDYALSKRT
FT                   DVYVLGIYQIASGHNAASGDLQAQIGSSTSYFNTSGVGADNQLAFRVGMRHKF"
FT                   /protein_id="YP_003607003.1"
FT   misc_feature    complement(285257..286363)
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3459"
FT   misc_feature    complement(order(285968..285970,286043..286045,
FT                   286136..286138,286253..286255,286349..286351))
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3459"
FT   misc_feature    complement(order(285257..285259,285263..285265,
FT                   285269..285271,285416..285418,285425..285430,
FT                   285959..285964,285968..285970,286082..286090,
FT                   286118..286132,286136..286141,286175..286186,
FT                   286190..286192,286196..286204,286208..286210,
FT                   286226..286240,286334..286342,286346..286348))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_3459"
FT   gene            complement(286772..287887)
FT                   /db_xref="GeneID:9112763"
FT                   /locus_tag="BC1002_3460"
FT   CDS_pept        complement(286772..287887)
FT                   /locus_tag="BC1002_3460"
FT                   /gene_family="HOG000219334" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /codon_start="1"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bpy:Bphyt_5954
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="GI:295699111"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="GeneID:9112763"
FT                   /translation="MQTQTHPLIAPSLGTARELTSFHYGPGGGQKIYIQSSLHADELPG
FT                   MLVSWSLRRKLAALEGAGKLRGEVVVVPVPNPIGLNQHLLGQMLGRFETGSAQNFNRNF
FT                   YDLAELVLPIIESRLTGDIDENRAAIRTAMREALDAQQPTTELGSQRLALQKLSYDADV
FT                   VLDLHCDWEAAMHLYTNPDLWPEVEPLARYIDAKASLLALNSVGNPFDEIHSFCWSDLR
FT                   GRFGERFPIPNGGISVTIELRGQRDVSHEYAEKDAQAIIEYLTLRGVVDGEPAPLPPLE
FT                   FAATPLAGAEPLVAPISGVLVYRCPVGTWVDVGQEIADIVDPLTDRVVTIKNTVAGVLY
FT                   ARHLARFATAGLEFARIAGATPFRSGSLLSN"
FT                   /protein_id="YP_003607004.1"
FT   misc_feature    complement(286814..287878)
FT                   /note="An uncharacterized subgroup of the Succinylglutamate
FT                   desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which
FT                   is part of the the M14 family of metallocarboxypeptidases.
FT                   This subgroup includes Pseudomonas aeruginosa AotO and
FT                   related proteins. ASTE...; Region: M14_PaAOTO_like;
FT                   cd06250"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="BC1002_3460"
FT   misc_feature    complement(286796..287860)
FT                   /note="Predicted deacylase [General function prediction
FT                   only]; Region: COG3608"
FT                   /db_xref="CDD:33407"
FT                   /locus_tag="BC1002_3460"
FT   misc_feature    complement(order(287165..287167,287198..287200,
FT                   287210..287212,287363..287365,287384..287386,
FT                   287582..287587,287615..287617,287762..287764,
FT                   287771..287773))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="BC1002_3460"
FT   misc_feature    complement(order(287384..287386,287762..287764,
FT                   287771..287773))
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133107"
FT                   /locus_tag="BC1002_3460"
FT   gene            complement(288154..288936)
FT                   /db_xref="GeneID:9112764"
FT                   /locus_tag="BC1002_3461"
FT   CDS_pept        complement(288154..288936)
FT                   /locus_tag="BC1002_3461"
FT                   /gene_family="HOG000031896" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01096"
FT                   /codon_start="1"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; KEGG: bpy:Bphyt_5953
FT                   cationic amino acid ABC transporter, periplasmic binding
FT                   protein; SMART: extracellular solute-binding protein family
FT                   3"
FT                   /db_xref="GI:295699112"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="GeneID:9112764"
FT                   /translation="MKKLLAALTVALIATVSIGAHAKDWSTIRFGVDASYPPFESKGAD
FT                   GKLVGFDIDLGNEICKRVGAKCVWVENDFDGMIPALKAKKFDGVLSSMSMTPQRAEQVA
FT                   FSSKLFNTPTRLVAKQGSGILPTAESLKGKSVGVEQGTIQETYAKTYWEPKGAKVVPYQ
FT                   NQDQVYADLISGRLDAALQDAVQAEQGFLKTPRGAGFAFVGQNLDDPKILGNGAGIGMR
FT                   KEDTDLKAKVDKAIADMIKDGTYKKIEKKYFDFDVYGS"
FT                   /protein_id="YP_003607005.1"
FT   misc_feature    complement(288178..288858)
FT                   /note="lysine-arginine-ornithine-binding periplasmic
FT                   protein; Region: 3A0103s03R; TIGR01096"
FT                   /db_xref="CDD:162200"
FT                   /locus_tag="BC1002_3461"
FT   misc_feature    complement(288178..288855)
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3461"
FT   misc_feature    complement(order(288388..288390,288508..288510,
FT                   288640..288642,288715..288717,288829..288831))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3461"
FT   misc_feature    complement(order(288409..288411,288427..288429,
FT                   288439..288441))
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3461"
FT   misc_feature    complement(order(288283..288297,288313..288315))
FT                   /note="hinge residues; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_3461"
FT   gene            289591..290820
FT                   /db_xref="GeneID:9112765"
FT                   /locus_tag="BC1002_3462"
FT   CDS_pept        289591..290820
FT                   /locus_tag="BC1002_3462"
FT                   /gene_family="HOG000195160" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bpy:Bphyt_5951 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="GI:295699113"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9112765"
FT                   /translation="MRTMSFTANQTGCCKQTFKRQIASVGAPVRAALLQRRFFVGFLSG
FT                   ITSGFTSIGVSGFWCDVLPRTLRVLTGALLCAGFAAATPAAAADKLLHVLAWPGYADPD
FT                   VVKAFEARYGVKVEVTLVDSDEALWAQMHSKGAPPFDVLAANTAEIRRYTQANLLAPLD
FT                   LASLPNTKKQLPRFQALGSIGGLTSAGKVYAIPFTYSSMGLIYDRKQIPVAPHSMLELW
FT                   NPRYRGKVLDFNSAQHNFSFTALALGYPHPFQLDPAQMRRIAHKLVDLRRNLLTYYTLP
FT                   EEATAFFIQHKVALMFGNYGTQQVQLLRRAGADVGYVIPDEGALAWLDCWSMTRAASDQ
FT                   PLALAWINYMLEPSVSALLTQRQGLANTLTEPAEGNPNAHIVWISPVEDIDRREQLWTR
FT                   IVSGDRSERF"
FT                   /protein_id="YP_003607006.1"
FT   misc_feature    289867..290799
FT                   /note="Spermidine/putrescine-binding periplasmic protein
FT                   [Amino acid transport and metabolism]; Region: PotD;
FT                   COG0687"
FT                   /db_xref="CDD:31031"
FT                   /locus_tag="BC1002_3462"
FT   misc_feature    289879..290682
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3462"
FT   gene            290820..292643
FT                   /db_xref="GeneID:9112766"
FT                   /locus_tag="BC1002_3463"
FT   CDS_pept        290820..292643
FT                   /locus_tag="BC1002_3463"
FT                   /gene_family="HOG000195049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bpy:Bphyt_5950 diguanylate cyclase; SMART:
FT                   GGDEF domain containing protein"
FT                   /db_xref="GI:295699114"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="GeneID:9112766"
FT                   /translation="MLHRGLTFKLSVLLACIGVLASGATGYYAYRANRTMLVNEAEHSL
FT                   QTSTELLGQRIAVSIDDVAADALVLATMPSSVSVAQTDDGIGPNLGRERLAQVYSSFML
FT                   HHAEYLQVRLITRQHHGLELIRFDRDSDGLVRVQGDDLQEKAQFPYVFETLAFSPGRIY
FT                   TSPISVNHEYGTHAAQGRPTLRLGTPIADARGTVVGVVVIDIDLAGMLRRLQSDLPSDY
FT                   QVYLANEWGDFLVHPDASKTFGFDRGRRVLMQDSFPVTRQLFEQRQSEVLVNGLARPDE
FT                   AEGHVLAFVRRPFGGSEGNRFIVLGLAKPLEDVLSGANQLGTRIIRMVLVFSALSLLLA
FT                   ILFARALTKPLHLLAYAATHLFAEHAMHTLPLKRTDEIGVLARCFERLRREIRAQMDAL
FT                   HSKQSELVHLASHDVLTGLPNRMLFMQKLENAIEEARFRREGLAVLFVDLDRFKQINDQ
FT                   FGHSVGDKVLVAVARRLKDVLYAGDVVARLGGDEFIVLIEGRRAAEVTPEIAERIMDAL
FT                   NKTLSVDGNSMTVGASIGISEFPHDSGNAEELLLNADAAMYAAKSGGRCGYLRYQDLLA
FT                   MRLHEQAEQARLAQAHAARDATEGREAEPTA"
FT                   /protein_id="YP_003607007.1"
FT   misc_feature    292053..292523
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3463"
FT   misc_feature    order(292161..292163,292290..292292)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3463"
FT   misc_feature    order(292176..292178,292185..292190,292200..292202,
FT                   292212..292214,292278..292280,292284..292295)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3463"
FT   misc_feature    order(292266..292268,292353..292355)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3463"
FT   gene            complement(292732..293865)
FT                   /db_xref="GeneID:9112767"
FT                   /locus_tag="BC1002_3464"
FT   CDS_pept        complement(292732..293865)
FT                   /locus_tag="BC1002_3464"
FT                   /gene_family="HOG000126996" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02318"
FT                   /codon_start="1"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2185 putative phosphonate metabolism
FT                   protein PhnM; TIGRFAM: phosphonate metabolism protein PhnM;
FT                   PFAM: Amidohydrolase 3"
FT                   /db_xref="GI:295699115"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:9112767"
FT                   /translation="MLISNARIVTRDEEFIGTVRVEDGVIRDVERGAGSARNAEDWDGD
FT                   YLLPGLIELHTDNLEKHLVPRPGVEWNTDAAFVIHDAQVAAAGITTVFDALAIGSRSSV
FT                   GLRNRHVQTQCAESLLRLSTRRLLRAEHFLHLRCEIATADVLEVFDSLCAHPLLRLASV
FT                   MDHTPGQRQWHDREQWRRFQERNGKMSDERVASTLAELAVEQERYADEHRREIVARCRR
FT                   LGIPVASHDDTLIEHVEQAKAEGIVLAEFPTTRIAAQAAREHGIATIMGAPNIVRGGSH
FT                   SGNVSALELARADLLDILSSDYVPSSLLTAVFDLVEKAGWSLPRAMATVSAEPARTAGL
FT                   TDRGAIEPGLRADLVRVTMLDRLPVPRATYRGGVRIV"
FT                   /protein_id="YP_003607008.1"
FT   misc_feature    complement(292735..293865)
FT                   /note="Cytosine deaminase and related metal-dependent
FT                   hydrolases [Nucleotide transport and metabolism / General
FT                   function prediction only]; Region: SsnA; COG0402"
FT                   /db_xref="CDD:30751"
FT                   /locus_tag="BC1002_3464"
FT   misc_feature    complement(<293698..293865)
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="BC1002_3464"
FT   misc_feature    complement(292747..293724)
FT                   /note="PhnM is believed to be a subunit of the membrane
FT                   associated C-P lyase complex. C-P lyase is thought to
FT                   catalyze the direct cleavage of inactivated C-P bonds to
FT                   yield inorganic phosphate and the corresponding
FT                   hydrocarbons. It is responsible for cleavage...; Region:
FT                   PhnM; cd01306"
FT                   /db_xref="CDD:30049"
FT                   /locus_tag="BC1002_3464"
FT   misc_feature    complement(order(292960..292962,293176..293178,
FT                   293695..293697,293701..293703))
FT                   /note="active site"
FT                   /db_xref="CDD:30049"
FT                   /locus_tag="BC1002_3464"
FT   gene            complement(293902..294678)
FT                   /db_xref="GeneID:9112768"
FT                   /locus_tag="BC1002_3465"
FT   CDS_pept        complement(293902..294678)
FT                   /locus_tag="BC1002_3465"
FT                   /inference="protein motif:TFAM:TIGR02324"
FT                   /codon_start="1"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnL;
FT                   PFAM: ABC transporter related; KEGG: bpy:Bphyt_5945
FT                   phosphonate C-P lyase system protein PhnL; SMART: AAA
FT                   ATPase"
FT                   /db_xref="GI:295699116"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112768"
FT                   /translation="MQSTAVVTDAGSAARHGERAFADNAALMLRATGIGKTFTLHGQGG
FT                   ARIDALANVSLEVERGECVVLVGPSGAGKSTLLRCLYGNYLASTGSIAIRDTSDQGRPV
FT                   TITGAEPRDVLRLRRSVVGYVSQFLRVIPRVPTLALVAEPLVLHGIAEPEANARAAELL
FT                   ARLNVPERLWSLAPATFSGGEQQRVNIARGLIAEHPLLLLDEPTASLDAENRDVVADLI
FT                   VEARERGAAIVGIFHDEETRNKVATRRLELRPPLRH"
FT                   /protein_id="YP_003607009.1"
FT   misc_feature    complement(293917..294597)
FT                   /note="phosphonate C-P lyase system protein PhnL; Region:
FT                   CP_lyasePhnL; TIGR02324"
FT                   /db_xref="CDD:131377"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(293920..294594)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(294454..294477)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(order(293968..293970,294064..294069,
FT                   294298..294300,294451..294459,294463..294468))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(294298..294309)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(294112..294141)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(294064..294081)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(294046..294057)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   misc_feature    complement(293962..293982)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_3465"
FT   gene            complement(294687..295457)
FT                   /db_xref="GeneID:9112769"
FT                   /locus_tag="BC1002_3466"
FT   CDS_pept        complement(294687..295457)
FT                   /locus_tag="BC1002_3466"
FT                   /inference="protein motif:TFAM:TIGR02323"
FT                   /codon_start="1"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnK;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; KEGG: bpy:Bphyt_5944
FT                   phosphonate C-P lyase system protein PhnK; SMART: AAA
FT                   ATPase"
FT                   /db_xref="GI:295699117"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112769"
FT                   /translation="MTPLLSARALTKQYGGRNGCRNVSFDLYPGEVLCIVGESGSGKTT
FT                   LLSTLALKTEADSGSLHYTASHGDSLDLRALSEPRRRLLMRTEWGFVQQNPRDGLRSGV
FT                   SAGANIGEPLMAVGARHYGEIRRTATQWMERVELDPMRIDEFPAAFSGGMQQRLQIARN
FT                   LVTGPRLVFMDEPTAGLDVSVQARLLDLLRTLTSTLHLSVLIVTHDIGVARLLAHRLMV
FT                   MQAGEVVEAGLTDQVLDDPQHPYTQTLVSSVLPV"
FT                   /protein_id="YP_003607010.1"
FT   misc_feature    complement(294690..295457)
FT                   /note="phosphonate C-P lyase system protein PhnK;
FT                   Provisional; Region: phnK; PRK11701"
FT                   /db_xref="CDD:171250"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(294762..295448)
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(295326..295349)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(order(294834..294836,294933..294938,
FT                   295176..295178,295323..295331,295335..295340))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(295176..295187)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(294981..295010)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(294933..294950)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(294915..294926)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(294828..294848)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_3466"
FT   misc_feature    complement(<294699..294773)
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="BC1002_3466"
FT   gene            complement(295454..296386)
FT                   /db_xref="GeneID:9112770"
FT                   /locus_tag="BC1002_3467"
FT   CDS_pept        complement(295454..296386)
FT                   /locus_tag="BC1002_3467"
FT                   /gene_family="HOG000147107" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06007"
FT                   /codon_start="1"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphonate metabolism PhnJ; KEGG:
FT                   bxe:Bxe_B2182 putative phosphonate metabolism PhnJ protein"
FT                   /db_xref="GI:295699118"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="GeneID:9112770"
FT                   /translation="MNAPDTAVANTSYDSAAHGYNFAYLDEQTKRMLRRALLKAVAVPG
FT                   YQVPFASREMPLPYGWGTGGIQVTAAIIGKTDTLKVIDQGSDETTNAVNIRRFFARTTG
FT                   VATTRHTSEATIIQTRHRIPETPLTEQQILVYQVPMPEPLFRLEPRVAECKKLHALADY
FT                   GLISVKLYEDIVHHASIATTYDYPVIVNHRYLTSPSPIPKFDNPKMHMNAALQLFGAGR
FT                   ERRIHAIPPYTPVRSLDFDDHPFEVQKWQHACALCGSKESFLDEMIVDDAGTRMFVCSD
FT                   SDYCHERRGDGEIEPQAALPHATREGESA"
FT                   /protein_id="YP_003607011.1"
FT   misc_feature    complement(295508..296332)
FT                   /note="Phosphonate metabolism protein PhnJ; Region: PhnJ;
FT                   cl01457"
FT                   /db_xref="CDD:154413"
FT                   /locus_tag="BC1002_3467"
FT   gene            complement(296383..297519)
FT                   /db_xref="GeneID:9112771"
FT                   /locus_tag="BC1002_3468"
FT   CDS_pept        complement(296383..297519)
FT                   /locus_tag="BC1002_3468"
FT                   /gene_family="HOG000127007" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05861"
FT                   /codon_start="1"
FT                   /product="phosphonate metabolism"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphonate metabolism; KEGG: bpy:Bphyt_5942
FT                   phosphonate metabolism"
FT                   /db_xref="GI:295699119"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="GeneID:9112771"
FT                   /translation="MYVAVKGGERAIEASWRLLDKARRGDKQIAELSVAQIREQLRLAV
FT                   ARVMTEGSVYDEELAALAIKQAAGDLVEAIFLLRAYRTTLPRFGYTRAIDTETMQVERR
FT                   ISATFKDVPGGQLLGATYDYTQRLLDFALLADGDDTRQYVTQANAPVSQEPTAQEAMPR
FT                   VVSLLDKEGLIEQERPTPNGAEPGDLSREPLAFPASRATRLQNLARGDEGFLLAMGYAT
FT                   QRGYAHSHPFAGEIRFGTIAVEMDLDELGEAVDIGDIDVTECQMINQFAGSSAVPPTFT
FT                   QGYGLAFGHSERKAMAMALVDRALRAEELGETLASPTQDIEFMLSHSDNVEASGFVQHL
FT                   KLPHYVDFQAELELVRRLRAQHHSNDEAGNTTDKELAA"
FT                   /protein_id="YP_003607012.1"
FT   misc_feature    complement(296434..297519)
FT                   /note="Bacterial phosphonate metabolism protein (PhnI);
FT                   Region: PhnI; cl01456"
FT                   /db_xref="CDD:154412"
FT                   /locus_tag="BC1002_3468"
FT   gene            complement(297519..298130)
FT                   /db_xref="GeneID:9112772"
FT                   /locus_tag="BC1002_3469"
FT   CDS_pept        complement(297519..298130)
FT                   /locus_tag="BC1002_3469"
FT                   /gene_family="HOG000127018" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03292"
FT                   /codon_start="1"
FT                   /product="phosphonate C-P lyase system protein PhnH"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2180 carbon-phosphorus lyase complex
FT                   subunit; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnH; PFAM: phosphonate metabolism"
FT                   /db_xref="GI:295699120"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="GeneID:9112772"
FT                   /translation="MERSPIALSTLTPGFADPVHDTQAVFRTLLDALSRPGTIGVIRDV
FT                   LPELRNTPVEPAAFAALLTLCDYATPVWLAQPDTALASAVRFHTGAPLVDAPGDAAFVY
FT                   VHDADALPSLENFAPGSAESPEQSATLLIRVDALTGGAPVTLSGPGILDTQTISPVGLP
FT                   ARFWQERAMLAPLFPCGIDCYLVCGPRVIGLPRTTEAKVN"
FT                   /protein_id="YP_003607013.1"
FT   misc_feature    complement(297537..298100)
FT                   /note="Bacterial phosphonate metabolism protein (PhnH);
FT                   Region: PhnH; cl01455"
FT                   /db_xref="CDD:174628"
FT                   /locus_tag="BC1002_3469"
FT   gene            complement(298130..298636)
FT                   /db_xref="GeneID:9112773"
FT                   /locus_tag="BC1002_3470"
FT   CDS_pept        complement(298130..298636)
FT                   /locus_tag="BC1002_3470"
FT                   /gene_family="HOG000127029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03293"
FT                   /codon_start="1"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2179 putative phosphonate metabolism
FT                   protein PhnG; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnG; PFAM: phosphonate metabolism PhnG"
FT                   /db_xref="GI:295699121"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="GeneID:9112773"
FT                   /translation="MSPSSVPPSAPLPAVSSAARRAWMAVLARTPRADLEAALQRALHG
FT                   QPTPAYDWLRPPEIGLAMVRGRIGGSGDPFNLGEATVTRATLRLHASGDAEATVGVACH
FT                   LGRDRRRAELAALADALLQMPEHHDSLHRQLIAPFAAQQKARREQQQQDAAATRVEFFT
FT                   MVRGD"
FT                   /protein_id="YP_003607014.1"
FT   misc_feature    complement(298133..298570)
FT                   /note="Phosphonate metabolism protein PhnG; Region: PhnG;
FT                   cl01454"
FT                   /db_xref="CDD:163981"
FT                   /locus_tag="BC1002_3470"
FT   gene            298817..299575
FT                   /db_xref="GeneID:9112774"
FT                   /locus_tag="BC1002_3471"
FT   CDS_pept        298817..299575
FT                   /locus_tag="BC1002_3471"
FT                   /gene_family="HOG000228717" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02325"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphonates metabolism transcriptional
FT                   regulator PhnF; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; KEGG: bxe:Bxe_B2178 GntR family transcriptional
FT                   regulator; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295699122"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="GeneID:9112774"
FT                   /translation="MTSNDSAAPATMLERGAGVAVWRQIEQILAAEIAASGFGEEGRLP
FT                   SEGELAKRFDVNRHTVRRAMLGLAALGLVSVEQGRGTFVQPGAIDYSIGRRTRFTENLR
FT                   QQHHSPGGTMLSGARVKAEPSVAKALGLRAGAAVYRIESLNESDGVPLTFARSWFPAAR
FT                   FPELPEVVERLGGTTKALAEFGVDDYLRKWSRIGSVLPEPEVARRLNINRQQPVLWVEN
FT                   VDVDLQGTPVKYGFTHFAADRVQLLVEHDL"
FT                   /protein_id="YP_003607015.1"
FT   misc_feature    298856..299566
FT                   /note="phosphonates metabolism transcriptional regulator
FT                   PhnF; Region: C_P_lyase_phnF; TIGR02325"
FT                   /db_xref="CDD:131378"
FT                   /locus_tag="BC1002_3471"
FT   misc_feature    <298943..299068
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3471"
FT   misc_feature    order(298949..298951,298955..298960,298982..298996,
FT                   299000..299005,299012..299014,299042..299047,
FT                   299051..299062)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3471"
FT   misc_feature    299129..299551
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="BC1002_3471"
FT   gene            299572..300336
FT                   /db_xref="GeneID:9112775"
FT                   /locus_tag="BC1002_3472"
FT   CDS_pept        299572..300336
FT                   /locus_tag="BC1002_3472"
FT                   /gene_family="HOG000147096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03223"
FT                   /codon_start="1"
FT                   /product="phosphonate metabolism protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2177 hypothetical protein; TIGRFAM:
FT                   phosphonate metabolism protein; PFAM: protein of unknown
FT                   function DUF1045"
FT                   /db_xref="GI:295699123"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="GeneID:9112775"
FT                   /translation="MSGPAWSDDARFALYYAPSCESAWWRAGSTWLGRDARSGERCAQP
FT                   QPPGLTRPLAALTDSPRRYGWHGTLIAPFRRGAGVTQHDVLAAARAWALAQQPFALPVE
FT                   AATLGDFVALRPADADGETRICELASNALESLDGLRARPSAADLERRLAAPLSERQRAL
FT                   LLQWGYPYVFEEFRFHMTLSSSLADADERATLLAWWRERTPALGPLAVDQAALFVEPAP
FT                   GEPFVLWQPLPFSDGAQHGDRSDEQQDEVSSQ"
FT                   /protein_id="YP_003607016.1"
FT   misc_feature    299599..300276
FT                   /note="putative phosphonate metabolism protein; Region:
FT                   Phn_opern_protn; TIGR03223"
FT                   /db_xref="CDD:163188"
FT                   /locus_tag="BC1002_3472"
FT   misc_feature    299776..300255
FT                   /note="Protein of unknown function (DUF1045); Region:
FT                   DUF1045; pfam06299"
FT                   /db_xref="CDD:114990"
FT                   /locus_tag="BC1002_3472"
FT   gene            300333..300884
FT                   /db_xref="GeneID:9112776"
FT                   /locus_tag="BC1002_3473"
FT   CDS_pept        300333..300884
FT                   /locus_tag="BC1002_3473"
FT                   /gene_family="HOG000037637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02322"
FT                   /codon_start="1"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5937 phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; TIGRFAM:
FT                   phosphonate metabolism protein/1,5-bisphosphokinase
FT                   (PRPP-forming) PhnN; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="GI:295699124"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="GeneID:9112776"
FT                   /translation="MNGRLIYVMGPSGAGKDSLLQFARTRLAGEPVVFAHRYITRPSGH
FT                   GEVHVALSVEEFAARSVLGLFALEWSSHSLHYGIGIELDAWLARGCTVVVNGSRQYLQH
FT                   ALARYPRAEVVHVSAAPHILEARLGARARESSEQVAARLARRAPFALPAGVRCTTIDNS
FT                   GTLEEAGHALITVLKEQVSV"
FT                   /protein_id="YP_003607017.1"
FT   misc_feature    300339..300872
FT                   /note="Guanylate kinase; Region: Guanylate_kin; cl12021"
FT                   /db_xref="CDD:175385"
FT                   /locus_tag="BC1002_3473"
FT   gene            complement(300901..301809)
FT                   /db_xref="GeneID:9112777"
FT                   /locus_tag="BC1002_3474"
FT   CDS_pept        complement(300901..301809)
FT                   /locus_tag="BC1002_3474"
FT                   /gene_family="HOG000233526" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_5936 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295699125"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112777"
FT                   /translation="MKPQQLQAFVAAAHHRSLRAAARELGVTQPAVTHTIRELESALNA
FT                   ELMVRSVRGIELTACGLALLPRAEQLLGDMRRTVEAVEQVKGELAGKVSVGTMPSLALT
FT                   VLPHAVSSFREKMPLVSLHLEEVTVPDALARLRNGTLDLAAIHHVLALDNDLVQVPLYS
FT                   TQFVVTMRAGHPLANVTRLSELLDAEWIVTVGADHFPHSVMMAMFSTHGLPLPKRLLRA
FT                   PSSFAVTLRLVSQTDVISCFTRPLAQRVAPLGIRVAQIEDALPNYDLSIISRRDLLPTP
FT                   AVQQFVACLRQVTRERMGDVQ"
FT                   /protein_id="YP_003607018.1"
FT   misc_feature    complement(300922..301809)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK09791"
FT                   /db_xref="CDD:170097"
FT                   /locus_tag="BC1002_3474"
FT   misc_feature    complement(301627..301800)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3474"
FT   misc_feature    complement(300937..301536)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3474"
FT   misc_feature    complement(order(301105..301110,301114..301119,
FT                   301135..301140,301144..301155,301432..301452,
FT                   301456..301458,301468..301470,301477..301482,
FT                   301486..301491))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_3474"
FT   gene            301921..303111
FT                   /db_xref="GeneID:9112778"
FT                   /locus_tag="BC1002_3475"
FT   CDS_pept        301921..303111
FT                   /locus_tag="BC1002_3475"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.32"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: bpy:Bphyt_5935
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:295699126"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:9112778"
FT                   /translation="MNETPRLTEVSDLEPAAASLREIRHHIHHHPELAYEEVRTAALVA
FT                   EKLEQWGWQVTRGVGKTGVVGTLKVGDGKSSIGIRADMDALPILEQTGLPYASGTHGKM
FT                   HACGHDGHTTILLGAAQRLAATRNFSGTVHLYFQPAEESGIDSGALKMINDGLFERFPC
FT                   DAVFGLHNHPGAEPGMLLFRKGPFMSAGDKATITVEGVGGHAARPHLTVDPVVVAASIV
FT                   MALQTIVARNVDPSQPAVVTVGSMHAGTANNVISSSARLELSVRSFSPEVRELLKQRIT
FT                   ELAESQAASYGGKAHVEYIEGYPVVINTDAETDFAVQVARELVGDDKVVEQTDILMGSE
FT                   DFAFMLQKRPGTFLRIGNGVGEDGCMVHNPHYDFNDRSLPIGAAFWARLVERYLAQ"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_003607019.1"
FT   misc_feature    302020..303105
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="BC1002_3475"
FT   misc_feature    <302020..303102
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="BC1002_3475"
FT   gene            complement(303215..304039)
FT                   /db_xref="GeneID:9112779"
FT                   /locus_tag="BC1002_3476"
FT   CDS_pept        complement(303215..304039)
FT                   /locus_tag="BC1002_3476"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02431"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: Transcriptional
FT                   regulator IclR ; regulatory protein IclR; KEGG:
FT                   bxe:Bxe_B2174 IclR family transcriptional regulator; SMART:
FT                   regulatory protein IclR"
FT                   /db_xref="GI:295699127"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9112779"
FT                   /translation="MSKALPPSSVAPANVEPAPEKPGDSYVQSFARGLAVIRAFDATRP
FT                   EQTLTDVAAATGLTRAGARRILLTLQTLGYVEAEGRLFRLTPKILDLGFAYLTSMPFWN
FT                   LAEPVMESLSAQVHESCSAAVLDRTEIVYVLRVPTHKIMTINLSIGSRLPAYCTSMGRV
FT                   LLASLDEETLDATLNSSPLYAHTPRTITDKEELKKVIEQVRRQGWAIVDQELEGGLISL
FT                   SAPIRNRQGRVIAAMNISGNAQRNSAKQMVKAFLEPLQQAAQTVSEMVARRG"
FT                   /protein_id="YP_003607020.1"
FT   misc_feature    complement(303230..303973)
FT                   /note="beta-ketoadipate pathway transcriptional regulators,
FT                   PcaR/PcaU/PobR family; Region: pcaR_pcaU; TIGR02431"
FT                   /db_xref="CDD:131484"
FT                   /locus_tag="BC1002_3476"
FT   misc_feature    complement(303698..303961)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3476"
FT   misc_feature    complement(303239..303616)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_3476"
FT   gene            304293..304997
FT                   /db_xref="GeneID:9112780"
FT                   /locus_tag="BC1002_3477"
FT   CDS_pept        304293..304997
FT                   /locus_tag="BC1002_3477"
FT                   /gene_family="HOG000273991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="GntR domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5932 GntR domain protein; PFAM: GntR
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="GI:295699128"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112780"
FT                   /translation="MFDKIPSRALSDTVAQQLLKQIDKGTFARGAKLPTEAVLAQQFGV
FT                   SRTVIREALSRLKNEGVVEPRQGSGVFVAGHGTIRPLRIDYAEAVEPGSVVQILALRRA
FT                   IEAEVASEAAMRRSDADMAAIDAALAQIERAVANGEDGVAEDVAFHRAIAAATGNPYFL
FT                   KTLTFLNQYLEAGTVVTRRNEALREDFSRQVREEHAAIAAAIRAGDPMAARNAAQTHLY
FT                   NAARRLAEAGIA"
FT                   /protein_id="YP_003607021.1"
FT   misc_feature    304293..304994
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   FadR; COG2186"
FT                   /db_xref="CDD:32369"
FT                   /locus_tag="BC1002_3477"
FT   misc_feature    304320..304514
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3477"
FT   misc_feature    order(304323..304325,304392..304394,304398..304403,
FT                   304425..304439,304443..304448,304455..304457,
FT                   304485..304490,304494..304505)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_3477"
FT   misc_feature    304581..304955
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_3477"
FT   gene            305070..305960
FT                   /db_xref="GeneID:9112781"
FT                   /locus_tag="BC1002_3478"
FT   CDS_pept        305070..305960
FT                   /locus_tag="BC1002_3478"
FT                   /gene_family="HOG000219608" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.31"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5931 3-hydroxyisobutyrate
FT                   dehydrogenase; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="GI:295699129"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112781"
FT                   /translation="MSRNVGVIGLGAMGLGVARSLLRAGFKVHACDLRRDVLQAFVAEG
FT                   GVGCATPAELGAQCEVVITLVVNAAQTEAVLFGEHGALAAMKPGGVVIASATVAPEFAS
FT                   DLARRVEAAGLQMLDAPVSGGAARAASGEMTMMTSGPAAAYAACEDVLAAIAGNVYRLG
FT                   VAHGAGSKVKIINQLLAGVHIAVAAEAMALGLREGVDPDALYDVITHSAGNSWMFENRV
FT                   PHILAGDYTPLSAVDIFVKDLGLVLDTARRTKFPLPLSAAAHQMFMMASTAGHGGEDDS
FT                   AVVKIFPGIELPAKQ"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_003607022.1"
FT   misc_feature    305082..305930
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="BC1002_3478"
FT   misc_feature    305082..>305594
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3478"
FT   gene            305976..307304
FT                   /db_xref="GeneID:9112782"
FT                   /locus_tag="BC1002_3479"
FT   CDS_pept        305976..307304
FT                   /locus_tag="BC1002_3479"
FT                   /gene_family="HOG000218170" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07005"
FT                   /codon_start="1"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /transl_table="11"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   bpy:Bphyt_5930 type III effector Hrp-dependent outers"
FT                   /db_xref="GI:295699130"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="GeneID:9112782"
FT                   /translation="MTAQTKPALLGCIADDFTGATDLANMLVRGGMRTVQTIGVPTSNE
FT                   APGADALDADALVVALKSRTIPAADAVAQSLAALAWLRAQGCRQFFFKYCSTFDSTDAG
FT                   NIGPVTDALLNALSAEFAERASFTIACPAFPENGRTIFRGHLFVGDALLDESGMENHPL
FT                   TPMRDANLVRVLQRQTQSKVGLVRYDQVAQGDAAVRAAFEALRADGVRIAIADAVSDAD
FT                   LHTLGAACADLALITGGSGVALGLPANFRRAGLLGEQTHAAQLPRVEGLSAVLAGSASK
FT                   ATNAQVAAWCATRPAFRIDPLAAARGEDVVAEALEFAQQRFVHAEPVLIYATASPDEVQ
FT                   AVQRELGVNEAGHLVEKTLASIARGLRELGVRKFVVAGGETSGAVVQALDVHMLRIGAQ
FT                   IDPGVPATATTEAEPLALALKSGNFGTTDFFDKALRHLDGAAQ"
FT                   /protein_id="YP_003607023.1"
FT   misc_feature    306000..307286
FT                   /note="Protein of unknown function, DUF1537; Region:
FT                   DUF1537; cl01345"
FT                   /db_xref="CDD:154344"
FT                   /locus_tag="BC1002_3479"
FT   gene            307301..307963
FT                   /db_xref="GeneID:9112783"
FT                   /locus_tag="BC1002_3480"
FT   CDS_pept        307301..307963
FT                   /locus_tag="BC1002_3480"
FT                   /gene_family="HOG000218185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /codon_start="1"
FT                   /product="class II aldolase/adducin family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bpy:Bphyt_5929 putative aldolase"
FT                   /db_xref="GI:295699131"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="GeneID:9112783"
FT                   /translation="MSGAPALHSSAEARVREEICAVGASLYQRGYTVGSAGNISARLDD
FT                   GWLITPTDACLGRLDPADIAKVDANGHAMSGGKPSKTLALHRGIYARNGEARGIVHTHS
FT                   THLVALTLAGVWSEADVLPPITPYYVMKVGHVPLIRYQRPGDPQVAAQIAQLADRVRAV
FT                   LLERLGPVVWERSVAHASYALEELEETARLWLMTNPRPAPLDAAAIEELRAAFGARW"
FT                   /protein_id="YP_003607024.1"
FT   misc_feature    307337..307942
FT                   /note="Class II Aldolase and Adducin head (N-terminal)
FT                   domain. Aldolases are ubiquitous enzymes catalyzing central
FT                   steps of carbohydrate metabolism. Based on enzymatic
FT                   mechanisms, this superfamily has been divided into two
FT                   distinct classes (Class I and II)...; Region: Aldolase_II;
FT                   cl00214"
FT                   /db_xref="CDD:174038"
FT                   /locus_tag="BC1002_3480"
FT   misc_feature    order(307361..307363,307373..307375,307397..307399,
FT                   307463..307465,307469..307474,307607..307609,
FT                   307613..307618,307631..307639,307670..307672,
FT                   307676..307681,307721..307723,307799..307801,
FT                   307832..307834,307853..307855,307865..307867,
FT                   307886..307888)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29521"
FT                   /locus_tag="BC1002_3480"
FT   misc_feature    order(307412..307414,307454..307459,307538..307546,
FT                   307601..307603,307607..307609,307802..307804)
FT                   /note="active site"
FT                   /db_xref="CDD:29521"
FT                   /locus_tag="BC1002_3480"
FT   misc_feature    order(307601..307603,307607..307609,307802..307804)
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:29521"
FT                   /locus_tag="BC1002_3480"
FT   gene            308025..308825
FT                   /db_xref="GeneID:9112784"
FT                   /locus_tag="BC1002_3481"
FT   CDS_pept        308025..308825
FT                   /locus_tag="BC1002_3481"
FT                   /gene_family="HOG000218197" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.22"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.22"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2169 hydroxypyruvate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="GI:295699132"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="GeneID:9112784"
FT                   /translation="MPRFAANLSMMYNEHAFLDRFAAASRDGFNAVEFLFPYEFRAGEL
FT                   KSRLDAHGLTQALFNAPPGDWSVGERGLASLPGREDEFRRSIDTALEYARVLGNRKLHV
FT                   MAGLIAGDRAGETQRKTQRDVYLNNLVYSARVAQAEQITVVIEPINTRDMPGYFLNRQD
FT                   DAQAICAEVGAPNLKVQFDCYHCQIVEGDLAMKLKRDMAGIGHIQVAGVPERHEPDIGE
FT                   LNYPYLFDLIDALGYDGYIGCEYRPRAGTSAGLGWLKPYLDAPR"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /protein_id="YP_003607025.1"
FT   misc_feature    308025..308816
FT                   /note="Hydroxypyruvate isomerase [Carbohydrate transport
FT                   and metabolism]; Region: Hfi; COG3622"
FT                   /db_xref="CDD:33421"
FT                   /locus_tag="BC1002_3481"
FT   gene            308859..309839
FT                   /db_xref="GeneID:9112785"
FT                   /locus_tag="BC1002_3482"
FT   CDS_pept        308859..309839
FT                   /locus_tag="BC1002_3482"
FT                   /gene_family="HOG000218208" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bpy:Bphyt_5926 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:295699133"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112785"
FT                   /translation="MKVLITGGAGFLGQRLARELLARGVLKDAHGAPQTITGLVLLDVV
FT                   RAHDFGDARVRTEVGDIAERSVLERVIDDQTSAIFHLAAIVSGQAEADFDLGMRINLDA
FT                   SRLLLEVCRQRGHQPRVVFTSSVAVYGGDLPAVVQDDTALNPQSSYGAQKAIAELLLND
FT                   YSRRGFVDGRVLRLPTISVRPGRPNAAASSFASGIIREPLNGEEAVCPVAGSTRLWLLS
FT                   PRKAIDSLIAGLELDGAALGKQRAVNLPGLSVSVDEMIAALREVAGEKVAGRIVRQPDE
FT                   RIEKIVGSWPGAWDTSRAERLGLAAERDFADVIRGYIADEGIEVR"
FT                   /protein_id="YP_003607026.1"
FT   misc_feature    308859..309821
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="BC1002_3482"
FT   misc_feature    308871..>309413
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3482"
FT   gene            310208..311410
FT                   /db_xref="GeneID:9112786"
FT                   /locus_tag="BC1002_3483"
FT   CDS_pept        310208..311410
FT                   /locus_tag="BC1002_3483"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02430"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.174"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5925 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: beta-ketoadipyl CoA thiolase; acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="GI:295699134"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="GeneID:9112786"
FT                   /translation="MTEAFLCDAIRTPIGRYAGSLSSVRADDLGAVPLKALMERNKNVD
FT                   WSAIDDVIYGCANQAGEDNRNVARMSLLLAGLPKDVPGSTVNRLCGSGMDAVGIAARAI
FT                   KSGEAALMIAGGVESMSRAPFVMPKATSAFTRQNEVYDTTIGWRFVNPLMKKLYGVDSM
FT                   PETGENVATDYNISRADQDAFALRSQQKAARAQRDGTLAQEIVGVTIAQKKGDPITVTQ
FT                   DEHPRETSLEALAKLKGVVRPDGTVTAGNASGVNDGAAALLLANEETAKRFGLTPRARV
FT                   LGVATAGVEPRVMGIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGIAVLRALGVAD
FT                   DDPRVNPNGGAIALGHPLGMSGARLVTTATYQLQRTQGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /protein_id="YP_003607027.1"
FT   misc_feature    310208..311407
FT                   /note="beta-ketoadipyl CoA thiolase; Validated; Region:
FT                   PRK09050"
FT                   /db_xref="CDD:169632"
FT                   /locus_tag="BC1002_3483"
FT   misc_feature    310220..311404
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_3483"
FT   misc_feature    order(310274..310276,310358..310360,310403..310405,
FT                   310412..310414,310424..310426,310457..310468,
FT                   310490..310492,310511..310516,310523..310525,
FT                   310568..310570,311057..311059,311063..311065,
FT                   311069..311071,311129..311131,311372..311377)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_3483"
FT   misc_feature    order(310475..310477,311273..311275,311363..311365)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_3483"
FT   gene            complement(311558..312484)
FT                   /db_xref="GeneID:9112787"
FT                   /locus_tag="BC1002_3484"
FT   CDS_pept        complement(311558..312484)
FT                   /locus_tag="BC1002_3484"
FT                   /gene_family="HOG000079022" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /codon_start="1"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB0022 putative metal transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="GI:295699135"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="GeneID:9112787"
FT                   /translation="MTDNLIRKHEHSFLGSSHDENARRTRSVVALTVVMMIGEIAAGYM
FT                   TGSMALLADGFHMATHAGALGIAALAYAFARRNSANRAFSFGTGKVGELAGFASALILA
FT                   LVSLGIGIESAVRLVHPTGVAFGQAAVIAAIGLVVNIVSALLLSGGHAHHGSHDHDHHH
FT                   HHHGHAHGSDNNLRSAYVHVLADALTSVLAIVALLAGRYLGWVWLDPLMGIVGSIVIAR
FT                   WAWTLMRDTAGVLLDKTDEHVAGEIREILNSHGDAEIADLHVWQIGPEARAAIVSVRTH
FT                   GGVTADTIRARLAPVHEVMHLTVEAAS"
FT                   /protein_id="YP_003607028.1"
FT   misc_feature    complement(311570..312463)
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:174105"
FT                   /locus_tag="BC1002_3484"
FT   gene            complement(312492..312767)
FT                   /db_xref="GeneID:9112788"
FT                   /locus_tag="BC1002_3485"
FT   CDS_pept        complement(312492..312767)
FT                   /locus_tag="BC1002_3485"
FT                   /gene_family="HOG000023914" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF156"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bbr:BB0023 hypothetical protein"
FT                   /db_xref="GI:295699136"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:9112788"
FT                   /translation="MSHLSTHKDGLLKRVRRIAGQVQAIERSLESDADCEKVLHLVAAT
FT                   RGAMNGLLDEIVEAHAREHVAHPDLTANQRKKGVDALVGAIRRYSK"
FT                   /protein_id="YP_003607029.1"
FT   misc_feature    complement(312507..312746)
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="BC1002_3485"
FT   gene            312995..313570
FT                   /db_xref="GeneID:9112789"
FT                   /locus_tag="BC1002_3486"
FT   CDS_pept        312995..313570
FT                   /locus_tag="BC1002_3486"
FT                   /gene_family="HOG000058876" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5924"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5924 hypothetical protein"
FT                   /db_xref="GI:295699137"
FT                   /db_xref="GeneID:9112789"
FT                   /translation="MKTATKAAALIIAAAAASLACAQDDMASAAQAVLSAAQPVHMTAE
FT                   IVGIDAGNRSLTLKGSGGNVAIVLVSQQVAGFDQLKIGDRVDVLYKNALLTKAEKVSGA
FT                   GKGIRERADKQSYAPASGGYESARQTEVLATVLKIDHKQRLVTLRGAYQTQTFRAAPDV
FT                   DLSDVKVGDTLHAVFVSAAAVQVMPVGR"
FT                   /protein_id="YP_003607030.1"
FT   misc_feature    313394..313531
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:154873"
FT                   /locus_tag="BC1002_3486"
FT   gene            313842..314795
FT                   /db_xref="GeneID:9112790"
FT                   /locus_tag="BC1002_3487"
FT   CDS_pept        313842..314795
FT                   /locus_tag="BC1002_3487"
FT                   /gene_family="HOG000059007" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5916"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5916 hypothetical protein"
FT                   /db_xref="GI:295699138"
FT                   /db_xref="GeneID:9112790"
FT                   /translation="MARGALRKAVLGAAAAVLALGSASAFAWSGHGTAYTSRGVYNGAH
FT                   YGSCGGGSCSHAGSVAGPYGGFASNTGTVTRTAPGQFSNSGTATGRYGNTVQHSGDTSC
FT                   AGGTCSHTGTMTGPDGKTATTSGDVTRTAPGQYSSSGSITGSNGNTVNHSASTSCAGST
FT                   CARSGTVTGPDNNSVYHSGTATRVAPGVVTTSTSVTGTQGHTVTSSGTVVTDGVVVAGG
FT                   TTTTTGTTVVVAPKPVVVAPPPPPPPVVIPPPVVYVPPKPVVVTPPPAYVPPPPVVYVP
FT                   PPAVYVAPRPVYVAPRAAVWVPGHWVGRVWVPAHWV"
FT                   /protein_id="YP_003607031.1"
FT   gene            complement(315358..316566)
FT                   /db_xref="GeneID:9112791"
FT                   /locus_tag="BC1002_3488"
FT   CDS_pept        complement(315358..316566)
FT                   /locus_tag="BC1002_3488"
FT                   /gene_family="HOG000059061" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2114 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:295699139"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:9112791"
FT                   /translation="MTDRRVSPLRNLANFIRAERGRLTRQWMHAVANDVDLVEADKLTY
FT                   QQLADHLPEILDQLCGALDAEDLERAEPSIERDAKKHGNVRWQQGYRIEELVRELDLFE
FT                   QVLVEALEEFVERDRTCTRRHESRARRLIAEAFSVVTYASIKEVVGERDRKIDEYTSRL
FT                   ERANFELTRKQRLVGDLYDSRMHITRSVVHDLRNFLNAFSVALQLIERAPSQAEAALTL
FT                   ANRQAADMKQLVDQMVEYSVVLGDSATLVLEDVDLRELFDELVASTQPSIDAKGLALHS
FT                   AFDPALPVVTSNRLKLKQIAVNLLNNAIKYTKTGQVEFRFAMHGAEHWTIRVSDTGVGI
FT                   APADAERVFDEFERAAGEETPGTGLGLAIVRELCRVLDGQIEFASREGVGTTFEIRFPL
FT                   HVQ"
FT                   /protein_id="YP_003607032.1"
FT   misc_feature    complement(315361..316368)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="BC1002_3488"
FT   misc_feature    complement(315376..315678)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3488"
FT   misc_feature    complement(order(315388..315390,315394..315399,
FT                   315412..315414,315418..315420,315466..315477,
FT                   315547..315552,315556..315558,315562..315564,
FT                   315568..315570,315637..315639,315646..315648,
FT                   315658..315660))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3488"
FT   misc_feature    complement(315646..315648)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3488"
FT   misc_feature    complement(order(315469..315471,315475..315477,
FT                   315550..315552,315556..315558))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3488"
FT   gene            316784..317146
FT                   /db_xref="GeneID:9112792"
FT                   /locus_tag="BC1002_3489"
FT   CDS_pept        316784..317146
FT                   /locus_tag="BC1002_3489"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="manually curated; PFAM: response regulator receiver;
FT                   KEGG: bpy:Bphyt_5913 response regulator receiver protein;
FT                   SMART: response regulator receiver"
FT                   /db_xref="GI:295699140"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:9112792"
FT                   /translation="MMYSILLVDDEPEILAAWRLILESEGYEVSCASNGAEALACVVAH
FT                   VPDLIVTDWMMPIMDGAELCRRLKSMPLSVDVPILVHTAVPPPDSDAQYCSACLLKPIG
FT                   ADLFLTTIAQLCAPRC"
FT                   /protein_id="YP_003607033.1"
FT   misc_feature    316799..317128
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3489"
FT   misc_feature    order(316808..316813,316940..316942,316964..316966,
FT                   317030..317032,317075..317077,317084..317089)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3489"
FT   misc_feature    316940..316942
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3489"
FT   misc_feature    order(316949..316954,316958..316966)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3489"
FT   misc_feature    317084..317092
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3489"
FT   gene            complement(317176..318078)
FT                   /db_xref="GeneID:9112793"
FT                   /locus_tag="BC1002_3490"
FT   CDS_pept        complement(317176..318078)
FT                   /locus_tag="BC1002_3490"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_5912 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295699141"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112793"
FT                   /translation="MELNDLAAFVSVSRAGGFRDAARVSGVSASSLSVAVRRLETKLGL
FT                   RLLNRTTRSVAPTEAGLRLIEKLTPLFGEMEAALDVLNGFRDKPTGTLKLNVPSSVARI
FT                   VLPDVLARFLKQYPDIRVEVVVEDGFVDVLSIGCDAGIRYDERLEQDMIAVPIGARVQR
FT                   FATAASPAYLDAHGRPEHPSELLAHACLRGQFASGAMPTWYFERDGELLQLNPTGPLLV
FT                   RPGAAIDLAVSGAVAGLGVIHLFEDMLRPQLDSGALEAILEPWWQRFSGPFLYYPGHRH
FT                   VPAPLRAFVDFLKADSTRS"
FT                   /protein_id="YP_003607034.1"
FT   misc_feature    complement(317194..318078)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_3490"
FT   misc_feature    complement(317896..318072)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3490"
FT   misc_feature    complement(317200..317814)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_CrgA_like_5; cd08474"
FT                   /db_xref="CDD:176163"
FT                   /locus_tag="BC1002_3490"
FT   misc_feature    complement(order(317263..317265,317344..317346,
FT                   317395..317397,317593..317595,317605..317607,
FT                   317647..317649,317764..317766,317776..317778))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176163"
FT                   /locus_tag="BC1002_3490"
FT   misc_feature    complement(order(317368..317370,317377..317382,
FT                   317410..317424,317512..317514,317701..317721,
FT                   317725..317727,317737..317739,317746..317751,
FT                   317755..317760,317770..317775))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176163"
FT                   /locus_tag="BC1002_3490"
FT   gene            318186..319061
FT                   /db_xref="GeneID:9112794"
FT                   /locus_tag="BC1002_3491"
FT   CDS_pept        318186..319061
FT                   /locus_tag="BC1002_3491"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /codon_start="1"
FT                   /product="aldo/keto reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_B2112
FT                   putative oxidoreductase"
FT                   /db_xref="GI:295699142"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="GeneID:9112794"
FT                   /translation="MPNFSSIDTFVLAGRAVRRMGYGAMQLAGPGVFGPPKDRAAALAV
FT                   LREAVASGVDHIDTSDFYGPHVTNQVIREALHPYPRDLTIVTKVGAVRDSAGGWLPAQE
FT                   PADLERAVHDNLRNLGLDALDVVNLRVMGNVHAPSEGSIEKQVTALAELQQRGLVRHVG
FT                   LSNVTAAQIAEAQRITKVVCVQNHYNLVHRDDDALIDALAEQGIAYVPFFPLGGFTPIQ
FT                   SSELSELARTLEATPMQVALAWLLHRAPNILLIPGTSSVAHLRENLQSAQLKLSDEVLD
FT                   QLDAIGAEKG"
FT                   /protein_id="YP_003607035.1"
FT   misc_feature    318225..319043
FT                   /note="Aldo-keto reductases (AKRs) are a superfamily of
FT                   soluble NAD(P)(H) oxidoreductases whose chief purpose is to
FT                   reduce aldehydes and ketones to primary and secondary
FT                   alcohols. AKRs are present in all phyla and are of
FT                   importance to both health and...; Region: Aldo_ket_red;
FT                   cd06660"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_3491"
FT   misc_feature    order(318252..318260,318357..318359,318372..318374,
FT                   318447..318449,318591..318596,318678..318683,
FT                   318738..318740,318819..318836,318897..318899,
FT                   318948..318959,318972..318974,318981..318986)
FT                   /note="active site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_3491"
FT   misc_feature    order(318357..318359,318372..318374,318447..318449,
FT                   318591..318593)
FT                   /note="catalytic tetrad; other site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_3491"
FT   gene            complement(319062..319970)
FT                   /db_xref="GeneID:9112795"
FT                   /locus_tag="BC1002_3492"
FT   CDS_pept        complement(319062..319970)
FT                   /locus_tag="BC1002_3492"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_B2111 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295699143"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:9112795"
FT                   /translation="MSGIAVVNLRRLDLNLLVTLDVLLEEHNVTRAAERLNFSQPSVSV
FT                   HLAKLRDVFGDPLLLPGPRGMRPTAKAQELREPLREALDALQRAVAPTSPFDPAAATQT
FT                   WRIAATDYAESTIILPMLAGLRAVAPGTRLAIVEAVPPRLARQAEQGDIDLGFHTSEGA
FT                   PEGLRRRVLFAERYVLVGRAGHPKLKRRPTLAQFCKLEHVIVSPDGGGFFGVTDETLAK
FT                   AGLARKVVLSVPHFLFMQSVLASTDLVGMLPARLVRGSDTLRMVEPPVEVPGYAMAMLW
FT                   HERVHRDPAHQWLRDFIAASV"
FT                   /protein_id="YP_003607036.1"
FT   misc_feature    complement(319065..319898)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_3492"
FT   misc_feature    complement(319752..319898)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3492"
FT   misc_feature    complement(319068..319661)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator similar
FT                   to DntR, which is involved in the catabolism of
FT                   dinitrotoluene; contains the type 2 periplasmic binding
FT                   fold; Region: PBP2_DntR_like_3; cd08461"
FT                   /db_xref="CDD:176150"
FT                   /locus_tag="BC1002_3492"
FT   misc_feature    complement(order(319140..319142,319332..319334,
FT                   319446..319448,319620..319622,319632..319637,
FT                   319641..319643))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:176150"
FT                   /locus_tag="BC1002_3492"
FT   misc_feature    complement(order(319194..319196,319236..319238,
FT                   319245..319250,319257..319262,319269..319283,
FT                   319368..319370,319557..319559,319563..319577,
FT                   319581..319586,319593..319598,319602..319607,
FT                   319614..319619,319626..319631,319638..319640))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176150"
FT                   /locus_tag="BC1002_3492"
FT   gene            320041..320865
FT                   /db_xref="GeneID:9112796"
FT                   /locus_tag="BC1002_3493"
FT   CDS_pept        320041..320865
FT                   /locus_tag="BC1002_3493"
FT                   /gene_family="HOG000149970" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.6.5.2"
FT                   /codon_start="1"
FT                   /EC_number="1.6.5.2"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2110 NAD(P)H dehydrogenase (quinone);
FT                   PFAM: NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="GI:295699144"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="GeneID:9112796"
FT                   /translation="MNVLIIYAHPEPKSLNGSLKDFAVRHLERAGHTVQVSDLYAMNWK
FT                   ASLDAHDTSERHSAERFFASLESKHAFENGLQSEDIAREQDKLKWADAVILQFPLWWFS
FT                   MPAIMKGWVERVYAYGLAYGVGEHSDARWGERYGEGRFAGKRAMLVVTTGGWESHYSAR
FT                   GINGPIDDVLFPIQHGVLYYPGFDVLPPFVVYRTSRVDDAKYAEVSEALGRRLDTLWTT
FT                   TPIAFRPQNGGAYEIPALTLRDDLAPGQIGFAVHVEEAGVEAATQAAEAAEA"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /protein_id="YP_003607037.1"
FT   misc_feature    320041..320697
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="BC1002_3493"
FT   gene            321022..321876
FT                   /db_xref="GeneID:9112797"
FT                   /locus_tag="BC1002_3494"
FT   CDS_pept        321022..321876
FT                   /locus_tag="BC1002_3494"
FT                   /gene_family="HOG000217869" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /codon_start="1"
FT                   /product="putative esterase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative esterase; KEGG: bxe:Bxe_B2109
FT                   putative esterase"
FT                   /db_xref="GI:295699145"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="GeneID:9112797"
FT                   /translation="MNPVRTFWLILILIASPAWAFQSRVVTIPSAAMHRTFDATVVLPD
FT                   QYARGNQAARFPVVYVLHGSGGDYTDWTANSHIGKLADRYQMILVMPDGGRDSWYIDSP
FT                   VDPRSRYETYVGTEVVGYIDGHFRTIATRQARAITGLSMGGFGALRIALDMPDAFGAAG
FT                   SISGAVDPRSSEDEPGIERVFGDPSQHADFWDSQAIVANAEDFGRDHIALTIDCGVNDS
FT                   LVQSNRLLHERLVELGVPHDYAERPGGHTWKYWSNAVKYQVLFFAGTFRQAAREMRDAR
FT                   AAA"
FT                   /protein_id="YP_003607038.1"
FT   misc_feature    321109..321786
FT                   /note="Putative esterase; Region: Esterase; pfam00756"
FT                   /db_xref="CDD:144380"
FT                   /locus_tag="BC1002_3494"
FT   misc_feature    321142..321684
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_3494"
FT   gene            complement(321899..323191)
FT                   /db_xref="GeneID:9112798"
FT                   /locus_tag="BC1002_3495"
FT   CDS_pept        complement(321899..323191)
FT                   /locus_tag="BC1002_3495"
FT                   /gene_family="HOG000022685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /codon_start="1"
FT                   /EC_number="2.1.3.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; KEGG:
FT                   bxe:Bxe_B2108 aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="GI:295699146"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="GeneID:9112798"
FT                   /translation="MSVPQQAFLRDAMRRLNMTRDTFANRIGVSRRALDTWLLPDDSQE
FT                   SRAMPEIVERFVSEIVANTEPGEGYTQSVDSQSLASQMLFEGKPQLLSVDQFSRDSVEA
FT                   LFRVADIMQPIARRRKISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFT
FT                   FSSMAKGESIYDTSRVMSGYVDALVIRHPEQGSVAEFARATNVPVINGGDGPGEHPSQA
FT                   LLDLYTIQREFSRLGKIVDGAHIALVGDLKYGRTVHSLVKLLALYRGIKFTLISPPMLE
FT                   MPGYIIEQISRNGHVIEQTHDLRTGLRGADVVYATRIQKERFTDESFEGYTPDFQINQA
FT                   LVDSMCGADTLIMHPLPRDSRPGANDLSTDLNHDSRLAIFRQTDNGIPVRMAIFAVLLG
FT                   VDKQVQHSMRDATWRPPVYLGPDDAVFHGID"
FT                   /product="aspartate carbamoyltransferase"
FT                   /protein_id="YP_003607039.1"
FT   misc_feature    complement(321902..323188)
FT                   /note="aspartate carbamoyltransferase; Provisional; Region:
FT                   PRK11891"
FT                   /db_xref="CDD:171326"
FT                   /locus_tag="BC1002_3495"
FT   misc_feature    complement(322496..322921)
FT                   /note="Aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
FT                   /db_xref="CDD:145728"
FT                   /locus_tag="BC1002_3495"
FT   misc_feature    complement(322001..322471)
FT                   /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
FT                   binding domain; Region: OTCace; pfam00185"
FT                   /db_xref="CDD:143948"
FT                   /locus_tag="BC1002_3495"
FT   gene            323630..324538
FT                   /db_xref="GeneID:9112799"
FT                   /locus_tag="BC1002_3496"
FT   CDS_pept        323630..324538
FT                   /locus_tag="BC1002_3496"
FT                   /gene_family="HOG000173604" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /codon_start="1"
FT                   /product="dihydrodipicolinate synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2107 dihydrodipicolinate synthase
FT                   family protein; TIGRFAM: dihydrodipicolinate synthase;
FT                   PFAM: dihydrodipicolinate synthetase"
FT                   /db_xref="GI:295699147"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="GeneID:9112799"
FT                   /translation="MSDFSGIWIPLITPFADDAVDHAALRALVSRYADAGVAGLVALGT
FT                   TGEPATLDAAEQDAVLATILDAAQALANAANATDAQRRPLPVLVGVSGNHTASMRARIE
FT                   QLNPLPIAGVLIAAPYYTRPAQDGIVAHFSALADASAHPVVLYDIPQRTGVRLELDTLL
FT                   TLAAHPRIQAIKDCAGSLDTTLALIRDGRLQVLAGNDIEVFSTLCAGGSGAIAASAHWR
FT                   PERFVALYQALTEGRLDEGRRIFHALVPQIQLAFAEPNPAPVKALLAAVGWVRNELRLP
FT                   MTRASEALTERLAALGETPLR"
FT                   /protein_id="YP_003607040.1"
FT   misc_feature    323639..324517
FT                   /note="Dihydrodipicolinate synthase (DHDPS) is a key enzyme
FT                   in lysine biosynthesis. It catalyzes the aldol condensation
FT                   of L-aspartate-beta- semialdehyde and pyruvate to
FT                   dihydropicolinic acid via a Schiff base formation between
FT                   pyruvate and a lysine residue...; Region: DHDPS; cd00950"
FT                   /db_xref="CDD:29943"
FT                   /locus_tag="BC1002_3496"
FT   misc_feature    323660..324514
FT                   /note="dihydrodipicolinate synthase; Region: dapA;
FT                   TIGR00674"
FT                   /db_xref="CDD:129757"
FT                   /locus_tag="BC1002_3496"
FT   misc_feature    order(323759..323773,323909..323911,323915..323917,
FT                   323984..323992,324077..324079,324083..324085,
FT                   324407..324412,324464..324466,324470..324472)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29943"
FT                   /locus_tag="BC1002_3496"
FT   misc_feature    order(323762..323767,324068..324070,324083..324085,
FT                   324152..324154,324221..324223,324227..324229)
FT                   /note="active site"
FT                   /db_xref="CDD:29943"
FT                   /locus_tag="BC1002_3496"
FT   misc_feature    324152..324154
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29943"
FT                   /locus_tag="BC1002_3496"
FT   gene            complement(324531..326615)
FT                   /db_xref="GeneID:9112800"
FT                   /locus_tag="BC1002_3497"
FT   CDS_pept        complement(324531..326615)
FT                   /locus_tag="BC1002_3497"
FT                   /gene_family="HOG000136246" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with MHYT
FT                   sensor"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; MHYT domain
FT                   protein; KEGG: bpy:Bphyt_5894 diguanylate
FT                   cyclase/phosphodiesterase; SMART: EAL domain protein; GGDEF
FT                   domain containing protein"
FT                   /db_xref="GI:295699148"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="GeneID:9112800"
FT                   /translation="MHSSYNLWLVAISFAVATLASYTALDLTGRIFLLASARRRQAWRL
FT                   GGALALGVGIWSMHFVAMLAFSLPIPLGYDLGLTAYSLALAIGASYLALFLTTQQRLTP
FT                   ARLLAGGAVMGIGIAGMHYTGMAALRMAPAIHYQPVWFAASVAIAIGASSAALWMARAL
FT                   SNEHERHIARKRLAAALVMGVAISGMHYTAMAAADFAPGAICGAASDMDAQWLATAVIL
FT                   LTFAVLIVTLMLSRFDVRTTFLLGAVSKLNGQIVRLATLDALTGLPNRATLTERIERAI
FT                   SGARRQRTSFAVLFMDLDGFKTINDSLGHSAGDAVLSAFAQRLQQCVRSSDTVARLGGD
FT                   EFVVLAEHLTSGDDAAALADGVLERMRQGTWSDEQPLQVMPSIGIALYPRDGDSVETLL
FT                   QHADAAMYEAKRAGRGTYRFFERSMNEAATRTLQIQQVLHDAFANERFSLVFQPKFQRG
FT                   GDALAGAEALIRLHDPELGTLTPAEFIPVAERSGQIVQIGYWVVRETCRRIRGWIEQGL
FT                   PAMKVAINLSPRQLLQPDLVETILEIVRTEGVACEQIMFEITESVAMQDAARTVDVIRA
FT                   FQASGFDISIDDFGTGYSSLAYLQRFQVKQLKIDRFFTHGLDANGAAGSAIVSAIIALA
FT                   HSLEMDVVAEGVETQSQLDKLRSMMCDEMQGYLLGKPVSAEDFGAMLRSRMIAASGVSI
FT                   "
FT                   /protein_id="YP_003607041.1"
FT   misc_feature    complement(325920..326615)
FT                   /note="MHYT domain (predicted integral membrane sensor
FT                   domain) [Signal transduction mechanisms]; Region: COG3300"
FT                   /db_xref="CDD:33109"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(326292..326462)
FT                   /note="Bacterial signalling protein N terminal repeat;
FT                   Region: MHYT; pfam03707"
FT                   /db_xref="CDD:112517"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(325362..325832)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(order(325596..325598,325725..325727))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(order(325593..325604,325608..325610,
FT                   325674..325676,325686..325688,325698..325703,
FT                   325710..325712))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(order(325533..325535,325620..325622))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="BC1002_3497"
FT   misc_feature    complement(324585..325304)
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="BC1002_3497"
FT   gene            complement(326769..327224)
FT                   /db_xref="GeneID:9112801"
FT                   /locus_tag="BC1002_3498"
FT   CDS_pept        complement(326769..327224)
FT                   /locus_tag="BC1002_3498"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4349 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="GI:295699149"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9112801"
FT                   /translation="MTHDNLTTAANAVTAIPAADSADAIAHFHASLRFETDCADVHAAL
FT                   ASGAPGFVLLDVRSPALFAQGHVPGALNLPHGKIVASKLAAYAPDTLFVTYCAGPHCNG
FT                   AARGALRLAQLGRPVKLMTGGVTGWLDEGFALSRQDADPSSDPRSAA"
FT                   /protein_id="YP_003607042.1"
FT   misc_feature    complement(326817..327131)
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_3498"
FT   misc_feature    complement(326934..326936)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_3498"
FT   gene            327332..328291
FT                   /db_xref="GeneID:9112802"
FT                   /locus_tag="BC1002_3499"
FT   CDS_pept        327332..328291
FT                   /locus_tag="BC1002_3499"
FT                   /gene_family="HOG000063192" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5890 transcriptional activator FtrA;
FT                   PFAM: ThiJ/PfpI domain protein; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="GI:295699150"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:9112802"
FT                   /translation="MHNHLVVALAYDRLCTFEFGCVTELFALERPELGVPWYRFAVCAG
FT                   EPGPIRAAGGITLAAPYTLRLLASADTIVIPGWRDADEVPPAALLRRLRAAYERGARLC
FT                   SICSGVFVLAAAGVLDGKTVTTHWRYADKLQQRYPQLRVQPDALYVDEGQVITSAGSAA
FT                   GLDMLLHLVRRDHGSAVANRVAQRLVVPPHREGGQAQFVPRPMPHDESGRIAKLMDWVR
FT                   SHAAEPHTLHSLAGRAAMSPRTLQRQFRDATGMAPYEWLVRERVALARELLEAATPLPM
FT                   ARVAELAGFGSEESLRRHFRRIALTSPGAYRRRFGGEG"
FT                   /protein_id="YP_003607043.1"
FT   misc_feature    327332..328288
FT                   /note="transcriptional activator FtrA; Provisional; Region:
FT                   ftrA; PRK09393"
FT                   /db_xref="CDD:169832"
FT                   /locus_tag="BC1002_3499"
FT   misc_feature    327347..327904
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_1; cd03137"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="BC1002_3499"
FT   misc_feature    327650..327652
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153231"
FT                   /locus_tag="BC1002_3499"
FT   gene            complement(328340..328825)
FT                   /db_xref="GeneID:9112803"
FT                   /locus_tag="BC1002_3500"
FT   CDS_pept        complement(328340..328825)
FT                   /locus_tag="BC1002_3500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psa:PST_0927 putative acyltransferase"
FT                   /db_xref="GI:295699151"
FT                   /db_xref="GeneID:9112803"
FT                   /translation="MAFAGASAMWWTWFGESILDIANPVWQFRLDAYGADTVDERLDLA
FT                   FGLSLLVAAVAVSGLLAYGYRQWVRSTGSNFDFYASLLAFDATALLLLANAFWWFEYMS
FT                   SVINASHPLWTWLKSTYGADRAYRLLDWAFPATSIAILAFVMSGTCYAIASHRRSLV"
FT                   /protein_id="YP_003607044.1"
FT   gene            complement(328864..329306)
FT                   /db_xref="GeneID:9112804"
FT                   /locus_tag="BC1002_3501"
FT                   /pseudo
FT   gene            329591..330808
FT                   /db_xref="GeneID:9112805"
FT                   /locus_tag="BC1002_3502"
FT   CDS_pept        329591..330808
FT                   /locus_tag="BC1002_3502"
FT                   /gene_family="HOG000001443" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10009"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF2252"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2252; KEGG:
FT                   bpy:Bphyt_5889 hypothetical protein"
FT                   /db_xref="GI:295699152"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="GeneID:9112805"
FT                   /translation="MSDIAKIIASFNAGRDPERLAMKYKAMRGSPFVFLRGTCHLFYQR
FT                   LPRTNVLDDAPHVWICGDMHFENFGSYKGDNRLVYFDNNDFDEACLAPAPYELVRLLTS
FT                   VLVGAADLKLSRAEALALCHTALDAYGAALAYGKSRWIEAETATGMVRDLFVALASRTR
FT                   AAHLDRRTVLKGKTRMLKVDGKKALPVSDERRAAVVQFMQQFAATEPNPDFYRTLDVAR
FT                   RIAGTGSLGVDRYVILVEGKGSPDGNYLIDLKQALSSSVSAHVTATQPQWQTEAQRVVE
FT                   VQRRNQAVSQAFLHAVEFNQRSYVLRSLQPSEDRVALADWDGKLPRLAAVINSMAELSA
FT                   WAHLRSGGRQKSAIADDLIAFGSRRDWQLPLIDLATQCEAQVAADWKAYCEAYDRGSFE
FT                   AGGAGE"
FT                   /protein_id="YP_003607045.1"
FT   misc_feature    329633..330766
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2252); Region: DUF2252; cl12088"
FT                   /db_xref="CDD:159748"
FT                   /locus_tag="BC1002_3502"
FT   gene            complement(330995..332473)
FT                   /db_xref="GeneID:9112806"
FT                   /locus_tag="BC1002_3503"
FT   CDS_pept        complement(330995..332473)
FT                   /locus_tag="BC1002_3503"
FT                   /gene_family="HOG000117912" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /codon_start="1"
FT                   /product="anion transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: bay:RBAM_007730 YflS; TIGRFAM: anion
FT                   transporter; PFAM: sodium/sulphate symporter"
FT                   /db_xref="GI:295699153"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="GeneID:9112806"
FT                   /translation="MAPTPAKVSQPTSSPPATPKPSVGLPAGIWKYLVPIAIGLVLWFL
FT                   PAPAGLQPKAWHMFAVFVATIAGIMTAPLPMSVVAIIGSTIGVLVGVLTFADVTRSTGT
FT                   DLVWLVMLAFFISRGVIKTGLGRRIALLFMRSLGKRTTGLGYGLVLTELVISPAMPSIT
FT                   ARAGGVMLPITRAISEVLGSHADDPESRAKVGRYLILCAFHANIITAGMFITAMAGNPL
FT                   VVKLAADQGVSISWLDWALAASIPGLLCLAVIPIAMLWIAPPHVRRTPDATDLAQRELA
FT                   TMGSISVKEIIMACIFVGLLVLWVFGDDIGIGATLAAAIGVSLLFISGVLTWQDALNEK
FT                   SAWDTMIWIGLLIMLASKLNEYGMVAWFGKEFGAHLAGFPMLAVYMLVAAIYVYIHYFF
FT                   ASATAHISALFPLSMALMVAAGVPPFVAAVSLGILSNVNGCLTQYGIGSGPVMFGAGYV
FT                   TQGEWWKAGFLMSLFYMVAWLVVGPLWWKVLGHV"
FT                   /protein_id="YP_003607046.1"
FT   misc_feature    complement(331004..332386)
FT                   /note="Di- and tricarboxylate transporters [Inorganic ion
FT                   transport and metabolism]; Region: CitT; COG0471"
FT                   /db_xref="CDD:30819"
FT                   /locus_tag="BC1002_3503"
FT   misc_feature    complement(331016..332278)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3503"
FT   misc_feature    complement(order(331022..331060,331133..331192,
FT                   331262..331303,331322..331327,331397..331453,
FT                   331493..331537,331559..331597,331691..331735,
FT                   331808..331819,331832..331891,331931..331984,
FT                   331988..332002,332009..332044,332111..332164,
FT                   332207..332248,332267..332278))
FT                   /note="transmembrane helices; other site"
FT                   /db_xref="CDD:29728"
FT                   /locus_tag="BC1002_3503"
FT   gene            complement(332526..333473)
FT                   /db_xref="GeneID:9112807"
FT                   /locus_tag="BC1002_3504"
FT   CDS_pept        complement(332526..333473)
FT                   /locus_tag="BC1002_3504"
FT                   /gene_family="HOG000213793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00056"
FT                   /codon_start="1"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   geo:Geob_0424 L-lactate dehydrogenase"
FT                   /db_xref="GI:295699154"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112807"
FT                   /translation="MRQAKIVIVGAGLVGGSAALFVALAIPSAKVVIIDVARVRAEGQA
FT                   LDLAHAAAFWGHSRFRAGDYEDARDADIVVITAGAGVKPGETRLHLAKTNADIATEIVG
FT                   RIAPLAPEAIYLIATNPCDVLTGAVYDQLRCERERVISTGTSLDTGRLRSLLSERFGVV
FT                   ASAIHAYVLGEHGESAVIQWSAATVCGMPLETFLTRNGKELGPASRDLILRSVHEAAKL
FT                   IKEGKGATHYGIASAIGRICEAIVHDTDLILTVGIVEPEVEGVPDVCVSLPMVVNGAGA
FT                   RLIAYPELDPIEREALLGSARIVKEATESVLHER"
FT                   /protein_id="YP_003607047.1"
FT   misc_feature    complement(332541..333383)
FT                   /note="NAD-dependent, lactate dehydrogenase-like,
FT                   2-hydroxycarboxylate dehydrogenase family; Region:
FT                   LDH_MDH_like; cl11406"
FT                   /db_xref="CDD:159429"
FT                   /locus_tag="BC1002_3504"
FT   misc_feature    complement(332556..333383)
FT                   /note="L-lactate dehydrogenase; Region: L-LDH-NAD;
FT                   TIGR01771"
FT                   /db_xref="CDD:162525"
FT                   /locus_tag="BC1002_3504"
FT   misc_feature    complement(order(332772..332774,332949..332951,
FT                   333033..333035,333045..333047,333114..333122,
FT                   333180..333182,333240..333245,333366..333371))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133419"
FT                   /locus_tag="BC1002_3504"
FT   misc_feature    complement(order(332754..332756,332766..332768,
FT                   332994..332996,333012..333017,333021..333026,
FT                   333321..333329,333333..333338,333342..333344,
FT                   333354..333356))
FT                   /note="LDH/MDH dimer interface; other site"
FT                   /db_xref="CDD:133419"
FT                   /locus_tag="BC1002_3504"
FT   misc_feature    complement(order(332949..332951,333021..333023,
FT                   333114..333116))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:133419"
FT                   /locus_tag="BC1002_3504"
FT   gene            complement(333576..334076)
FT                   /db_xref="GeneID:9112808"
FT                   /locus_tag="BC1002_3505"
FT   CDS_pept        complement(333576..334076)
FT                   /locus_tag="BC1002_3505"
FT                   /gene_family="HOG000221579" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2092 hypothetical protein"
FT                   /db_xref="GI:295699155"
FT                   /db_xref="GeneID:9112808"
FT                   /translation="MQQVLGQGFYGADYALTTNIQRDGHARRVDCNARLWRDAMNEQAI
FT                   REALNTHWRASADGDLDAEHTIYADDAICDYPQSGERIHGRINLQALRGHHPGKPSGFA
FT                   IRRIQGEGNLWITEYTINYQGRIAYTVSVMEFREGKVVHETQYFADPFEAPDWRSQWVE
FT                   RTA"
FT                   /protein_id="YP_003607048.1"
FT   gene            complement(334107..335099)
FT                   /db_xref="GeneID:9112809"
FT                   /locus_tag="BC1002_3506"
FT   CDS_pept        complement(334107..335099)
FT                   /locus_tag="BC1002_3506"
FT                   /gene_family="HOG000160813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bgl:bglu_2g05060 transcriptional regulator,
FT                   AraC family protein; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="GI:295699156"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:9112809"
FT                   /translation="MKAAFEHVDFGRDCSVRVYHRRLPRIPFEWHHHPEYELTLTMNSQ
FT                   GKRYIGDSVATYGADDLVLVPPNLPHTWASNRSIDAAHPQVAIVVWFDGAWLRRLADVC
FT                   PEYNGLCDLLRRAACGLAFEDGAGTRMREHLDRLLSDKPRERLQAVLDVLDLLSTLPAT
FT                   PLASPSAFDVQTGAATGHESDQLNRALALIETQFAHPLRLSALAKASGLSERSLTRHFT
FT                   QHLGESVGRYVTRVRIGHACRMLTDTQAPISVIATRSGFANVANFNRQFKAAKDMTPVE
FT                   FRQQFAGARRAEQQMSPRLTERSPSLQRLRNKGDSKRMSRPSRAGRQSG"
FT                   /protein_id="YP_003607049.1"
FT   misc_feature    complement(334683..335057)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_3506"
FT   misc_feature    complement(334230..>334562)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="BC1002_3506"
FT   gene            335195..336439
FT                   /db_xref="GeneID:9112810"
FT                   /locus_tag="BC1002_3507"
FT   CDS_pept        335195..336439
FT                   /locus_tag="BC1002_3507"
FT                   /gene_family="HOG000160924" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07350"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1479"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1479; KEGG:
FT                   bpy:Bphyt_0861 protein of unknown function DUF1479"
FT                   /db_xref="GI:295699157"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="GeneID:9112810"
FT                   /translation="MALHINDLPAAIRQAKRELRAMLPNYRDVFADVEAAMTKEAERIA
FT                   TLRDRGEPVIPEIQFADIVANRVTDAQISLVKTRGACVIRKVFDRSLVEQWDQDIADYV
FT                   ERNDLDAKLLNRAEDKYFGQLASSRPQIYGVYWSKPQVLARQSRELTRARVFLNRLWRT
FT                   ESEGRVHFDPNHVPVYADRLRRRPPGSESLGLSAHCDGGSVERWIEPNFRKVYRHVFSG
FT                   HWRDYDPFDAAWRTEVEEIASPAVCSMFRTFQGWTALTPQGPGDGTLQLVPMANSMIYV
FT                   LLRALQDDVAEDDLCGAMPGRALSIKSAYHAPLFHALSSIPLMQAGDTVFWHSDVIHAV
FT                   EDAHRGNGYSNVMYIASLPACAKNDAYLKRQLPSFLEGRSPPDFPADHFEVDFVGRATA
FT                   DDLTELGRSQMGFDL"
FT                   /protein_id="YP_003607050.1"
FT   misc_feature    335213..336430
FT                   /note="Protein of unknown function (DUF1479); Region:
FT                   DUF1479; pfam07350"
FT                   /db_xref="CDD:148770"
FT                   /locus_tag="BC1002_3507"
FT   gene            336521..336676
FT                   /db_xref="GeneID:9112811"
FT                   /locus_tag="BC1002_3508"
FT   CDS_pept        336521..336676
FT                   /locus_tag="BC1002_3508"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:YALI0B18216g"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: YALI0B18216p"
FT                   /db_xref="GI:295699158"
FT                   /db_xref="GeneID:9112811"
FT                   /translation="MATSPNKDENPLRPDQSDVVQTDLPDIGPSQDPDEPPLDPDIDPD
FT                   REDDKP"
FT                   /protein_id="YP_003607051.1"
FT   gene            complement(337272..337562)
FT                   /db_xref="GeneID:9112812"
FT                   /locus_tag="BC1002_3509"
FT   CDS_pept        complement(337272..337562)
FT                   /locus_tag="BC1002_3509"
FT                   /gene_family="HOG000290460" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ypb:YPTS_1942 hypothetical protein"
FT                   /db_xref="GI:295699159"
FT                   /db_xref="GeneID:9112812"
FT                   /translation="MEVLSWQESLIAKLRMRMTALRRLFKVELFIGLFLLSARLIGRNG
FT                   PMPESEALRWLSIANGLGLHEADDVYVPVMLTVWLIVAAVTYLAIMRLCRV"
FT                   /protein_id="YP_003607052.1"
FT   gene            complement(337514..337794)
FT                   /db_xref="GeneID:9112813"
FT                   /locus_tag="BC1002_3510"
FT                   /pseudo
FT   gene            complement(337775..337985)
FT                   /db_xref="GeneID:9112814"
FT                   /locus_tag="BC1002_3511"
FT                   /pseudo
FT   gene            complement(338000..338335)
FT                   /db_xref="GeneID:9112815"
FT                   /locus_tag="BC1002_3512"
FT   CDS_pept        complement(338000..338335)
FT                   /locus_tag="BC1002_3512"
FT                   /gene_family="HOG000162425" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0371"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: bpy:Bphyt_0371 hypothetical
FT                   protein"
FT                   /db_xref="GI:295699160"
FT                   /db_xref="GeneID:9112815"
FT                   /translation="MKRYLLVLSLSLPGICLASPSCASWPTNMALVHLKNAGITDPTKI
FT                   DESKTKAVRLASEKVGKDLYRQIYDITFIEKNGPRIEVITSSEASAQECSMSGVDVFVV
FT                   SRRLGGP"
FT                   /protein_id="YP_003607053.1"
FT   gene            complement(338332..338709)
FT                   /db_xref="GeneID:9112816"
FT                   /locus_tag="BC1002_3513"
FT   CDS_pept        complement(338332..338709)
FT                   /locus_tag="BC1002_3513"
FT                   /gene_family="HOG000061122" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0372"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_0372 hypothetical protein"
FT                   /db_xref="GI:295699161"
FT                   /db_xref="GeneID:9112816"
FT                   /translation="MVWTYSQKSGQLWHNDAPIAGGNASGYSGKGAGKNNPIMQAKSST
FT                   GPIPRGEYRITEPFNHAHAGRYTLRLEPAIGTQTFGRSGFMIHGDSLKNPGNASEGCII
FT                   FPLLIRQRIWNSGDTLLEVVQ"
FT                   /protein_id="YP_003607054.1"
FT   misc_feature    complement(338395..338631)
FT                   /note="Protein of unknown function (DUF2778); Region:
FT                   DUF2778; pfam10908"
FT                   /db_xref="CDD:151355"
FT                   /locus_tag="BC1002_3513"
FT   gene            complement(338794..338988)
FT                   /db_xref="GeneID:9112817"
FT                   /locus_tag="BC1002_3514"
FT   CDS_pept        complement(338794..338988)
FT                   /locus_tag="BC1002_3514"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ctu_08770"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctu:Ctu_08770 hypothetical protein"
FT                   /db_xref="GI:295699162"
FT                   /db_xref="GeneID:9112817"
FT                   /translation="MAYTGKFLVNNAPLSPLTINGIGRFDAYSGDGPYLNRCAQRHAVA
FT                   ENLTRKTPAPPTRRARTPI"
FT                   /protein_id="YP_003607055.1"
FT   gene            339383..340801
FT                   /db_xref="GeneID:9112818"
FT                   /locus_tag="BC1002_3515"
FT   CDS_pept        339383..340801
FT                   /locus_tag="BC1002_3515"
FT                   /gene_family="HOG000088630" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: bpy:Bphyt_5888
FT                   beta-galactosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="GI:295699163"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="GeneID:9112818"
FT                   /translation="MVNNASAVVDAEQPPTHGDPHSDPFTPPADSSLWRQDFLLGAATA
FT                   SYQIEGAINEDGRLPSIWDTFSATPGKVLAGDTGAVACDHYHRWEQDVDLLAGLGLEAY
FT                   RLSTAWPRVMDENGAPNQKGLDFYKRLLGRLKEKNITTFVTLYHWDLPQHLEDRGGWLN
FT                   RETAYRFVDYADLMSRELHGFVDAWATLNEPWCSAYLGYGNGHHAPGLSNVRFAAQAMH
FT                   HLLLAHGLAIPVLRANDPRSHKGIVANVGRGTPNSNSAADRRAAELFEVQHNAWILDPL
FT                   FKGEYPQDLVELWPGSEPLVLEGDMQTINTPLDFLGINYYFRTNVASDGGHGFKDVPLE
FT                   GVERTQMGWEVYPDGLRDLLIGFKDTYVNLPPIYITENGMASDDKVIDGRVEDTQRISF
FT                   LKRHLAAVDQAIKAGVDVRGYFLWSLMDNFEWAFGYERRFGIVHVDYQTQKRTIKRSAE
FT                   LVSKFLEDRKAQAQ"
FT                   /product="beta-galactosidase"
FT                   /protein_id="YP_003607056.1"
FT   misc_feature    339482..340756
FT                   /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
FT                   cl01046"
FT                   /db_xref="CDD:174504"
FT                   /locus_tag="BC1002_3515"
FT   gene            340896..342134
FT                   /db_xref="GeneID:9112819"
FT                   /locus_tag="BC1002_3516"
FT   CDS_pept        340896..342134
FT                   /locus_tag="BC1002_3516"
FT                   /gene_family="HOG000244069" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bpy:Bphyt_5887 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="GI:295699164"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9112819"
FT                   /translation="MNSNRMVLRGVVAALALYGVVAHAEPLKANVIHWWTSGGESAAIR
FT                   QFAVAYDKAGGQWVDNAVAGGDQARATAINRIVGGDPPTAAQFNTSKQFHDLIDQGLLN
FT                   NVDDVAAKENWSGIFPQSILDSIRVKGHFYAAPVDIHMPAWFFYSKPVFQKAGIASEPK
FT                   SYDEFIADLGKLKSAGVIPLAFGGQPWQEKITFDAVLADVGGPDLYMKVYRDHDQNAVN
FT                   SEAFKKVLVSFKKLHDFVDPGSPGRNWNDATALVTSGKAGVQIMGDWAKGEFVAANQTA
FT                   GKDFGCFPGFGPRSPYLVAGDVFVFPKTDSASAIKAQNLLATVMTSPSAQVAFSAKKGS
FT                   IPIRSDIDESSLDVCAKEGIAIMKDKSRQLPNPEMLLSPDTQGALTDVVTNFWNKNQSV
FT                   DDAQKAFASALKG"
FT                   /protein_id="YP_003607057.1"
FT   misc_feature    340986..342128
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="BC1002_3516"
FT   misc_feature    <341286..>341753
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_3516"
FT   gene            342143..343099
FT                   /db_xref="GeneID:9112820"
FT                   /locus_tag="BC1002_3517"
FT   CDS_pept        342143..343099
FT                   /locus_tag="BC1002_3517"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_5886
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295699165"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9112820"
FT                   /translation="MHALKLPAEGSNPQGKSQPRPRNKPLNRRFSIAVWLALLPMLLTV
FT                   VFTYLGTMVWTARVSLSNSRTFPSNDFAGLTQYVRLFHNDRWLMSLQNIVIYGACFIIA
FT                   CMVIGLLLAIFIDQRVVAEGALRTVFLYPYAMSFVATGLVWQWILNPSLGAQQVLRNLG
FT                   FAHARFDWIVDQDWVIYTIVIATVWQASGLVMALLLAGLRGIDEELWKAARIDGIPRWR
FT                   VYASIVVPMLGPSISTAFVLLFVMVVKLYDAVVAMTQGGPGTASEVPAKFIMDYLFGRA
FT                   NIGLASAASIVLLATVLAVLTPFFYARSRAALRGERG"
FT                   /protein_id="YP_003607058.1"
FT   misc_feature    342413..342940
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3517"
FT   misc_feature    order(342461..342466,342473..342478,342491..342493,
FT                   342518..342529,342533..342562,342569..342574,
FT                   342578..342580,342701..342706,342710..342712,
FT                   342719..342721,342728..342733,342737..342739,
FT                   342749..342754,342761..342763,342812..342814,
FT                   342854..342859,342866..342868,342887..342898,
FT                   342905..342910)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3517"
FT   misc_feature    order(342536..342580,342887..342904)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3517"
FT   misc_feature    order(342578..342580,342686..342688,342905..342907)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3517"
FT   misc_feature    order(342764..342802,342818..342823,342833..342835)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3517"
FT   gene            343096..344013
FT                   /db_xref="GeneID:9112821"
FT                   /locus_tag="BC1002_3518"
FT   CDS_pept        343096..344013
FT                   /locus_tag="BC1002_3518"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B2081 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:295699166"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9112821"
FT                   /translation="MNTLDSTLKGGMPQRARTRPRRSVFSPARLGIYAFLFTAAVFFLL
FT                   PLYVMLVTSVKPMSEIRLGNLLGFPMHFTLDAWSAAWQSACTGLDCNGIRVGFWNSVRI
FT                   VAPSTVLSIMVGAVNGYALSFWRPRGAGLLFGVLLVGAFIPVQVMIYPLVRVLASVHLF
FT                   SSLPGIVLIHTMFGMPVMTLLFRNYYASIPQELFKAARIDGGSFWRIFFQLMLPMSTPI
FT                   IVVALIMQVTNIWNDYILGLVFAGTKNLPMTVQLNNIINTTTGERLYNVNMAATILTSM
FT                   VPLAVYFISGRWFVRGIASGAVKG"
FT                   /protein_id="YP_003607059.1"
FT   misc_feature    343387..343941
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3518"
FT   misc_feature    order(343435..343440,343447..343452,343465..343467,
FT                   343495..343506,343510..343539,343546..343551,
FT                   343555..343557,343615..343620,343627..343629,
FT                   343633..343635,343642..343647,343651..343653,
FT                   343663..343668,343675..343677,343726..343728,
FT                   343768..343773,343780..343782,343801..343812,
FT                   343819..343824,343861..343866,343894..343899,
FT                   343906..343911,343915..343920,343927..343932,
FT                   343939..343941)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3518"
FT   misc_feature    order(343513..343557,343801..343818)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3518"
FT   misc_feature    order(343555..343557,343600..343602,343819..343821,
FT                   343855..343857,343864..343866,343894..343896)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3518"
FT   misc_feature    order(343678..343716,343732..343737,343747..343749)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_3518"
FT   gene            344017..345177
FT                   /db_xref="GeneID:9112822"
FT                   /locus_tag="BC1002_3519"
FT   CDS_pept        344017..345177
FT                   /locus_tag="BC1002_3519"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5884 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:295699167"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9112822"
FT                   /translation="MTDMANTIDAAAVPGASAGAASDAAALTHPANVAVRNLTIRLGAN
FT                   TVIENLDLDVLAGEFVVLLGPSGCGKSTLLHSIAGLIDVSDGSIEIAGEDMTWADPKDR
FT                   RIALVFQSYALYPTMSVERNLSFALRINGTPKAEIARRVARASEMLQLGPLLKRKPSQL
FT                   SGGQRQRVAIGRAIVREADVFLFDEPLSNLDAKLRTELRRELKQLHHSLGATMIYVTHD
FT                   QVEAMTLATRMAVMRGGVIQQFGTPAEVYARPNNLFVATFLGSPAMNLLKGTLETRDGA
FT                   LHFCSGNARIDVSAYEFIQAPAHGVPCVLGVRAEDVHITAGASERAKVSLIEPMGNHRV
FT                   IWLDYHGEQIASIDQTKAPIAEDDSVAFSFDAAHVSLFDEASGARL"
FT                   /protein_id="YP_003607060.1"
FT   misc_feature    344104..345174
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344113..344751
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344209..344232
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    order(344218..344223,344227..344235,344347..344349,
FT                   344575..344580,344677..344679)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344338..344349
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344503..344532
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344563..344580
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344587..344598
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344665..344685
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_3519"
FT   misc_feature    344944..345150
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BC1002_3519"
FT   gene            345225..346277
FT                   /db_xref="GeneID:9112823"
FT                   /locus_tag="BC1002_3520"
FT   CDS_pept        345225..346277
FT                   /locus_tag="BC1002_3520"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5883 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="GI:295699168"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9112823"
FT                   /translation="MENRVATLKDVAQLAGVGMSTASRAISGKGPISADAAARVKAAIE
FT                   ALNFRPSSIGRAMATQQLGIIGIFVPTFFGPYYGTILKQTDTELRAVGRHVVVATGCGE
FT                   VSPREQAIEAVRFLIGRDCDGVVVISHDLHDEDLIMLHGMHPKMVFLNRAFEQLPEASF
FT                   SADHRRGGELAARTLLDHGHRDIAVISGPATASDNVMRIDGFFAELARAGIARDDVPLI
FT                   ESDFSPEGGYAAAQKLLEMQRRVTGLFCANDTMAVAVLARFHQAGISVPNDISVISYDD
FT                   DYSAAYAAPGLTSVHIPTGELTQNAVRWLINQCYGTTWEIFREFPVSVTMRESVGPAPM
FT                   QKKNTRGSTR"
FT                   /protein_id="YP_003607061.1"
FT   misc_feature    345240..346241
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    345249..345404
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    order(345249..345251,345273..345287,345291..345296,
FT                   345303..345305,345318..345323,345330..345332,
FT                   345369..345371,345378..345380,345387..345392,
FT                   345396..345401)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    345369..345398
FT                   /note="domain linker motif; other site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    345417..346226
FT                   /note="Ligand binding domain of DNA transcription
FT                   iso-repressor GalS, which is one of two regulatory proteins
FT                   involved in galactose transport and metabolism; Region:
FT                   PBP1_GalS_like; cd06270"
FT                   /db_xref="CDD:107265"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    order(345417..345419,345438..345440,345456..345458,
FT                   345471..345473,345480..345482,345507..345518,
FT                   345522..345524,345573..345575,345585..345587,
FT                   345906..345911,346005..346007,346083..346088)
FT                   /note="dimerization interface (closed form); other site"
FT                   /db_xref="CDD:107265"
FT                   /locus_tag="BC1002_3520"
FT   misc_feature    order(345453..345455,345609..345611,345825..345827,
FT                   345900..345902,345978..345980,346062..346064)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107265"
FT                   /locus_tag="BC1002_3520"
FT   gene            346958..348649
FT                   /db_xref="GeneID:9112824"
FT                   /locus_tag="BC1002_3521"
FT   CDS_pept        346958..348649
FT                   /locus_tag="BC1002_3521"
FT                   /gene_family="HOG000199843" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /codon_start="1"
FT                   /product="sulphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bpy:Bphyt_5881 sulphate transporter"
FT                   /db_xref="GI:295699169"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="GeneID:9112824"
FT                   /translation="MAARASVLKGVLPLSRIAAARDALAGVQLASMDIPQVLGYARIAG
FT                   MPAVTGLYTVFLPLVAFAFFGASRHLVVAADSATATIFASRLETMAPASSAEYAALAAM
FT                   VALLTAGLLLVARIFKLGFLADFLSRTVLVGFLAGVGVQVGIAMLGDMLGVPGHATRSV
FT                   DQLLLVVSKATQINRPTLAISLFVVAAILVCKRFWPRLPVPLIAVVGGIAASDVFGFAA
FT                   HGIPILGPVEGGLPPLRIPSVTWQQMLDLVPVAASCFVMIVAQSAAASRVFAERYHEPV
FT                   DTNADLLGIAAANAAAAFSGAFVVNGSPTQTAMADRAGTRSQFAQLVFATVVVAVLLFF
FT                   SRYLQYLPHCILASIVFTIAVGLINVQSLFSIRRESPGEFALALFTAAAVVLIGVEHGI
FT                   LVAVALSLLRHVRHSYRPHTMMLAPNGDGMWVPVPAVPGIETAPGLIVYRFGADLFYAN
FT                   DHFFVDDTRRLIEHAPNAVRWFVVDASAITDVDYSAARSVGELCSALKRDGIEVVFARV
FT                   NRYLRSDMDRHGITPIVEERCIFGTLHEALSMAGVEKPHEQVKGAP"
FT                   /protein_id="YP_003607062.1"
FT   misc_feature    347018..348619
FT                   /note="Sulfate permease and related transporters (MFS
FT                   superfamily) [Inorganic ion transport and metabolism];
FT                   Region: SUL1; COG0659"
FT                   /db_xref="CDD:31004"
FT                   /locus_tag="BC1002_3521"
FT   misc_feature    347309..348094
FT                   /note="Permease family; Region: Xan_ur_permease; cl00967"
FT                   /db_xref="CDD:176823"
FT                   /locus_tag="BC1002_3521"
FT   misc_feature    348266..348586
FT                   /note="Sulphate Transporter and Anti-Sigma factor
FT                   antagonist domain of SulP-like sulfate transporters, plays
FT                   a role in the function and regulation of the transport
FT                   activity, proposed general NTP binding function; Region:
FT                   STAS_SulP_like_sulfate_transporter; cd07042"
FT                   /db_xref="CDD:132913"
FT                   /locus_tag="BC1002_3521"
FT   gene            348782..349474
FT                   /db_xref="GeneID:9112825"
FT                   /locus_tag="BC1002_3522"
FT   CDS_pept        348782..349474
FT                   /locus_tag="BC1002_3522"
FT                   /gene_family="HOG000219770" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /codon_start="1"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6062 phosphoesterase PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   SMART: phosphoesterase PA-phosphatase related"
FT                   /db_xref="GI:295699170"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="GeneID:9112825"
FT                   /translation="MNSFDSTIETYLSSIHFGHFATQSIQAIADLYTFKGLVLIAVLWW
FT                   IWFQQDAHAERRREIVLATLLSGVVALFVGRLLAHWLPFRVRPIYSTELHLQFASGATK
FT                   AAQLSDWSSFPSDHAMLWMAIATGIFLVWRGIGVLALLYTAVFICLPRAYLGFHYPTDL
FT                   LAGAAVGIAITVILTRDAIRTRFATPMLRWIERHPGPAAMLAFILCLQLVTQFEELRAL
FT                   ACGVFRHL"
FT                   /protein_id="YP_003607063.1"
FT   misc_feature    348890..349267
FT                   /note="PAP2_like proteins, a super-family of histidine
FT                   phosphatases and vanadium haloperoxidases, includes type 2
FT                   phosphatidic acid phosphatase or lipid phosphate
FT                   phosphatase (LPP), Glucose-6-phosphatase,
FT                   Phosphatidylglycerophosphatase B and bacterial acid...;
FT                   Region: PAP2_like; cl00474"
FT                   /db_xref="CDD:174227"
FT                   /locus_tag="BC1002_3522"
FT   misc_feature    order(349019..349021,349040..349042,349127..349135,
FT                   349235..349237,349253..349255,349265..349267)
FT                   /note="active site"
FT                   /db_xref="CDD:48084"
FT                   /locus_tag="BC1002_3522"
FT   gene            349616..351214
FT                   /db_xref="GeneID:9112826"
FT                   /locus_tag="BC1002_3523"
FT   CDS_pept        349616..351214
FT                   /locus_tag="BC1002_3523"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_3828 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:295699171"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008611"
FT                   /db_xref="GeneID:9112826"
FT                   /translation="MYSLLPLKAQVRRHARTLAGYFPAPFTRDESSGVDILGVMTPRLL
FT                   NGSTLLNLNYGEVDRFTDKTRATGTVFVAIGDDFVRVATSVKRQTGERAVGTVLDRSHP
FT                   GYRMLRSGQPYTGYATLFGKQYMTRYEPIRDSSGDVIGALYVGLDVSEVWNLSIGGRLA
FT                   LLTLAANTVLLLGYGRLLQAVILPDQASPTGASPPFLPAGVIGFGLLCALLVSALVFVT
FT                   TRRGLGMQLLEAKAAAEKLAAGDLTAQVHVSRRDELGQLMQAMNGISVGLASVVGNVRR
FT                   ASDMIALGAREIAAGNAELSSRTEAQAGSLEETASTMEQLTATVRANAERASHANQHIA
FT                   SASDLAVKGGTVVGHVVTTMSLIRGSSHKIVDIISMIDSIAFQTNILALNAAVEAARAG
FT                   DQGRGFAVVAAEVRSLAQRSATAAREIKALITDSVGNVNAGGELVDQAGRDMTEIVTAV
FT                   DSVVTLMGEITHASNEQSTGIGEMNRAIGHMDEMTQQNVALVEQVAAAAASMQEQASTL
FT                   EDAVQVFRLVGDGPN"
FT                   /protein_id="YP_003607064.1"
FT   misc_feature    <350240..351094
FT                   /note="methyl-accepting protein IV; Provisional; Region:
FT                   PRK09793"
FT                   /db_xref="CDD:170098"
FT                   /locus_tag="BC1002_3523"
FT   misc_feature    350693..351193
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="BC1002_3523"
FT   gene            complement(352038..352265)
FT                   /db_xref="GeneID:9112827"
FT                   /locus_tag="BC1002_3524"
FT   CDS_pept        complement(352038..352265)
FT                   /locus_tag="BC1002_3524"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: C1orf102; chromosome 1 open reading frame 102"
FT                   /db_xref="GI:295699172"
FT                   /db_xref="GeneID:9112827"
FT                   /translation="MAVAVKDRQLRSARALTSYRISARLKRGREASHPGGNEDGFGDRL
FT                   MSSAEDEQAPSVTKVWHHGSRSIGNQQRVN"
FT                   /protein_id="YP_003607065.1"
FT   gene            352821..353987
FT                   /db_xref="GeneID:9112828"
FT                   /locus_tag="BC1002_3525"
FT   CDS_pept        352821..353987
FT                   /locus_tag="BC1002_3525"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ter:Tery_4990 radical SAM family protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="GI:295699173"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:9112828"
FT                   /translation="MDTTERIIKWRDLRHVDTVVSEPRNPLPAVCDVSVTNVCNAACDF
FT                   CGFSREKNLAGPRRYLDPDEFARALPILRRRRIRYMTLQGGEPLVHPQIASLVASATKA
FT                   GIQCGVITNGWFLPRHIKQLAEAGLKRLLISIDSADMREHEHNRGLRGLEARIREGITQ
FT                   AHSFGIEVCASITVSRLVRYESLPETLNRLGFDAVVFSYPRREAFGSSSLVYDEDSKLV
FT                   DLNTDELLDALNAIARLKKHFRVMDPSAALDEVARFVRGERQLVPCIGGSKYFYIDWNL
FT                   DVWRCEAWSEPMGSVFDLDRLPDQREPCNACMMGCYRHASILMHGAIAVTDSVYALGRG
FT                   QLRTAVSLLFQRSVAYSLWALSVEELPRASLMSFARRMGGRRSTPQTG"
FT                   /protein_id="YP_003607066.1"
FT   misc_feature    352917..353399
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_3525"
FT   misc_feature    order(352935..352937,352941..352943,352947..352949,
FT                   352953..352961,353070..353072,353076..353081,
FT                   353151..353159,353223..353225,353346..353348)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_3525"
FT   gene            354182..354385
FT                   /db_xref="GeneID:9112829"
FT                   /locus_tag="BC1002_3526"
FT   CDS_pept        354182..354385
FT                   /locus_tag="BC1002_3526"
FT                   /gene_family="HOG000059087" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_6546"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6546 hypothetical protein"
FT                   /db_xref="GI:295699174"
FT                   /db_xref="GeneID:9112829"
FT                   /translation="MKSDDKGDVRAFVQTAEQGGEHVWVITLVDFAAREVRRSLVSDET
FT                   YATAAAARDAGQAHLKGLEQDR"
FT                   /protein_id="YP_003607067.1"
FT   gene            354479..355984
FT                   /db_xref="GeneID:9112830"
FT                   /locus_tag="BC1002_3527"
FT   CDS_pept        354479..355984
FT                   /locus_tag="BC1002_3527"
FT                   /gene_family="HOG000005157" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /codon_start="1"
FT                   /product="glutamine synthetase, type I"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RSp0886 glutamine synthetase protein;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="GI:295699175"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="GeneID:9112830"
FT                   /translation="MASTQGSTGSPFAASVEAGSYRVARPQNASDVIDLLQKRDIQIVD
FT                   LKFTDLPGLWQHFSITLPEVHDDLFSAGIGFDGSSIRGFQEIHESDMLLRPDPATAFVD
FT                   PACGTPTLSIICDVVDPVLRQPYSRDPRYVAKKAENYLRQTGIATTCYFGPELEFFIFD
FT                   SIRFGQDQHCGYYYVESAEGDWTTGRDEGAYGGGNLGYKQHYKEGYFPVPPHDTLQELR
FT                   SEIALTLQQAGVQIEVHHHEVATAGQNEIDMRFATLTRMADNVMIYKYICKNVARRHGK
FT                   VATFMPKPLFADNASGMHCHQSLWNDEQNLFYDAGGWALTSDMCRWYIGGLLQHAPALM
FT                   AFCAPTTNSYKRLVPGYEAPVNLAMSQRNRSAAARIPMYSDSPNARRVEFRCPDPSANA
FT                   YLAFAAMLMAGLDGIENKTDPGEPLDRNIYDLPPEEARNIRQVPGSLEAALAALETDNT
FT                   FLRKGDVFTDDVIQTWIDYKRSREIDTIKLRPHPWEFYLYFDI"
FT                   /protein_id="YP_003607068.1"
FT   misc_feature    354569..355978
FT                   /note="glutamine synthetase, type I; Region: GlnA;
FT                   TIGR00653"
FT                   /db_xref="CDD:161979"
FT                   /locus_tag="BC1002_3527"
FT   misc_feature    354596..354841
FT                   /note="Glutamine synthetase, beta-Grasp domain; Region:
FT                   Gln-synt_N; pfam03951"
FT                   /db_xref="CDD:146534"
FT                   /locus_tag="BC1002_3527"
FT   misc_feature    354863..355708
FT                   /note="Glutamine synthetase, catalytic domain; Region:
FT                   Gln-synt_C; pfam00120"
FT                   /db_xref="CDD:143894"
FT                   /locus_tag="BC1002_3527"
FT   gene            complement(356003..357463)
FT                   /db_xref="GeneID:9112831"
FT                   /locus_tag="BC1002_3528"
FT   CDS_pept        complement(356003..357463)
FT                   /locus_tag="BC1002_3528"
FT                   /gene_family="HOG000117911" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /codon_start="1"
FT                   /product="anion transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: kpu:KP1_2563 putative tartrate:succinate
FT                   antiporter; TIGRFAM: anion transporter; PFAM:
FT                   sodium/sulphate symporter"
FT                   /db_xref="GI:295699176"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="GeneID:9112831"
FT                   /translation="MRMGHGMKTFWKAVAPLIVAIVIGLIPAPPGLAQHAWYYFGIFAG
FT                   VIVGLMLEPIPGAAIGLIAVTLVAVFSEWVFFSPAQLAKPGFNVANAGLSWALSGFSNG
FT                   TVWLIFGAFMFALGYEKTGLGKRIALMLVRALGRRTLTLGYAVMVADAVIAPFTPSNTA
FT                   RSGGTIFPVIRSLPPLYDSKPNDPSARRIGSYIMWTAIATTCVTSSMFLTALAPNLLAA
FT                   ELVKKTVDVDLEWAQWFLAFAPAGILLLLAIPLLTYVLYPPHVKQSAEVPAWAAQQLKE
FT                   MGPLTRREIMLAVLVLIALALWVFADDYVNPTTAALMVIALMLVTQVVSWDDMLGNKQA
FT                   WNTLVWFATLVALADGLSRTGFVKWFAGTISTHMAGFPPTEAAIVLVLIFFFTHYMFAS
FT                   VTAHATAMLPVMLAVGSTIPGMPMEAFALMLSLTLGIMGILTPYGTGPSPVYFGSGYLP
FT                   AGDFWRLGLIFGVIYIAVFLLICAPILL"
FT                   /protein_id="YP_003607069.1"
FT   misc_feature    complement(356006..357445)
FT                   /note="Di- and tricarboxylate transporters [Inorganic ion
FT                   transport and metabolism]; Region: CitT; COG0471"
FT                   /db_xref="CDD:30819"
FT                   /locus_tag="BC1002_3528"
FT   misc_feature    complement(356024..357175)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3528"
FT   misc_feature    complement(order(356027..356065,356153..356155,
FT                   356159..356206,356210..356218,356270..356275,
FT                   356276..356311,356393..356449,356492..356536,
FT                   356639..356677,356690..356692,356708..356749,
FT                   356813..356848,356852..356881,356897..356902,
FT                   356912..356932,356942..356962,356966..356977,
FT                   356981..356986,356990..357034,357104..357157))
FT                   /note="transmembrane helices; other site"
FT                   /db_xref="CDD:29728"
FT                   /locus_tag="BC1002_3528"
FT   gene            357549..358187
FT                   /db_xref="GeneID:9112832"
FT                   /locus_tag="BC1002_3529"
FT   CDS_pept        357549..358187
FT                   /locus_tag="BC1002_3529"
FT                   /gene_family="HOG000004474" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /codon_start="1"
FT                   /product="ferredoxin"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; KEGG: reu:Reut_B4590
FT                   ferredoxin:4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="GI:295699177"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:9112832"
FT                   /translation="MVRVSIEGREIQAPDNCSILQAMGHAGQTLVEGVGCMSQGVCGSC
FT                   RVMVRRSGEQEVKTALACETLVEEGMQVAFLDYFTESERHLYRMEEIGDSWQALSKIAE
FT                   IFPEAAHCRHCSGCDRACPKGLDVQRGVNLAVEGNLPASSQVFDECVMCNLCTLACPEH
FT                   IRPNHLGVFVRRMIASLSLRPANLMRRLQQIESGEMKIDFDAPGAQPPR"
FT                   /protein_id="YP_003607070.1"
FT   misc_feature    357552..357767
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3529"
FT   misc_feature    order(357636..357641,357654..357656,357666..357668,
FT                   357672..357683,357732..357737)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3529"
FT   misc_feature    order(357654..357656,357672..357674,357681..357683,
FT                   357735..357737)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_3529"
FT   misc_feature    <357810..>358043
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl00255"
FT                   /db_xref="CDD:174071"
FT                   /locus_tag="BC1002_3529"
FT   gene            358203..359852
FT                   /db_xref="GeneID:9112833"
FT                   /locus_tag="BC1002_3530"
FT   CDS_pept        358203..359852
FT                   /locus_tag="BC1002_3530"
FT                   /gene_family="HOG000007038" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /codon_start="1"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: rme:Rmet_4301 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein-like
FT                   protein"
FT                   /db_xref="GI:295699178"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9112833"
FT                   /translation="MSAGIPYENARQRYRPGMAATLRADDVPVDELLKAYHPDHGPHAR
FT                   VTLSVGINRGEPCQPDLARHLQANALIDDVDIAGAQLMTTDVLVIGGGGGGCAAALTAA
FT                   KQGARVILATKLRLGDSNTVMAEGGIQAAIGEDDSPQLHFEDTLRAGHFCGEPELVAQM
FT                   VMDGPDVIRWLIQLGMMFDLEEDQPIGGNLMRKKPGGASAARILSYRDYTGLEMMRVLR
FT                   EAVDLDPGIELWNRCPLVELLSDERGGCAGAVIYNLEWRTFVLVRARAVILATGGAGRL
FT                   HLNSFPTSNHYGATADGLVLAYRIGARLRELDSFQYHPTGIAYPHHLAGGLISEAARSA
FT                   GARLLNGEGERFVDELKPRDVVASAILRECAQGRGIERDGQVGVFLDTPTLEIEHPGIL
FT                   AKRLVTLRHLADKCGIDAAQEPFLVYPTLHYQNGGVAIDKDGATNVPGLFCVGEVTGGI
FT                   HGRNRLMGNALLDILSMGRRAGAKAAQSKEWVMASRAGIGHVHAWQRELTLAGLPLHVK
FT                   APQLFPTYAHFDLRVDAGLRASARGRVIGGIR"
FT                   /protein_id="YP_003607071.1"
FT   misc_feature    358449..359639
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_3530"
FT   misc_feature    358530..359642
FT                   /note="flavocytochrome c; Region: flavo_cyto_c; TIGR01813"
FT                   /db_xref="CDD:162543"
FT                   /locus_tag="BC1002_3530"
FT   gene            359873..361117
FT                   /db_xref="GeneID:9112834"
FT                   /locus_tag="BC1002_3531"
FT   CDS_pept        359873..361117
FT                   /locus_tag="BC1002_3531"
FT                   /gene_family="HOG000251534" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4300 respiratory-chain NADH
FT                   dehydrogenase domain-containing protein; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding"
FT                   /db_xref="GI:295699179"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="GeneID:9112834"
FT                   /translation="MQTLNQCLMRDDFRVGADLDAWFARGGGEGLAKALDDPEAIIAEL
FT                   AQADLRGMGGAGFPAHRKWAPVAAAPDGDKYVVCNGNEDEPGTFKDRFLLEHTPHQVIE
FT                   GALIAAVATRANHVVLYVNPHQTSSLAATREAVEQWSGHPQFAAVERWIGAPLSLGVVP
FT                   SSGLYIGGEETAVIASVEGGFPFPRRKPPFPAEQGVHGAPTIVNNVETLAHVPGILRHG
FT                   AQWYRELGVGNAAGTKLYSLSGDVLRPGLYELPMGTSLETLVFQHGGGMLQGKEFKAVF
FT                   TGGPSNTLLTKRDLDVALDFDSVRQRRSRLGTGAMIVVSEGTSIVRKVADYVNFFAQGS
FT                   CGQCPPCKGGTFQMMRLLNRLDTGRGVRADLDALENLCRVLPGSGRCGLIDGAVTVVES
FT                   SIDQFRAEYEALLMA"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /protein_id="YP_003607072.1"
FT   misc_feature    359924..361102
FT                   /note="NADH:ubiquinone oxidoreductase, NADH-binding (51 kD)
FT                   subunit [Energy production and conversion]; Region: NuoF;
FT                   COG1894"
FT                   /db_xref="CDD:32078"
FT                   /locus_tag="BC1002_3531"
FT   misc_feature    360005..360520
FT                   /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
FT                   Region: Complex1_51K; pfam01512"
FT                   /db_xref="CDD:144926"
FT                   /locus_tag="BC1002_3531"
FT   misc_feature    360587..360730
FT                   /note="endonuclease III; includes endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
FT                   glycosidases (Alka-family) and other DNA glycosidases;
FT                   Region: ENDO3c; cl11430"
FT                   /db_xref="CDD:175252"
FT                   /locus_tag="BC1002_3531"
FT   misc_feature    360848..360985
FT                   /note="NADH-ubiquinone oxidoreductase-F iron-sulfur binding
FT                   region; Region: NADH_4Fe-4S; pfam10589"
FT                   /db_xref="CDD:151119"
FT                   /locus_tag="BC1002_3531"
FT   gene            complement(361140..362948)
FT                   /db_xref="GeneID:9112835"
FT                   /locus_tag="BC1002_3532"
FT   CDS_pept        complement(361140..362948)
FT                   /locus_tag="BC1002_3532"
FT                   /gene_family="HOG000281279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /codon_start="1"
FT                   /product="Citrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   KEGG: smd:Smed_5235 citrate transporter"
FT                   /db_xref="GI:295699180"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9112835"
FT                   /translation="MNPMTVTSLVLAMTMALFIWNKVPAAVVAVMSLIALYLTGVLTMR
FT                   EALSGFGYPLIVFIAALLGIGIGLETTGVGTWAGQWLIRHSGSSRKRLIASLLILSAVS
FT                   TALIGMNGAVVAMLPIAVIICVQTQLAPSQLMMPVSIACLTGAKLTLLGSPVNVIASSA
FT                   ADTLGGAPIRFFEWSIVGLPLFAGTLAIILILGPVLLPRRSSNSLPADFSQHAHTLVEQ
FT                   YRLADGVFRLRVRAGSPLIGKTLDSIDLSQYPGISVLGLTDDEGAELAQKEASEGHHLL
FT                   VRGDAQGVARLANDLHLAIREPLSEAQAVTNALFNRSSGLAEVVIPPRSGLIGQTVFPG
FT                   MATHEGDLIVLAIQRGGNNVPEPSTTLLAGDHLLFRGTWEALDKHFSDPQILMVDSPQM
FT                   VRRQTIALGRGAREALAILAVLVILLATNAVPPAVATLICVTAMVLTRVITLNQLYTID
FT                   WNTCVLVGALIPLATAMSNTGLAYQIGDFVIQAVGSGGPRAVLAGLFFVAAVLTQVISN
FT                   NSAALVTVPIAVATAQELGVSATPFLVAVALGAGAAHMTPMSTPVNLVTYGPGAYEFGD
FT                   YWKIGLLIVLWSMAVVVFIAPLYWPF"
FT                   /protein_id="YP_003607073.1"
FT   misc_feature    complement(<362346..362921)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3532"
FT   misc_feature    complement(order(362346..362363,362376..362393,
FT                   362394..362417,362481..362552,362562..362615,
FT                   362619..362669,362739..362792,362835..362876,
FT                   362895..362906))
FT                   /note="transmembrane helices; other site"
FT                   /db_xref="CDD:29728"
FT                   /locus_tag="BC1002_3532"
FT   misc_feature    complement(362058..362264)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3532"
FT   misc_feature    complement(361797..361988)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3532"
FT   misc_feature    complement(361149..>361670)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_3532"
FT   gene            complement(363033..364694)
FT                   /db_xref="GeneID:9112836"
FT                   /locus_tag="BC1002_3533"
FT   CDS_pept        complement(363033..364694)
FT                   /locus_tag="BC1002_3533"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /codon_start="1"
FT                   /EC_number="2.3.2.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: gamma-glutamyltransferase; KEGG: bbr:BB0978
FT                   gamma-glutamyltranspeptidase precursor; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="GI:295699181"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:9112836"
FT                   /translation="MSHPNGPRTGRPPTRAPHGMVATPHYLASQAGVEMLQRGGTAVDA
FT                   AIAANAVLCVAYPHMAGLGGDGFWLIADGNSEQIHAINASGPAAQGATLAHYRGIATDN
FT                   EIAARGPQAVLTVPGAIDGWRLAHERFGRLAWAELFAAAIGYARDGVPVSRSLADWTAQ
FT                   DVPILTRYPDTAAIFMPGGRVPADGEKLVQTALSRSLQQLADQGPRAGFYEGDLAARIC
FT                   AGVVAAGSPLQPVDFAAYRAEWVTPISTTYRDHTVYELPPNTQGFTPLQILNLIEGYDV
FT                   TAWGEGTADYYHHLAEAVKIAFADREEWLTDPRFVTIPVDQLITKAYCDERRKLLDPER
FT                   ALDISTVPPGIAYQYPHDRRAPDGDTCYFCAADNDGMVVSLIQSIYHDFGSGVLGGDTG
FT                   IIMQNRGAFFSLDEHHPNCLQPGKRTFHTLIPALMTRDGRPCLAFGSMGGEGQPQTQAA
FT                   LVTRIVDFGYDVQQAIEAPRWLMGRTWGTKSRNMSLEGRISDEVVRELKRRGQPVQMVT
FT                   DWNDNMGHAHAIALDRQQGFYEGGADPRGDGAALGY"
FT                   /product="gamma-glutamyltransferase"
FT                   /protein_id="YP_003607074.1"
FT   misc_feature    complement(363036..364649)
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:174918"
FT                   /locus_tag="BC1002_3533"
FT   misc_feature    complement(363051..364598)
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="BC1002_3533"
FT   gene            complement(364806..365024)
FT                   /db_xref="GeneID:9112837"
FT                   /locus_tag="BC1002_3534"
FT   CDS_pept        complement(364806..365024)
FT                   /locus_tag="BC1002_3534"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Namu_0603"
FT                   /codon_start="1"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: nml:Namu_0603 drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="GI:295699182"
FT                   /db_xref="GeneID:9112837"
FT                   /translation="MDKLVAETLALLLMFAGFPLTSRGSVTGNMLLLGLGLLCVIAGGA
FT                   LPIITRFMDHSNDKVRDAGVEFDDRAS"
FT                   /protein_id="YP_003607075.1"
FT   gene            complement(365035..366669)
FT                   /db_xref="GeneID:9112838"
FT                   /locus_tag="BC1002_3535"
FT   CDS_pept        complement(365035..366669)
FT                   /locus_tag="BC1002_3535"
FT                   /gene_family="HOG000254704" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02652"
FT                   /codon_start="1"
FT                   /product="L-lactate permease"
FT                   /transl_table="11"
FT                   /note="PFAM: L-lactate permease; KEGG: bbr:BB0976 lactate
FT                   permease family protein"
FT                   /db_xref="GI:295699183"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="GeneID:9112838"
FT                   /translation="MNEITLPVDLIHWILATLSIIALLVFLVPLRWRAPEAGPGAMFVA
FT                   GLIAVFAFRTPITTLAVASGKGVWDAIFILYVMWPALLLYQITKQAGGYDALRHGISRF
FT                   SRNDLFVILGLGWVFSSFLQGIAGFGAPIAVVAPLLLAIGVRPVHAAAISIIAHAWARF
FT                   FGTLGVGWLATLQVADIQDVGRAAFESCVLLLIPTYFGGLLIVWLYGRWAAVRHGWPLV
FT                   LILGTILGFGQLIFAYLSPELSTFLAATVAMVALYPLSRWRRFREPVPAAEVPDRPAMD
FT                   PAAVGMQNETEEPVMSLGMAFLPYVVLTVVTLGILLIGPLNDALRQFRIGLPFPEVSTG
FT                   FGVRNAAVARYAPFSPFTHPGTMLLISAIVVWIVYRVNGFYGAWQSRHGGENLGRSLIV
FT                   DGVPASLPVIAFLVTSRVLDHSGQTQVLAHGIADVSPPLVYAGIASVIGALGAFMTSSS
FT                   TASNVLFGGLQSDVAQLHSLPTEAIIAAQAAGSAYGNAIGPANIVLGTSISGIKGQEGA
FT                   VMKLALPWTVVVAILTGIGTILLVIFA"
FT                   /protein_id="YP_003607076.1"
FT   misc_feature    complement(365080..366630)
FT                   /note="L-lactate permease; Region: Lactate_perm; cl00701"
FT                   /db_xref="CDD:163899"
FT                   /locus_tag="BC1002_3535"
FT   misc_feature    complement(365080..366630)
FT                   /note="glycolate transporter; Provisional; Region:
FT                   PRK09695"
FT                   /db_xref="CDD:77349"
FT                   /locus_tag="BC1002_3535"
FT   gene            complement(366917..367267)
FT                   /db_xref="GeneID:9112839"
FT                   /locus_tag="BC1002_3536"
FT   CDS_pept        complement(366917..367267)
FT                   /locus_tag="BC1002_3536"
FT                   /gene_family="HOG000061333" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5880"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5880 hypothetical protein"
FT                   /db_xref="GI:295699184"
FT                   /db_xref="GeneID:9112839"
FT                   /translation="MNGNEHDAPSSTRRSPLQKRLYLFGAAILVVSLIVAALIYLSVPP
FT                   PDSAVAMYSMVHPRYQIELQQIGGNAAVLMAQLHQWFDSLWHGVRLAYTVAALGAALAA
FT                   GCFFIGHYFVDD"
FT                   /protein_id="YP_003607077.1"
FT   gene            complement(367367..368005)
FT                   /db_xref="GeneID:9112840"
FT                   /locus_tag="BC1002_3537"
FT   CDS_pept        complement(367367..368005)
FT                   /locus_tag="BC1002_3537"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B2075 amino acid efflux pump, RhtB family protein"
FT                   /db_xref="GI:295699185"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:9112840"
FT                   /translation="MIASPVLTADVLIAYSAYFVGTASPGPSNLAIMSLAMSAGRRAAL
FT                   VFALGVVSGSFSWALLASLGLSAVLATYSECLVAIRIAGGLYLLWLGYKSARSALSAGK
FT                   PAASAARVDEPLGRLYLRGLLLHLTNPKAVLVWLSIVSLAMSPVHGAAHVMPVVLGCMV
FT                   IGATVFSSYAMLFSTASARRVYTAIRRWLDGSLAVMFGIAGIKLLTSKN"
FT                   /protein_id="YP_003607078.1"
FT   misc_feature    complement(367376..367951)
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="BC1002_3537"
FT   gene            complement(368182..369057)
FT                   /db_xref="GeneID:9112841"
FT                   /locus_tag="BC1002_3538"
FT   CDS_pept        complement(368182..369057)
FT                   /locus_tag="BC1002_3538"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_5878 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295699186"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9112841"
FT                   /translation="MLSELKTFIAVSQYGTFSGAGARIGLTQSAVSAQMQRLEQELGFP
FT                   LFDRTGRSATLNEAGRETLPLAEEMMTLYARLSERSGGAAESGMLRVGAIASAQVSLLA
FT                   DALARFRDDRPGWRIRVVPGVSLGLLGQVDAGELDLAVIIKPPFALPSELEWRTLVAEP
FT                   FVLLAPKKLARGGRSWRELLRSEPFIRYDRASFGGRLVDRFLRRARLSVRDAVELDELQ
FT                   AIVQLVARGMGVALIPNTAGLGKWPASVVALELGDATFEREIGLVLRPRHSRPVVADAL
FT                   AECIASAADG"
FT                   /protein_id="YP_003607079.1"
FT   misc_feature    complement(368191..369057)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_3538"
FT   misc_feature    complement(368875..369054)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_3538"
FT   misc_feature    complement(368206..368790)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator,
FT                   contains the type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_like_2; cd08427"
FT                   /db_xref="CDD:176118"
FT                   /locus_tag="BC1002_3538"
FT   misc_feature    complement(order(368368..368373,368377..368382,
FT                   368398..368415,368689..368709,368713..368715,
FT                   368725..368727,368734..368739,368743..368748))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176118"
FT                   /locus_tag="BC1002_3538"
FT   gene            369217..369651
FT                   /db_xref="GeneID:9112842"
FT                   /locus_tag="BC1002_3539"
FT   CDS_pept        369217..369651
FT                   /locus_tag="BC1002_3539"
FT                   /gene_family="HOG000232014" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bpy:Bphyt_5877
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:295699187"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9112842"
FT                   /translation="MSVAETALPPFHLAFPVHSLAAAREFYGELLGCPEGRSSDAWVDF
FT                   NFYGHQIVAHLAPDEVGHRHTSAVDGDAVPVRHFGAVLSMEQWQAAADKLQKAGIEFII
FT                   EPHVRFKGEVGEQATMFFLDPSGNALEFKAFADMSSLFAK"
FT                   /protein_id="YP_003607080.1"
FT   misc_feature    369247..369621
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_18; cd08357"
FT                   /db_xref="CDD:176705"
FT                   /locus_tag="BC1002_3539"
FT   misc_feature    order(369250..369252,369448..369450,369607..369609)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:176705"
FT                   /locus_tag="BC1002_3539"
FT   gene            370026..373301
FT                   /db_xref="GeneID:9112843"
FT                   /locus_tag="BC1002_3540"
FT   CDS_pept        370026..373301
FT                   /locus_tag="BC1002_3540"
FT                   /gene_family="HOG000158132" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bpy:Bphyt_5876 acriflavin resistance protein"
FT                   /db_xref="GI:295699188"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="GeneID:9112843"
FT                   /translation="MWIVNVALKRPYTFIVMAILIVLATPFVLFTTPVDVLPEINIPVV
FT                   SIIWTYTGLSAEDMATRITSVNERSLTTTVNDIEHIESQSLPGIAILKVFLQPNANIQT
FT                   AIAQTVAVEQAQLKQMPPGATAPLVISYSASSIPVIQLGLSSPKLSEQDLNDTALNFLR
FT                   PQLVTIPGAAVPYPYGGKSRLISVDLDTRAMLAKGLTPADVVNAFNAQNLILPTGTAKI
FT                   GPKEYTIDMNGSPPTLEGLNDIPVRTVNGATTYLREVAHVRDGYSPQTNIVRQNGHRGV
FT                   LMSVLKNGNASTLSIVDTLKGLLPAARAALPPDLQITALFDQSVFVKAAVQGVVREALV
FT                   AAALTAAMILLFLGNWRSTCIIAISIPLSILSSLIVLHALGQTINIMTLGGLALAVGIL
FT                   VDDATVTIENIERHLHMGTNLHDAILDGAGEIAVPALVSTLCICIVFVPMFFLTGVARY
FT                   LFVPLAEAVVFAMLASYILSRTLVPTLAMLLMGHAHKPKTGTKPNLFMRLYHRFDAGFE
FT                   RMRAAYIMILSSLLVRRKMFGTLFLGFCVLSMGLFFALGEDFFPSVDAGDIRLHMRAPT
FT                   GTRIEETARLADEVEKVIREVVPEKELGTILDNLGLPYSGINLSYSNAGTMGTLDGEIQ
FT                   IALNEGHKPSQIYMDKLRTILPQRFPGVEFFFQPADIVTQILNFGLPAAVDVQIAGANQ
FT                   QGNLDVARKLLKQVRLIPGTVDTHIQQKLDEPVIGLHMDRTRLQQLNLTANDVAQNVLV
FT                   SLSGSSQTSPGFWVNNNNGVEYRVQVQTPQYQVSSIDELLRTPVSATMNGPTQLLGNLV
FT                   QVSPKSQFAEVSHYNIRPVIDLYVSVEKRDLGSVANQVDRIVNEVSGTLPRGSTITVRG
FT                   QVQTMRSSFFGLGIGVAMAIVLVYLLIVVNFQSWVDPLIIVSALPAALAGIVWMLFLTG
FT                   THLSVPALTGAIMTMGVATANSILMVAFARQRLSAGAPPLTAALEAGASRIRPVLMTAF
FT                   AMIIGMVPMALGLGEGAEQNAPLGRAVIGGLLFATVSTLFFVPLVFAGIHSWLARRHHN
FT                   GGGDGGDGGGGGKGGNRGGTGGDGGRSSGHSGSPEHSSAATPA"
FT                   /protein_id="YP_003607081.1"
FT   misc_feature    370029..373133
FT                   /note="Cation/multidrug efflux pump [Defense mechanisms];
FT                   Region: AcrB; COG0841"
FT                   /db_xref="CDD:31183"
FT                   /locus_tag="BC1002_3540"
FT   gene            373325..374551
FT                   /db_xref="GeneID:9112844"
FT                   /locus_tag="BC1002_3541"
FT   CDS_pept        373325..374551
FT                   /locus_tag="BC1002_3541"
FT                   /gene_family="HOG000182879" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5875 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="GI:295699189"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:9112844"
FT                   /translation="MTEKTHASLAIPTRETEQGEHLLPPRHREWRHAKIAILIVFVLLA
FT                   IGTLRTVIANVMQNREVTATAQQNATQYVNVVTPKQTDGGGGTLLPGTLRGYVESPIYA
FT                   RATGYLLHWYADIGARVKQGQLLAELDTPEIDQELAQALAQRQQINSSLALAKSSLERW
FT                   QQLRQRDAVSQQELDERQSTYTQDLANLAAADANVKRLQQLESFKRIVAPFAGVVTQRN
FT                   VDVGDLIDAGSGTSRALFALAQSDPLRVYVQLPQAYAQNVAVGQKVVVTQAELPGQQFH
FT                   GTITHMSGAIDVATRSLQIEVTLPNPDARLRPGAYVQVEVPAAAHERLTVPGNALLFRA
FT                   EGPRLAVVDAKGNVSLHKVVIAVDLGQQLEIESGISPTDRIIINPSDSIADGDHVQVQP
FT                   LRKNGKEAS"
FT                   /protein_id="YP_003607082.1"
FT   misc_feature    373628..374518
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="BC1002_3541"
FT   gene            374551..376116
FT                   /db_xref="GeneID:9112845"
FT                   /locus_tag="BC1002_3542"
FT   CDS_pept        374551..376116
FT                   /locus_tag="BC1002_3542"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /codon_start="1"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5874 RND efflux system, outer
FT                   membrane lipoprotein, NodT family; TIGRFAM: RND efflux
FT                   system, outer membrane lipoprotein, NodT family; PFAM:
FT                   outer membrane efflux protein"
FT                   /db_xref="GI:295699190"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:9112845"
FT                   /translation="MFAASRRARTRGIVVTALSACAGAALLAACTVGPDYQRPQAEVPP
FT                   EWHTDSFWRVAAPSHAPIAPDWWTGFADPTLATLETRALAQNQTLAAASAHYEQAKATL
FT                   ANTSAQRVPEVDFSAQASRFRISHDRPLTNYATPTQSTVQNNIQLGPTLSYDTDLFGRI
FT                   RREVEGAQASAEQSADDLANARLVLTTDLATDYFSLRELDSEIDVLNQSVKLQQKALDY
FT                   VNTEHDLGSVSGLDVLQQKSQLDATRVQAQLLLNQRAQFEHAIAALVGVPAPQFAIEPK
FT                   VLDIKPPTVPLGVPSDVLQRRPDVASAERAMAAANAQIGVAKAAFFPSLMLTPGIGWES
FT                   TEFANLLSAPTLMWTLGAAVGQVIFDGGRRAANVKFASEGYKATEANYRQTVLSAFQQV
FT                   QDGITGLSVLDGAAKQSREAVEDAQRLLSLANDRYSGGLVAYLNVIDAQESLLTSERTD
FT                   VQIHGQQLTLSVALVKALGGGWDGGAQGSAMAANEAHASNAAAMPQQAPAGGAQQKDMP
FT                   AAAR"
FT                   /protein_id="YP_003607083.1"
FT   misc_feature    374650..375978
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="BC1002_3542"
FT   misc_feature    374776..375360
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="BC1002_3542"
FT   misc_feature    375442..375921
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="BC1002_3542"
FT   gene            376228..376914
FT                   /db_xref="GeneID:9112846"
FT                   /locus_tag="BC1002_3543"
FT   CDS_pept        376228..376914
FT                   /locus_tag="BC1002_3543"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01387"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bpy:Bphyt_5873 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family; SMART: response regulator receiver"
FT                   /db_xref="GI:295699191"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:9112846"
FT                   /translation="MKLLIVEDEHKVVDYLRSGLTEQGWVVDVALDGEEGTHLATEFDY
FT                   DVIVLDVMLPKRDGFSVLKALRMRKSTPVIMLTARDHVNDRVRGLREGADDYLTKPFSF
FT                   LELVERLHALARRTRSQESTLISVGDLFVDLIGRRATRDGVRLDLTAKEFQLLSVLARR
FT                   QGDILSKTAITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPSKLLHTVRGMGYVLEVR
FT                   EEAESS"
FT                   /protein_id="YP_003607084.1"
FT   misc_feature    376234..376884
FT                   /note="heavy metal response regulator; Region:
FT                   cztR_silR_copR; TIGR01387"
FT                   /db_xref="CDD:130454"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    376237..376572
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    order(376246..376251,376378..376380,376402..376404,
FT                   376459..376461,376516..376518,376525..376530)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    376378..376380
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    order(376387..376392,376396..376404)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    376525..376533
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    376603..376884
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_3543"
FT   misc_feature    order(376675..376677,376732..376737,376789..376791,
FT                   376798..376800,376822..376827,376858..376860,
FT                   376873..376875)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_3543"
FT   gene            376911..378413
FT                   /db_xref="GeneID:9112847"
FT                   /locus_tag="BC1002_3544"
FT   CDS_pept        376911..378413
FT                   /locus_tag="BC1002_3544"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bpy:Bphyt_5872 heavy metal sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:295699192"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:9112847"
FT                   /translation="MNRSIARRLALMFALVALFVFTLVGSGLFLVLRSQLEHHLRESLD
FT                   DRTQIARIIVSHAVTPEKWRMAREKLTDMTPHDSSTMYSVTSAEPNFHFGTPVHGTVTK
FT                   SWPGGYARIAPEGGGPDMLTSTVILPANGARPEVQLQVAASYSPNLRTMRVFGSALAAL
FT                   SALGSLAVLLLSYSVTRIGLQPLTRLTRDASAVSPNNRSQRLNTASLPLELNDLANSFN
FT                   GALERLDGAYGRLESFNADVAHELRTPVTILIGQTEVALTRNRSVDDLRHTLQSNLEEF
FT                   ERMRAIINDMLFLARADQGERATGLIEVSLAAEVAHTLEFLEIPLEEARVHAKLRGDAF
FT                   ARVNRSLFGRACANLLMNAIQHCEPGATISVTIARGEGAMRDQVRVVVANPGEPIAPDV
FT                   LEHLFDRFYRAEVSRTNSRENHGLGLAIVKAIAEMHRGTVSAHSANGINTFSFSVAAPV
FT                   ISASGDIPAARANASANANASANAAGVAADTAYSSLAKGKSA"
FT                   /protein_id="YP_003607085.1"
FT   misc_feature    377013..378275
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    377610..377798
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    order(377622..377624,377634..377636,377646..377648,
FT                   377655..377657,377667..377669,377676..377678,
FT                   377727..377729,377739..377741,377748..377750,
FT                   377760..377762,377769..377771,377781..377783)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    377640..377642
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    377952..378272
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    order(377970..377972,377982..377984,377991..377993,
FT                   378072..378074,378078..378080,378084..378086,
FT                   378090..378095,378174..378185,378231..378233,
FT                   378237..378239,378252..378257,378258..378260)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    377982..377984
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3544"
FT   misc_feature    order(378084..378086,378090..378092,378174..378176,
FT                   378180..378182)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3544"
FT   gene            complement(378380..379546)
FT                   /db_xref="GeneID:9112848"
FT                   /locus_tag="BC1002_3545"
FT   CDS_pept        complement(378380..379546)
FT                   /locus_tag="BC1002_3545"
FT                   /gene_family="HOG000082707" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2067 DNA-directed DNA polymerase;
FT                   PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="GI:295699193"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017962"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="GeneID:9112848"
FT                   /translation="MNSPSRRIAHLDMDAFYASVELLRYPELRGRAVVIGGGRNSAPQL
FT                   LEDGSKRFAKLRDYAGRGVVTTSTYEARALGVFSAMGMMKAAALAPDAILLPTDFDSYR
FT                   HYSRLFKAAVRTFTDRIEDRGIDEIYIDLTDLPGESADIGRRIKEAVHQATGLTCSICV
FT                   APNKLLAKIGSELDKPDGLTILTPADIPLRVWPLPVRKVNGIGPKAAEKLTALGLATVG
FT                   DLAAADAGLLQDNFGRSYSAWLMEVAQGQDERPVVVESEPKSISRETTFERDLHPRHDR
FT                   PALSSAFTGLCVRVADDLVRKGYVGRTIGIKLRYDDFRTVTRDLTLDEPTADATEIRRA
FT                   ATECLRRVQLNRKLRLLGVRISTLSSASEQALKPRLPVQADLPFASDE"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_003607086.1"
FT   misc_feature    complement(378431..379537)
FT                   /note="DNA polymerase IV; Validated; Region: PRK02406"
FT                   /db_xref="CDD:167372"
FT                   /locus_tag="BC1002_3545"
FT   misc_feature    complement(378455..379519)
FT                   /note="DNA Polymerase IV/Kappa; Region: Pol_IV_kappa;
FT                   cd03586"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="BC1002_3545"
FT   misc_feature    complement(order(379013..379015,379166..379168,
FT                   379328..379330,379337..379339,379346..379351,
FT                   379496..379504,379508..379513))
FT                   /note="active site"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="BC1002_3545"
FT   misc_feature    complement(order(378458..378460,378467..378469,
FT                   378479..378484,378569..378571,378575..378586,
FT                   378653..378655,378737..378760,378830..378835,
FT                   378920..378940,379034..379036,379163..379168,
FT                   379172..379174,379301..379303,379436..379438))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="BC1002_3545"
FT   gene            379810..381402
FT                   /db_xref="GeneID:9112849"
FT                   /locus_tag="BC1002_3546"
FT   CDS_pept        379810..381402
FT                   /locus_tag="BC1002_3546"
FT                   /gene_family="HOG000117610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /codon_start="1"
FT                   /product="EAL domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1090 EAL-containing signal
FT                   transduction protein; PFAM: EAL domain protein; SMART: EAL
FT                   domain protein"
FT                   /db_xref="GI:295699194"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:9112849"
FT                   /translation="MIKRMSLISAYIALGCAATVLPVLISIYIANEDVARREQRDLHLY
FT                   AEKAVMRTELVTYQGFAAIADLQAEHAEPCSPEYLARAAHVIFNYRYVRDAGAYGDGRY
FT                   LCSPLFGDVRSQDVALPPPRWRSNDGYLVWFQQKNPLSDMREDIQIGRNGEYVSIDPQS
FT                   YVDVMDPAGRPIATINTEMNSIVALSTGADPDEMLHAWKRAGRVDSDEWNYAVARSETR
FT                   ALGVVVKGRRTSLLRDWPGLLATWLSIGVAMGAAFGWFAFKRISRQVSFQASLEWAISH
FT                   KTINVVYQPIVNLATNECVGVEALARWNLNGREISPHIFIALAEQHGLIQSLTDLVFDE
FT                   ALQDLTELLRSRPSFYVSVNVSGEDLRTPRFLNLITARLAGTGLGPAQIRIEATERSFL
FT                   NADVTRQTIAAFRSAGHPVYIDDFGTGYSSLAYLQTFMIDVLKIDKSFVDTIAQEAASS
FT                   IVAPHIIEMAHELGVEIVAEGIERNEQVEYLVRRGVQYGQGWLFAKAMRREELVAWLEA
FT                   RRVTHAPAQPAVQ"
FT                   /protein_id="YP_003607087.1"
FT   misc_feature    379822..381372
FT                   /note="Predicted signal transduction protein containing
FT                   sensor and EAL domains [Signal transduction mechanisms];
FT                   Region: COG4943"
FT                   /db_xref="CDD:34551"
FT                   /locus_tag="BC1002_3546"
FT   misc_feature    380626..381339
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="BC1002_3546"
FT   gene            complement(381435..382016)
FT                   /db_xref="GeneID:9112850"
FT                   /locus_tag="BC1002_3547"
FT   CDS_pept        complement(381435..382016)
FT                   /locus_tag="BC1002_3547"
FT                   /gene_family="HOG000262660" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /codon_start="1"
FT                   /product="YceI family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_5860 YceI
FT                   family protein"
FT                   /db_xref="GI:295699195"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="GeneID:9112850"
FT                   /translation="MKKSLLLAAGALAAACSFNAMAATETYLLDPTHTSPSFETDHFGG
FT                   LSIWRGKFQKANGTVVLDRAAKTGTVEATIDLSSVGIGNDKLNEELVGDKFFDTAKFPT
FT                   ATYKGTQIRFDGDKPVEVIGTLTLHGVTKPVNLKIESFKCIQHPMLKREVCGTESVATF
FT                   NRDDFGIDFGKAYGFNMKTTLHIQAEGIKQ"
FT                   /protein_id="YP_003607088.1"
FT   misc_feature    complement(381438..381959)
FT                   /note="YceI-like domain; Region: YceI; cl01001"
FT                   /db_xref="CDD:174493"
FT                   /locus_tag="BC1002_3547"
FT   gene            complement(382065..382640)
FT                   /db_xref="GeneID:9112851"
FT                   /locus_tag="BC1002_3548"
FT   CDS_pept        complement(382065..382640)
FT                   /locus_tag="BC1002_3548"
FT                   /gene_family="HOG000262661" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /codon_start="1"
FT                   /product="YceI family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YceI family protein; KEGG: bxe:Bxe_B2065
FT                   hypothetical protein"
FT                   /db_xref="GI:295699196"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="GeneID:9112851"
FT                   /translation="MKTPFYLSAHRAALTSFAALALIGANLAHADVDLAKSSVIATTKQ
FT                   MNVPVDGKFRKFSAQLNFDPAKPAAGSANVSIDTASYDLGADDYNKQAQGKEWFDSGAF
FT                   PSATFVSSSIAPAGGNQYKVTGKLTIKGKSQTVVVPVVIASQGATQTFDGSLPIKRTQF
FT                   DVGTGEWKDTSVVADEVVIKFHLVAATK"
FT                   /protein_id="YP_003607089.1"
FT   misc_feature    complement(382074..382547)
FT                   /note="YceI-like domain; Region: YceI; cl01001"
FT                   /db_xref="CDD:174493"
FT                   /locus_tag="BC1002_3548"
FT   gene            complement(382757..383320)
FT                   /db_xref="GeneID:9112852"
FT                   /locus_tag="BC1002_3549"
FT   CDS_pept        complement(382757..383320)
FT                   /locus_tag="BC1002_3549"
FT                   /gene_family="HOG000110384" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /codon_start="1"
FT                   /product="cytochrome B561"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome B561; KEGG: bpy:Bphyt_5858
FT                   cytochrome b561"
FT                   /db_xref="GI:295699197"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="GeneID:9112852"
FT                   /translation="MQTQASAPTRYHGAAIALHWLIAALMICGFYIGWIMTDIPGFTPT
FT                   KLKYFSWHKWIGVTVFALALLRVLWRATHRAPALGAATPAWQKAAAHLVHGLLYLLMLA
FT                   IPLSGYFYSSAAGIQVVYLGIVPLPTIIGPDQALKATLRTLHVLLNYTLLALVLMHVLA
FT                   ALKHQFVDRDGLLARMVPFLKTHA"
FT                   /protein_id="YP_003607090.1"
FT   misc_feature    complement(382775..383233)
FT                   /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
FT                   a subunit of cytochrome bc1, an 11-subunit mitochondrial
FT                   respiratory enzyme. Cytochrome b spans the mitochondrial
FT                   membrane with 8 transmembrane helices (A-H) in eukaryotes.
FT                   In plants and cyanobacteria; Region: Cytochrome_b_N;
FT                   cl00859"
FT                   /db_xref="CDD:174425"
FT                   /locus_tag="BC1002_3549"
FT   gene            383583..384833
FT                   /db_xref="GeneID:9112853"
FT                   /locus_tag="BC1002_3550"
FT   CDS_pept        383583..384833
FT                   /locus_tag="BC1002_3550"
FT                   /gene_family="HOG000005270" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /codon_start="1"
FT                   /product="Citrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate transporter; KEGG: bpy:Bphyt_5856
FT                   arsenical pump membrane protein"
FT                   /db_xref="GI:295699198"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="GeneID:9112853"
FT                   /translation="MNSVFLSWGIAAAATAGVITRPFKWPEAVWAVAGAVLLVVLGLLP
FT                   LHLAIEAIGKGTDVYLFLIGMMLLSEVGRREGLFDWVAVLAVNHANSSPRKLFVLVYLF
FT                   GVVITAFLSNDATAVVLTPAVFAAAKKAKTPPLPLLFVCAFVANAASFVLPISNPANIV
FT                   LYGNHTPPLGPWMLRFALPSVLSIGATFVMLRWTQRDALAGVCEANLEAVELSASGRVA
FT                   LAGIAVTAGALLTVSAYDIQLGLPTAILGTLTALVVLIKERKSPLPMIREISWNVLPLV
FT                   AGLFVLVEMLDHTGVISTFAGALRRATEHNEMEAAAWAGTSIAALSNLINNLPSGLIAS
FT                   STVMQAQSPERVIDAFLIGVDLGPNLSISGSLATILWLNAIRREGEDVGFMKFLRVGVL
FT                   VMVPALVLALGARILTG"
FT                   /protein_id="YP_003607091.1"
FT   misc_feature    383598..384767
FT                   /note="Anion permease ArsB.  These permeases have been
FT                   shown to export arsenate and antimonite in eubacteria and
FT                   archaea.  A typical ArsB permease contains 8-13
FT                   transmembrane helices and can function either independently
FT                   as a chemiosmotic transporter or as a...; Region:
FT                   ArsB_permease; cd01118"
FT                   /db_xref="CDD:29732"
FT                   /locus_tag="BC1002_3550"
FT   misc_feature    order(383631..383642,383661..383702,383751..383804,
FT                   383874..383924,383928..383981,384000..384005,
FT                   384006..384062,384126..384170,384258..384296,
FT                   384321..384362,384399..384455,384525..384572,
FT                   384639..384698)
FT                   /note="transmembrane helices; other site"
FT                   /db_xref="CDD:29732"
FT                   /locus_tag="BC1002_3550"
FT   gene            complement(384822..385100)
FT                   /db_xref="GeneID:9112854"
FT                   /locus_tag="BC1002_3551"
FT   CDS_pept        complement(384822..385100)
FT                   /locus_tag="BC1002_3551"
FT                   /gene_family="HOG000058805" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5855 hypothetical protein"
FT                   /db_xref="GI:295699199"
FT                   /db_xref="GeneID:9112854"
FT                   /translation="MSYQDIDREIAHLEVVFNALSARDRFPLSYWHGRLHALNRSSMVP
FT                   AQRQRVAHLEARLRSVGAQLDQLAGASRIGSRAGPRMDHRSGVRSAR"
FT                   /protein_id="YP_003607092.1"
FT   gene            complement(385440..385775)
FT                   /db_xref="GeneID:9112855"
FT                   /locus_tag="BC1002_3552"
FT   CDS_pept        complement(385440..385775)
FT                   /locus_tag="BC1002_3552"
FT                   /gene_family="HOG000061331" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5854"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5854 hypothetical protein"
FT                   /db_xref="GI:295699200"
FT                   /db_xref="GeneID:9112855"
FT                   /translation="MSIRLACASTFTAIGLACSSAAYARVVVYLPAAVVYAPPPRPVYY
FT                   PVPVNPVYVSAPPVAVPIAAATIVAAPPELPANTPAAAVVVPPAPNYAMVPAPTVSYAQ
FT                   PLVNAPH"
FT                   /protein_id="YP_003607093.1"
FT   gene            386023..386316
FT                   /db_xref="GeneID:9112856"
FT                   /locus_tag="BC1002_3553"
FT   CDS_pept        386023..386316
FT                   /locus_tag="BC1002_3553"
FT                   /gene_family="HOG000056420" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5853"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5853 hypothetical protein"
FT                   /db_xref="GI:295699201"
FT                   /db_xref="GeneID:9112856"
FT                   /translation="MKKLLATLLLCCASTVTFAQAAAPQGITQQRMERMEQQLQTRFST
FT                   ANTTHDGKLTRDQAAAGMPMLARHFDEIDTQKAGYITLPQIEAFMQERAAAH"
FT                   /protein_id="YP_003607094.1"
FT   misc_feature    386149..386277
FT                   /note="EF-hand, calcium binding motif; A diverse
FT                   superfamily of calcium sensors and calcium signal
FT                   modulators; most examples in this alignment model have 2
FT                   active canonical EF hands. Ca2+ binding induces a
FT                   conformational change in the EF-hand motif, leading...;
FT                   Region: EFh; cl09501"
FT                   /db_xref="CDD:158540"
FT                   /locus_tag="BC1002_3553"
FT   misc_feature    order(386155..386163,386182..386196)
FT                   /note="pseudo EF-hand loop; other site"
FT                   /db_xref="CDD:28934"
FT                   /locus_tag="BC1002_3553"
FT   misc_feature    order(386209..386211,386218..386220,386230..386232)
FT                   /note="peptide binding pocket; other site"
FT                   /db_xref="CDD:28934"
FT                   /locus_tag="BC1002_3553"
FT   misc_feature    order(386242..386244,386248..386250,386254..386256,
FT                   386275..386277)
FT                   /note="Ca2+ binding site; other site"
FT                   /db_xref="CDD:28934"
FT                   /locus_tag="BC1002_3553"
FT   gene            386344..387057
FT                   /db_xref="GeneID:9112857"
FT                   /locus_tag="BC1002_3554"
FT   CDS_pept        386344..387057
FT                   /locus_tag="BC1002_3554"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5849 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="GI:295699202"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:9112857"
FT                   /translation="MERPARIIVLDDEAELRNMLLRFLRGHGFDVRAAEDGKRLNRYLE
FT                   REPFDLLILDLMIGEENGLEICAKLRAQGQTLPILMLTAKGDPLDRVTGLETGADDYLA
FT                   KPFLPRELVARVNALLRRQKMAAGDVTVTSQRVRFGDFTLDVGKQELSRAGEPLEIHSA
FT                   QMLLLVALASSPNRAVSRDNLLARARGRDHDALDRSIDVQVLRLRQIVEDDPSKPRFIR
FT                   TVWGVGYMLVADVES"
FT                   /protein_id="YP_003607095.1"
FT   misc_feature    386344..387045
FT                   /note="osmolarity response regulator; Provisional; Region:
FT                   ompR; PRK09468"
FT                   /db_xref="CDD:169897"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    386365..386703
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    order(386374..386379,386506..386508,386530..386532,
FT                   386590..386592,386647..386649,386656..386661)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    386506..386508
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    order(386515..386520,386524..386532)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    386656..386664
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    386752..387036
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_3554"
FT   misc_feature    order(386824..386826,386881..386886,386938..386940,
FT                   386947..386949,386971..386976,387010..387012,
FT                   387025..387027)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_3554"
FT   gene            387054..388424
FT                   /db_xref="GeneID:9112858"
FT                   /locus_tag="BC1002_3555"
FT   CDS_pept        387054..388424
FT                   /locus_tag="BC1002_3555"
FT                   /gene_family="HOG000218774" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5848 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:295699203"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:9112858"
FT                   /translation="MMRSLSRRLLPRTLLARNIALLIALVMLSQICSIVVLLHFVQRPR
FT                   VERAAAVFATYVTTLDNLLAATPPASRAALTARLDAREQLPPEATDTPPHDLLRAYSTY
FT                   QRGVFIDSLQKYLPADMPARWQTEGAQRLWIRMHGSLAGAGNAAGLANAPYWIALPVPE
FT                   DAQGSGLEAAIFLSLGLGVLAALAGYAIQLHLNEPLHELTQAARRVSAGDLPAPLPTDG
FT                   PAEIAAVGSAFNQMTRALRDAEATRALMLAGISHDIRTPLTKLRLSMAMAMPQGADSSF
FT                   VIAAESYLDQIETILQQFMDYAGSGEREEAQPGDLNALIERLAGDFAGLGHEFELSLGS
FT                   LPAVPYRPISMMRLLMNLMQNAIVYGGSGLAVRTWATQDTVTVAVADRGKGLTAEELEK
FT                   LKAPFQRGRNARTHSGGTGLGLSIVERIARLHGGSLQFHPRDGGGLEVWVVLPLKAP"
FT                   /protein_id="YP_003607096.1"
FT   misc_feature    387636..387779
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    order(387636..387641,387648..387653,387657..387662,
FT                   387669..387674,387678..387680,387726..387731,
FT                   387735..387740,387747..387752,387756..387761,
FT                   387768..387773)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    387783..387962
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    order(387801..387803,387813..387815,387825..387827,
FT                   387834..387836,387846..387848,387855..387857,
FT                   387903..387905,387912..387914,387927..387929,
FT                   387936..387938,387948..387950)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    387819..387821
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    388104..388406
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    order(388122..388124,388134..388136,388143..388145,
FT                   388206..388208,388212..388214,388218..388220,
FT                   388224..388229,388305..388316,388362..388364,
FT                   388368..388370,388383..388388,388392..388394)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    388134..388136
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3555"
FT   misc_feature    order(388218..388220,388224..388226,388305..388307,
FT                   388311..388313)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3555"
FT   gene            complement(388461..388727)
FT                   /db_xref="GeneID:9112859"
FT                   /locus_tag="BC1002_3556"
FT   CDS_pept        complement(388461..388727)
FT                   /locus_tag="BC1002_3556"
FT                   /gene_family="HOG000061330" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2057"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2057 hypothetical protein"
FT                   /db_xref="GI:295699204"
FT                   /db_xref="GeneID:9112859"
FT                   /translation="MPAQHDEAPGAQDTNDKPKRKTLSLSVRNLLMVAIGVLMFAIVSG
FT                   VVLYNPIMYGDEIPNFGIILMLTVPVIAGVAFRVGLDAWLDRE"
FT                   /protein_id="YP_003607097.1"
FT   gene            complement(388882..389208)
FT                   /db_xref="GeneID:9112860"
FT                   /locus_tag="BC1002_3557"
FT   CDS_pept        complement(388882..389208)
FT                   /locus_tag="BC1002_3557"
FT                   /gene_family="HOG000061338" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5541 putative insertion element
FT                   transposase"
FT                   /db_xref="GI:295699205"
FT                   /db_xref="GeneID:9112860"
FT                   /translation="MLDLPLSDDAWARISHLFQQDPKKRLGRPARPPREILDAILWVVT
FT                   RNEKWHRLPGTFPPSQTCYIRWLQWRRTGLMSAILDELGLSGCALASAAGADSAPAAGP
FT                   KADA"
FT                   /protein_id="YP_003607098.1"
FT   misc_feature    complement(389128..>389202)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="BC1002_3557"
FT   gene            389680..389781
FT                   /db_xref="GeneID:9112861"
FT                   /locus_tag="BC1002_3558"
FT                   /pseudo
FT   gene            389780..390016
FT                   /db_xref="GeneID:9112862"
FT                   /locus_tag="BC1002_3559"
FT                   /pseudo
FT   gene            complement(390066..392726)
FT                   /db_xref="GeneID:9112863"
FT                   /locus_tag="BC1002_3560"
FT   CDS_pept        complement(390066..392726)
FT                   /locus_tag="BC1002_3560"
FT                   /gene_family="HOG000217841" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: bpy:Bphyt_5841 PAS/PAC sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; response regulator receiver"
FT                   /db_xref="GI:295699206"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="GeneID:9112863"
FT                   /translation="MPFPAQDYGCAGWRGEMARRISEFDWRATSLGAIENWQRSLTSTV
FT                   LTMLASPMPLVLLWDEPGYMIYNDAYAIFAGGRHPYLLGRPVEDGWPEVADFNRHVMVT
FT                   CLAGGTLSYRDKALVLLRDGKPEDVWMDLYYSPVAGDSGAPAGVLSMVVETTGRVLTER
FT                   LRQQAETELHETNERLQLALNTGAVLGTWVLDVRTGEVTGDERFARTFSFGRDTASKGV
FT                   ARDAATQIIHPDDQQLNDRLTAEAIRSGEPFRAEYRIRRPDGGYMWVQANGRCQFDEHG
FT                   EPTRFPGVLIDIHERKIAEQQLLQLTETLEQRVADSIAARALAEEQLRQAQKMEAIGSL
FT                   TGGVAHDFNNVLQVINGNLQMLAADADDNPVTQRRLSAATDAVKRGAKLAAHLLAFARR
FT                   QPLSPTVLNPRRLLTGMSEMLHRALGETVRIDTVLSDDLWNVQVDRNQLENALLNLAIN
FT                   ARDAMRADGALTVRATNRTLDAAFCRGKPELSPGEYVEFSVADTGSGMPPEVLQHVFEP
FT                   FFTTKPDGHGTGLGLSMVFGFARQSGGHVSIESEVGHGTTVSLFFPRCCEAETPETVDG
FT                   TAASVGGGETILVVEDDADVRLTAVEMLAQLGYKVLTASNGDAALEFIDSDVPIDLLFT
FT                   DVVMPGKLKSVELAQRAAARTPPLPTLFTSGYTRDEIVHHGKLDAGITLLSKPYRRDDL
FT                   ARLVRNVLRAGAARADRAADMRETRIAACVPPAAYESANMYGATQAPPKGLKKEPKRKP
FT                   QKATQPRAAQEAARVLFVEDDTESREALGELLGALGLACTAVASAEAALPLASTQRYDV
FT                   LLTDLKLPGMSGDELARAVRQVQPAIRVLLVSGYGRSAEIGAAIPGARLLGKPLDIAQL
FT                   RHELAQWLDHTEAAS"
FT                   /protein_id="YP_003607099.1"
FT   misc_feature    complement(391857..392117)
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(391839..391961)
FT                   /note="Motif C-terminal to PAS motifs (likely to contribute
FT                   to PAS structural domain); Region: PAC; smart00086"
FT                   /db_xref="CDD:128397"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(391533..391727)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(391548..391550,391560..391562,
FT                   391569..391571,391581..391583,391590..391592,
FT                   391602..391604,391653..391655,391662..391664,
FT                   391674..391676,391683..391685,391695..391697,
FT                   391707..391709))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(391689..391691)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(391062..>391508)
FT                   /note="adaptive-response sensory kinase; Validated; Region:
FT                   PRK09303"
FT                   /db_xref="CDD:169790"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(391041..>391253)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(391053..391055,391059..391064,
FT                   391077..391079,391083..391085,391131..391142,
FT                   391209..391214,391218..391220,391224..391226,
FT                   391230..391232))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(391134..391136,391140..391142,
FT                   391212..391214,391218..391220))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390621..390965)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(390663..390668,390675..390677,
FT                   390732..390734,390792..390794,390819..390821,
FT                   390951..390956))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390819..390821)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(390792..390800,390807..390812))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390660..390668)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390090..390422)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(390132..390137,390144..390146,
FT                   390195..390197,390255..390257,390279..390281,
FT                   390408..390413))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390279..390281)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(order(390255..390263,390267..390272))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   misc_feature    complement(390129..390137)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_3560"
FT   gene            complement(393047..397699)
FT                   /db_xref="GeneID:9112864"
FT                   /locus_tag="BC1002_3561"
FT   CDS_pept        complement(393047..397699)
FT                   /locus_tag="BC1002_3561"
FT                   /gene_family="HOG000263206" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /codon_start="1"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   KEGG: bxe:Bxe_B2043 putative cellulose synthase operon
FT                   protein C"
FT                   /db_xref="GI:295699207"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterP