(data stored in ACNUC8465 zone)

HOGENOMDNA: BURSC_3

ID   BURSC_3; SV 1; empty ; DNA; empty ; PRO; 1282816 BP.
XX
AC   NC_014119;
XX
PR   Project: 42523;
XX
DE   Burkholderia sp. CCGE1002 chromosome chromosome 3, complete sequence.
XX
OS   Burkholderia sp. CCGE1002
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-1282816
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Ovchinnikova,G., Martinez-Romero,E.,
RA   Hernandez,M.A.R., Tiedje,J.M. and Woyke,T.;
RT   "Complete sequence of chromosome3 of Burkholderia sp. CCGE1002";
RL   Unpublished
XX
RN   [2]
RP   1-1282816
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-MAY-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1282816
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Ovchinnikova,G., Martinez-Romero,E.,
RA   Hernandez,M.A.R., Tiedje,J.M. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (19-APR-2010) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002015.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085555
CC   Source DNA and organism available from Esperanza Martinez-Romero
CC   (Centro de Ciencias Genomicas--http://ccg.unam.mx)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Burkholderia sp. CCGE1002 is a mimosa occidentalis nodule isolate
CC   from Nayarit, Tepic, Mexico. Site of isolation is Latitude: 21.604,
CC   Longitude: -104.952. Additionally, it forms nodules in Phaseolus
CC   vulgaris beans. It contributes to Nitrogen fixation and CO2
CC   fixation in the tropics.
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1282816
FT                   /strain="CCGE1002"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia sp. CCGE1002"
FT                   /chromosome="3"
FT                   /db_xref="taxon:640511"
FT   gene            8..337
FT                   /db_xref="GeneID:9092146"
FT                   /locus_tag="BC1002_5564"
FT   CDS_pept        8..337
FT                   /locus_tag="BC1002_5564"
FT                   /gene_family="HOG000059074" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0169"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0169 hypothetical protein"
FT                   /db_xref="GI:295680426"
FT                   /db_xref="GeneID:9092146"
FT                   /translation="MDIWLGLLAAPTAVLATQSVDYALIRLACASGAAWPMHAVSAAAF
FT                   AFCAFATWLAYGRWRAERSRGTPAYAARAARAGFFALMAMIVGALSALLQLAMWFPQWL
FT                   LPACR"
FT                   /protein_id="YP_003609000.1"
FT   sig_peptide     8..58
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.443 at
FT                   residue 17"
FT                   /locus_tag="BC1002_5564"
FT   gene            334..1284
FT                   /db_xref="GeneID:9090942"
FT                   /locus_tag="BC1002_5565"
FT   CDS_pept        334..1284
FT                   /locus_tag="BC1002_5565"
FT                   /gene_family="HOG000219878" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /codon_start="1"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: bph:Bphy_4795 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680427"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="GeneID:9090942"
FT                   /translation="MRRHIRWFACAAWLPGATAAAHGLSVADRAALSFGWSFEPWIVAL
FT                   MALSIGGYLIGFARLRRRSRAQRRGAGSRRLHLLAFAGGWSALGLALMSPLDTLSGALF
FT                   SAHMVQHESMMLIAAPLCVAGRPLAVWMWALPRRARMALGRAVRARPFARAWRCLSAPL
FT                   VAWALHAVALWAWHAPTLFDAALAHPSVHTLQHASFLLSALLFWWTVTGDGARRGNGGH
FT                   AMLSLFTTMVHTSALGALITLAPGLWYPSYVEPCAALGIDPLHDQQLGGLIMWVPGALA
FT                   YLTGGLLVASRWLSRADRQPAFTQDAARARGEGAR"
FT                   /protein_id="YP_003609001.1"
FT   sig_peptide     334..399
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.402 at
FT                   residue 22"
FT                   /locus_tag="BC1002_5565"
FT   misc_feature    568..1221
FT                   /note="Cytochrome c oxidase caa3 assembly factor
FT                   (Caa3_CtaG); Region: Caa3_CtaG; cl09173"
FT                   /db_xref="CDD:158444"
FT                   /locus_tag="BC1002_5565"
FT   gene            1281..2642
FT                   /db_xref="GeneID:9090943"
FT                   /locus_tag="BC1002_5566"
FT   CDS_pept        1281..2642
FT                   /locus_tag="BC1002_5566"
FT                   /gene_family="HOG000178965" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /codon_start="1"
FT                   /EC_number="1.1.99.3"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4796 gluconate 2-dehydrogenase
FT                   (acceptor); PFAM: cytochrome c class I"
FT                   /db_xref="GI:295680428"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="GeneID:9090943"
FT                   /translation="MMRRRTVVRAAAAGALLSVCVGLLAIAFSGGATATDSAAASTDAQ
FT                   ARGGAASFDPSRLARGEYLAKAADCAGCHTAPQGGAPYAGGLGMGSPFGTIVSSNITPD
FT                   PQYGIGRYTYEEFERALREGVARGGKRLYPAMPYVSFSKLSDEDVHALYEFMLHGVAPI
FT                   AKPTPRSDVAFPFNQRWALRFWQMLFVPSQPYVPRPQSDAIWNRGAYLVQGAGHCGACH
FT                   TPRGMFYQESGLDESSSDYLVGGVNDHWFAPNLTGDMGSGLGRLTAADIAAFLKTGHGA
FT                   GVVAYGSMVEQVEDSSQYLTDEDLHAIAHYLKSLPAQQPSGTYTGGADPARSSVNGNRV
FT                   ADSLSVGFNVYQSFCASCHRADGRGVPNAFPALAGNPSVIAEDTTSLIRLLIEGGNSPT
FT                   TQSGPPRQSMPAFATTLADVEIAQVLTYIRGAWGNNAQPVTANDVATLRSELHK"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /protein_id="YP_003609002.1"
FT   sig_peptide     1281..1385
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 35"
FT                   /locus_tag="BC1002_5566"
FT   misc_feature    1779..2225
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="BC1002_5566"
FT   misc_feature    2187..2627
FT                   /note="Cytochrome c, mono- and diheme variants [Energy
FT                   production and conversion]; Region: CccA; COG2010"
FT                   /db_xref="CDD:32193"
FT                   /locus_tag="BC1002_5566"
FT   misc_feature    2319..2567
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="BC1002_5566"
FT   gene            complement(2662..3414)
FT                   /db_xref="GeneID:9090944"
FT                   /locus_tag="BC1002_5567"
FT   CDS_pept        complement(2662..3414)
FT                   /locus_tag="BC1002_5567"
FT                   /gene_family="HOG000261041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /codon_start="1"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bpd:BURPS668_A1972 metal-dependent hydrolase"
FT                   /db_xref="GI:295680429"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="GeneID:9090944"
FT                   /translation="MTLMHDPGIDQPRMTFARERELRIGTYNLHGAVGIDGKFAPKRIG
FT                   DVLTEIDADIFALQEVPLGGASSPDVLALLQRMTGLDAVAGPTFDTPARRFGNAVLTRY
FT                   PVRAVRTLDLSFKSREPRGALDADIDCNGELWRVVATHLGLASSERRAQVEQVLQRFDT
FT                   PALPVILLGDLNEWFVYGRTLRRLVTHFRRATALRTFPTRFPLFALDRIWVHPGERLLR
FT                   VDVHRTALSRVASDHYPLIAHISASVNG"
FT                   /protein_id="YP_003609003.1"
FT   misc_feature    complement(2683..3351)
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:174238"
FT                   /locus_tag="BC1002_5567"
FT   gene            complement(3414..5735)
FT                   /db_xref="GeneID:9090945"
FT                   /locus_tag="BC1002_5568"
FT   CDS_pept        complement(3414..5735)
FT                   /locus_tag="BC1002_5568"
FT                   /gene_family="HOG000268442" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /codon_start="1"
FT                   /product="SNARE associated Golgi protein-associated
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpl:BURPS1106A_A1879 phospholipase D
FT                   domain-containing protein; PFAM: SNARE associated Golgi
FT                   protein; phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase"
FT                   /db_xref="GI:295680430"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="GeneID:9090945"
FT                   /translation="MQDPLYPSDAARIVPIYESFFEPGRNCESVRHANRFTLLIDGADY
FT                   FRVLREAITRAERTVFILGWDIDSRMRLTPEGSNDGFPEALGDFLHAVAAKKHLLHVYI
FT                   LAWDFAMLYAFEREWLPVFKMGWRTHRRIAFQMDGKHPLGGSHHQKIVVIDDCLAFVGG
FT                   LDLTRSRWDTQQHHADDPLRRDANGARYQPCHDVHSMFDGEAAREIGILARERWARACK
FT                   SKPAIRAQPVPPTQDPWPPSRGVELENVDIAISLTEPAYMGRESKQQIRTQYLDAIARA
FT                   RRSIYIENQYFTSAPIGAALSESLARENGPELTIVVPRNQTGWLQKVTMGVLRARLHGM
FT                   LKEADKYGHYRLLSPDVPGLGESIVNVHSKLMIVDDELLIVGSANLNNRSMMLDSECNV
FT                   SIDAGADARIRRAIAKMRDTLLAEHLGCEVADIVRERDARGSVTAAIRALQRDRDEHRT
FT                   LVDLDPQVSPELDRLIPPDALIDPETPIAAKELIDQFVPAEKARPLIGRYALLGVLALL
FT                   VVGFAAAWHWSPLAGYLNLKSLANAVRQIEALPLAPLWIVLAYIAAAVVCAPVTLLIAT
FT                   MGVVFGAAWGGLYAFIGTTVAAATSFWIGNRLGRDAVRKLAGARVNRLSERVAKRGIVA
FT                   VVVLRLLPVAPFAIVNLVAGASHVRMRDFIIGTMLGMGPGIFLTVAFAHQLVASLRRPT
FT                   AGSFAVLIGIGAVLIGLSMLLQRFLGRSTRSDPHEGAPSDDDKPRASDEAERAQRLRDH
FT                   SGMPRDASGKTSTQCQDEAS"
FT                   /protein_id="YP_003609004.1"
FT   misc_feature    complement(5160..5624)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(order(5208..5210,5241..5243,5247..5249,
FT                   5286..5288,5292..5294))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(order(5241..5243,5247..5252,5271..5273,
FT                   5286..5288,5292..5294))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(4539..4991)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(order(4548..4550,4581..4583,4587..4589,
FT                   4626..4628,4632..4634))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(order(4581..4583,4587..4592,4611..4613,
FT                   4626..4628,4632..4634))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="BC1002_5568"
FT   misc_feature    complement(3570..4163)
FT                   /note="SNARE associated Golgi protein; Region: SNARE_assoc;
FT                   cl00429"
FT                   /db_xref="CDD:174199"
FT                   /locus_tag="BC1002_5568"
FT   gene            complement(5874..6125)
FT                   /db_xref="GeneID:9090946"
FT                   /locus_tag="BC1002_5569"
FT   CDS_pept        complement(5874..6125)
FT                   /locus_tag="BC1002_5569"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:mlr4527"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mlr4527 hypothetical protein"
FT                   /db_xref="GI:295680431"
FT                   /db_xref="GeneID:9090946"
FT                   /translation="MSHVVVERSFPTPQSDAELSVVEDRLAPCSELYGVVWKRSVVSVD
FT                   RRHMICEYDAPDAETVRKVQREAGATFDHIWSGEVIES"
FT                   /protein_id="YP_003609005.1"
FT   gene            complement(6168..9338)
FT                   /db_xref="GeneID:9090947"
FT                   /locus_tag="BC1002_5570"
FT   CDS_pept        complement(6168..9338)
FT                   /locus_tag="BC1002_5570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, putative ATPase,
FT                   winged helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; ATPase; KEGG: dsy:DSY3806
FT                   hypothetical protein"
FT                   /db_xref="GI:295680432"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="GeneID:9090947"
FT                   /translation="MGNVEITDASCGPLCIRLLGELELTRGGARVTLPASRRTRALLGY
FT                   LVLSGAPVSRPALCDMLWEGPDDPRAALRWSLSKLRPLLDDASHERIVASRTHVAFEAA
FT                   GAVVDVTRLQALLAGGAERTPVAALQEAAQMLRGDFLGGLELPGCYRFYNWCIGQRERF
FT                   GRIRGTVLRALVATLATDVPRALQYGHELIDADPLDETGHAALIALLEAADRHADAQEH
FT                   HRYARELLHREVGARACASLDDAVQRMRDDTRRSRANHGGDRMPRDEHRTPEDRLRTAV
FT                   QNAHASGGDQQPVSRLPLVGREVERARLDDLLASSSGAGTLTLLTGEPGIGKTRLLEYF
FT                   SECASNAAYRVLRARCYEAEAIRPYGIWIDALRDLASDAAPPVDEALAPLVRATVNSAS
FT                   GIQRDEGGRERLFEAVVALLGRLSVEQQLAFVLDDLQWLDEASAALLHFVLRRLAPGLP
FT                   VVFVAAARPAETEDNRFAAKLLQSLAHDSKMTRVELAPLSADEVAALLGASRSDLRVEQ
FT                   AVKGSGGNPLYVLELARSTQAPPETATLTIEALIADRLTPLDARTRDLLSFAACIGREF
FT                   APEQFAQLLDRPLVDVLSSLAELERRGVLTAASQTGFDFTHDLLRQTVYRMLSQPHRRA
FT                   IHHQIAQQLLASSTHDSRLHGEVVHHATLAGDSRMTALACVEASQHCVAVFAASEARAV
FT                   ADRGLAHARSLPRGSERVRLEIQLLTARLVALASSGRTCPASMEQEFEDAIQQAEALSL
FT                   QAEVVQGLHSLSWLTQQANDVERTREVTIRAAAAARKADATTRCKQLANTGRCLLELER
FT                   ELPRARSLLLEAQALAELLDLRVVELMWGAALLARADGALDTGSAQLNDAVRQARAIGD
FT                   HWREYQCLVWLATVDFERGAYLQVTQLAGAIVVAARRMGYSGAPYANVLSAIASLRLTG
FT                   GDVRDCRFEGLDTLREADDKRHLCYVLNEVALICLDRRASEHAIVHAREALEAAEILNS
FT                   PTGRIVATAVLVEAALARSEMESAESLLASLRELLGGEPISPRSHAALQRLHQRYPSIT
FT                   TIVQTPAD"
FT                   /protein_id="YP_003609006.1"
FT   misc_feature    complement(<8634..9248)
FT                   /note="DNA-binding transcriptional activator of the SARP
FT                   family [Signal transduction mechanisms]; Region: DnrI;
FT                   COG3629"
FT                   /db_xref="CDD:33428"
FT                   /locus_tag="BC1002_5570"
FT   misc_feature    complement(<8283..8528)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_5570"
FT   misc_feature    complement(<7401..8447)
FT                   /note="Predicted ATPase [General function prediction only];
FT                   Region: COG3899"
FT                   /db_xref="CDD:33687"
FT                   /locus_tag="BC1002_5570"
FT   misc_feature    complement(order(8337..8345,8355..8360))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="BC1002_5570"
FT   gene            9474..9830
FT                   /db_xref="GeneID:9090948"
FT                   /locus_tag="BC1002_5571"
FT                   /pseudo
FT   gene            complement(9902..10441)
FT                   /db_xref="GeneID:9090949"
FT                   /locus_tag="BC1002_5572"
FT   CDS_pept        complement(9902..10441)
FT                   /locus_tag="BC1002_5572"
FT                   /gene_family="HOG000058949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /codon_start="1"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   bpy:Bphyt_4200 hypothetical protein"
FT                   /db_xref="GI:295680433"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="GeneID:9090949"
FT                   /translation="MKWPSKWMRAVLAVIAVAALLVVPLPASVNLTTKIATVISIERPV
FT                   AVVFDYVTTPAHWPDWHPSSLSVTGAIGHSLNVGEQVTEEFRVAGRRGSVLWTVAVRDR
FT                   PHKWVIVGAIDGKPAGTVSYALTPVASRTRFEREFVYRAPTLWFALVNVLFVRTRIQQE
FT                   SEEAVARLKKALETMP"
FT                   /protein_id="YP_003609007.1"
FT   sig_peptide     complement(10352..10441)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.923 at
FT                   residue 30"
FT                   /locus_tag="BC1002_5572"
FT   misc_feature    complement(9914..10345)
FT                   /note="Polyketide cyclase / dehydrase and lipid transport;
FT                   Region: Polyketide_cyc2; cl10449"
FT                   /db_xref="CDD:175214"
FT                   /locus_tag="BC1002_5572"
FT   gene            complement(10571..10858)
FT                   /db_xref="GeneID:9090950"
FT                   /locus_tag="BC1002_5573"
FT   CDS_pept        complement(10571..10858)
FT                   /locus_tag="BC1002_5573"
FT                   /gene_family="HOG000257316" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05899"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF861 cupin_3"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF861 cupin_3;
FT                   KEGG: bph:Bphy_6574 protein of unknown function DUF861
FT                   cupin_3"
FT                   /db_xref="GI:295680434"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="GeneID:9090950"
FT                   /translation="MKVQQIKQSIALQGLEDWSTAGLARTPEIRVSEPGIYRRSVRQSE
FT                   VMHFLSGRGRFTPDGEDAIHFTGGDTLFFEAHTEGTWEVEETMRKVYVIF"
FT                   /protein_id="YP_003609008.1"
FT   misc_feature    complement(10574..>10774)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_5573"
FT   gene            11046..11234
FT                   /db_xref="GeneID:9090951"
FT                   /locus_tag="BC1002_5574"
FT   CDS_pept        11046..11234
FT                   /locus_tag="BC1002_5574"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: similar to T cell receptor alpha"
FT                   /db_xref="GI:295680435"
FT                   /db_xref="GeneID:9090951"
FT                   /translation="MSATRRIDPRHRGYQAPLDKTTRYPAEHVTLTASSRKRLRRCAPH
FT                   RKVGRGKVGVGGKSSGG"
FT                   /protein_id="YP_003609009.1"
FT   gene            complement(11560..12263)
FT                   /db_xref="GeneID:9090952"
FT                   /locus_tag="BC1002_5575"
FT                   /pseudo
FT   gene            12830..13318
FT                   /db_xref="GeneID:9090953"
FT                   /locus_tag="BC1002_5576"
FT   CDS_pept        12830..13318
FT                   /locus_tag="BC1002_5576"
FT                   /gene_family="HOG000124623" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4245 hypothetical protein"
FT                   /db_xref="GI:295680436"
FT                   /db_xref="GeneID:9090953"
FT                   /translation="MNRLMLSNPTIELLLRMSRSAALVGTWLFCPTIQSAMATEKAETM
FT                   YQQCRSQQSTARQRDCYPAVLRQAEIELAAAGNEARADLVELESISEGSRAVHPVLAFD
FT                   EAARDFGAFRDAESRRVRASYGSGNGGDLAAYATSIEMTIARARQLAGEAGARRATGY"
FT                   /protein_id="YP_003609010.1"
FT   sig_peptide     12830..12946
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.958 at
FT                   residue 39"
FT                   /locus_tag="BC1002_5576"
FT   misc_feature    12974..13279
FT                   /note="Protein of unknown function (DUF1311); Region:
FT                   DUF1311; cl01530"
FT                   /db_xref="CDD:154454"
FT                   /locus_tag="BC1002_5576"
FT   gene            13500..13776
FT                   /db_xref="GeneID:9090954"
FT                   /locus_tag="BC1002_5577"
FT                   /pseudo
FT   gene            13866..14921
FT                   /db_xref="GeneID:9090955"
FT                   /locus_tag="BC1002_5578"
FT   CDS_pept        13866..14921
FT                   /locus_tag="BC1002_5578"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:295680437"
FT                   /db_xref="GeneID:9090955"
FT                   /translation="MVTVKTKDWGLQFKHLEAHIGNVAAAVKQHEADLKDELSKVAAGG
FT                   GQHAYARHGWQTGWQAQMVRAVAGKTPDQAFDPFGCNPEIRTWGRVMIADPAGLVIGRY
FT                   GLGADGRRVVAPVQPTFTPLPDTAAPPKGASAGHFISPMAQHLAMTSSKTKLKAWGVWT
FT                   RAQRKKGTSTAFHGVRRVALTVKGPGPLLGLGFTLPKTATPRSEEEARWLLEAFERRAT
FT                   FKQVMDGCPFSSAQARKSLQIALETLHHGSTQALRSSNPIAFPQLSSFFDALELEVQGS
FT                   YGVLSVWDRVASPSGWSLVTAYATGGPTLTEQIELSVDGSTKPDGALTGMVSDGVTTKT
FT                   GTVKDGKVVLT"
FT                   /protein_id="YP_003609011.1"
FT   gene            complement(15261..16253)
FT                   /db_xref="GeneID:9090956"
FT                   /locus_tag="BC1002_5579"
FT   CDS_pept        complement(15261..16253)
FT                   /locus_tag="BC1002_5579"
FT                   /gene_family="HOG000251307" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /codon_start="1"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_4868 TRAP dicarboxylate transporter,
FT                   DctP subunit; TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: Extracellular solute-binding protein, family
FT                   7"
FT                   /db_xref="GI:295680438"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="GeneID:9090956"
FT                   /translation="MNNKFAFSRVSMIVAAAALAFSTMSAEARVFRVAEVHGDTFPTNV
FT                   AVKHMGEEISKATNGKDTVKVFGNSALGSEKDTIDQVRIGALDMTRANGASFTEIVPEI
FT                   MIPSLPFLFRDIDHFRKVMYGPEGQKILDAFTAKGMIALTFYESGARSMYAKKAIKSPA
FT                   DMKGLKVRVQPSELVVDEIKAMGGIPTPMPTAEVYTGLKTGIVDSAENNFPTYEEGKHF
FT                   EVATVYSETQHTMTPEVLVFSKKVWDTLTPQEQQIIKKAAADSVPVYQQLWTAREAEAQ
FT                   KTVTAGGATIIPAAQIDRAAFVKATQPVWAKYEKTPEMKQIVDEIQAIK"
FT                   /protein_id="YP_003609012.1"
FT   sig_peptide     complement(16176..16253)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.648 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5579"
FT   misc_feature    complement(15264..16169)
FT                   /note="Bacterial extracellular solute-binding protein,
FT                   family 7; Region: SBP_bac_7; cl00710"
FT                   /db_xref="CDD:153950"
FT                   /locus_tag="BC1002_5579"
FT   gene            complement(16727..17746)
FT                   /db_xref="GeneID:9090957"
FT                   /locus_tag="BC1002_5580"
FT   CDS_pept        complement(16727..17746)
FT                   /locus_tag="BC1002_5580"
FT                   /gene_family="HOG000229012" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5162"
FT                   /codon_start="1"
FT                   /product="putative ABC transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5162 putative ABC transporter"
FT                   /db_xref="GI:295680439"
FT                   /db_xref="GeneID:9090957"
FT                   /translation="MKMTTIAVALCIAAASAGASAQVATGDTSSQKLALSNNYAGNSWR
FT                   QQMLKSWANVADPAVKQKIVAAAPSFTTAESQATEQVQQIQNLVLQGYKAIVVDAVSPT
FT                   ALNGVIKQACGAGVTVVSFDGIATEPCAYRIAVDFQGMGRMQVDYLAKRLNGKGNLLEI
FT                   RGLAGVSVDDEIHQGVVEQLKKYPGLKIVGSVHGDWTQTVAQKQVAGILPTLPQIDGVV
FT                   TQGGDGFGAAQAIKTAGRPTPIIILGNRQEELAWWADQKKSGYETMSVTIPPGASTFAF
FT                   WVTQQILAGKKVPHDIRMPVLEVKPEELDAVLAKTPAGALANKEYTRGEVVAVIDGKK"
FT                   /protein_id="YP_003609013.1"
FT   sig_peptide     complement(17681..17746)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.910 at
FT                   residue 22"
FT                   /locus_tag="BC1002_5580"
FT   misc_feature    complement(16835..17653)
FT                   /note="Periplasmic sugar-binding component of
FT                   uncharacterized ABC-type transport systems that are members
FT                   of the pentose/hexose sugar-binding protein family of the
FT                   type I periplasmic binding protein superfamily; Region:
FT                   PBP1_ABC_sugar_binding_like_1; cd06300"
FT                   /db_xref="CDD:107295"
FT                   /locus_tag="BC1002_5580"
FT   misc_feature    complement(order(16934..16936,17000..17002,17222..17224,
FT                   17375..17377,17615..17617))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107295"
FT                   /locus_tag="BC1002_5580"
FT   gene            complement(17780..18688)
FT                   /db_xref="GeneID:9090958"
FT                   /locus_tag="BC1002_5581"
FT   CDS_pept        complement(17780..18688)
FT                   /locus_tag="BC1002_5581"
FT                   /gene_family="HOG000075491" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.1.17"
FT                   /codon_start="1"
FT                   /EC_number="3.1.1.17"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5161 gluconolactonase; PFAM:
FT                   SMP-30/Gluconolaconase/LRE domain protein"
FT                   /db_xref="GI:295680440"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="GeneID:9090958"
FT                   /translation="MKSSDYEVHDPRFRRLLQPNAFLTRVTDQSLWAEGPVYFPATDLL
FT                   VWSDIPNNRMLRWAPGMGVGVFRAPSNYSNGNTRDREGRLVTCEHGTRRVTRTEHDGSV
FT                   TVLASHYEGKRLNSPNDVVVDSSGNIWFTDPDYGILSDYEGYRAESEIGRCNVYRVSAD
FT                   SARVELVSDEFVKPNGLAFSPDESRLYIADSAASHDDDAPRHIRVFDLAGGGRLRNGRV
FT                   LVGMKSGVPDGMRVDEHGNVWTSAEDGVHCYAPDGTLLGKMLIPEVVANLTFGGINRNC
FT                   LFIAATSSIYSLYVGVRGAER"
FT                   /product="Gluconolactonase"
FT                   /protein_id="YP_003609014.1"
FT   misc_feature    complement(17783..18670)
FT                   /note="Gluconolactonase [Carbohydrate transport and
FT                   metabolism]; Region: COG3386"
FT                   /db_xref="CDD:33193"
FT                   /locus_tag="BC1002_5581"
FT   gene            complement(18746..19732)
FT                   /db_xref="GeneID:9090959"
FT                   /locus_tag="BC1002_5582"
FT   CDS_pept        complement(18746..19732)
FT                   /locus_tag="BC1002_5582"
FT                   /gene_family="HOG000212232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bph:Bphy_5160 inner-membrane translocator"
FT                   /db_xref="GI:295680441"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9090959"
FT                   /translation="MKSQTSDSGIGAGDGVFTRLRDLQAPWAWSFAGAVLVWFGIVGVF
FT                   GFGIASNVAQTALTYGVFMVLVGLGQMLVITSGVGNIDLSVPSTIALAGVIGMHVMGGS
FT                   DARVVLGVAAALGVGVAVGLANYVLIRLLRIPPIIATLSSSFIIQSIAITQGRQLPPPP
FT                   PALGAFATGRFVGVPYIALFALALSAALAVLLHRAVYGRRLSAIGQNARAAWLAGVDVH
FT                   RTRCVAYVLCSMIAALTALLLAASSGGASLDMGVEYMLISIAVVVIGGTLVAGGKATIV
FT                   GVWGASMFLYLTNAALNALGADAGVRAIVYGVLIVAVTVAAGGKIVR"
FT                   /protein_id="YP_003609015.1"
FT   misc_feature    complement(18779..19549)
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5582"
FT   misc_feature    complement(19043..19099)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5582"
FT   gene            complement(19729..20694)
FT                   /db_xref="GeneID:9090960"
FT                   /locus_tag="BC1002_5583"
FT   CDS_pept        complement(19729..20694)
FT                   /locus_tag="BC1002_5583"
FT                   /gene_family="HOG000229013" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bph:Bphy_5159 inner-membrane translocator"
FT                   /db_xref="GI:295680442"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9090960"
FT                   /translation="MTPARFTVERFTVQNTQARLRALLPAISLIAVLVPIVIMQPAVMS
FT                   YFGSSLLLNLAVPIVLATLAQLAIITVNDLDLSIGSFVSLVACIGATLLAKEPWLGVLA
FT                   LVGCVLAYAAVGALIELRQIPSIVVTLGLSFVWSGLAIVLLPSPGGTSPGWLGTAMNYQ
FT                   TPLIAAPIVWSVVIAIIGHVLLMRTSAGVRIRGAGGNPRAMRRFGWSLVRSKATLYGIA
FT                   GIFGVLSGLSLLGLTTSADANLALRYTLLSIAAVILGGGEFIGGRVSVIGAVLGATTLT
FT                   LAASFLAFLNISADWQVGMQGAILIIVLSLRVLLQRGERQ"
FT                   /protein_id="YP_003609016.1"
FT   misc_feature    complement(19786..20529)
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5583"
FT   misc_feature    complement(20035..20091)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5583"
FT   gene            complement(20691..22172)
FT                   /db_xref="GeneID:9090961"
FT                   /locus_tag="BC1002_5584"
FT   CDS_pept        complement(20691..22172)
FT                   /locus_tag="BC1002_5584"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5158 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295680443"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9090961"
FT                   /translation="MGATSSNEQHSALIRFEGIGKVFGRVRALADIDFAFQRGECVGIA
FT                   GHNGAGKSTLMAVLAGVYPPTQGRIVVDGQPAPHYDANAARDAGVRCVFQELSLCANLT
FT                   VAENMTIVHPQLRGRGWRREATALMREKLDEIFPGNGLKGNELVSDLTLTQQQMVEIAR
FT                   GFTVTDTPVRLVILDEPTSSLDAHTADQLLAFVRRAAQRGITCVLITHMLGEIERVADR
FT                   VAVMRDGGIVGVLPREASSRAAIIQAMGQQLEADKTPTAARSSNASGGERAFRWNVGAH
FT                   KRTSIEASRGEIVGFAGLAGQGQTEALLAIYEAATRHGAARVKAAFVAGDRGRDGVFPV
FT                   WSIAQNLDLRWLLGGAKARRGLVDRTAARALVEAWRTKIGIRGAPMNAGILSLSGGNQQ
FT                   KVLFARALASDAELILMDDPTRGVDVGTKRDIYQLVHDEAHKGRTFLWYTTENEELSHC
FT                   DRTYVFRSAAVTRVLSADQCTEEALLAASFEEQAA"
FT                   /protein_id="YP_003609017.1"
FT   misc_feature    complement(20703..22157)
FT                   /note="ABC-type sugar transport system, ATPase component
FT                   [Carbohydrate transport and metabolism]; Region: MglA;
FT                   COG1129"
FT                   /db_xref="CDD:31325"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(21471..22133)
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(22014..22037)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(order(21540..21542,21636..21641,21888..21890,
FT                   22011..22019,22023..22028))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(21888..21899)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(order(21693..21707,21852..21866))
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(21636..21653)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(21618..21629)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(21534..21554)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5584"
FT   misc_feature    complement(20778..21347)
FT                   /note="This family represents domain II of the carbohydrate
FT                   uptake proteins that transport only monosaccharides
FT                   (Monos).  The Carb_Monos family is involved in the uptake
FT                   of monosaccharides, such as pentoses (such as xylose,
FT                   arabinose, and ribose) and hexoses (; Region:
FT                   ABC_Carb_Monos_II; cd03215"
FT                   /db_xref="CDD:72974"
FT                   /locus_tag="BC1002_5584"
FT   gene            complement(22256..23290)
FT                   /db_xref="GeneID:9090962"
FT                   /locus_tag="BC1002_5585"
FT   CDS_pept        complement(22256..23290)
FT                   /locus_tag="BC1002_5585"
FT                   /gene_family="HOG000229012" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5157"
FT                   /codon_start="1"
FT                   /product="putative simple sugar transport system
FT                   substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5157 putative simple sugar transport
FT                   system substrate-binding protein"
FT                   /db_xref="GI:295680444"
FT                   /db_xref="GeneID:9090962"
FT                   /translation="MFRRGIDVRAALVLAACMFGSAAHAQVAAGDTSQKKIALSNSFAG
FT                   NAWRQSMLKSWNTVAQQAVSDKKIAAAPAFTTAENQVTEQAQQVQNLVLQGYNAIVIDA
FT                   VSPTALNGTIKKACAAGIVVVSFDGVVDEPCAYRVNFDFKGWAEQGVDYLATRLNGKGN
FT                   VLEVRGVAGISVDNLMHEGVLEGLKKHPGLKLVGSVHGDWTQSVAQKAVAGILPTLPEV
FT                   DGVATEGEMSFGIAQAFKAANRPTPPMIIGSTYPELQWWNEQAKTGYQSRSLSNPPGAV
FT                   SFAFWVAQQVLAGKHIPKDVTINVPLLAISEQELPAKLAATPPGGLADVTYTLPQTVAL
FT                   LDKK"
FT                   /protein_id="YP_003609018.1"
FT   misc_feature    complement(22316..23290)
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   RbsB; COG1879"
FT                   /db_xref="CDD:32063"
FT                   /locus_tag="BC1002_5585"
FT   sig_peptide     complement(23213..23290)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5585"
FT   misc_feature    complement(22361..23185)
FT                   /note="Periplasmic sugar-binding component of
FT                   uncharacterized ABC-type transport systems that are members
FT                   of the pentose/hexose sugar-binding protein family of the
FT                   type I periplasmic binding protein superfamily; Region:
FT                   PBP1_ABC_sugar_binding_like_1; cd06300"
FT                   /db_xref="CDD:107295"
FT                   /locus_tag="BC1002_5585"
FT   misc_feature    complement(order(22466..22468,22532..22534,22754..22756,
FT                   22907..22909,23147..23149))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107295"
FT                   /locus_tag="BC1002_5585"
FT   gene            complement(23883..25343)
FT                   /db_xref="GeneID:9090963"
FT                   /locus_tag="BC1002_5586"
FT   CDS_pept        complement(23883..25343)
FT                   /locus_tag="BC1002_5586"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /codon_start="1"
FT                   /product="xylulokinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6659 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="GI:295680445"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="GeneID:9090963"
FT                   /translation="MSYLGIDLGTSEVKVVLTDAESNVIASSRAGLRVDNPHPLWSEQS
FT                   PQDWWNATLDAIAAIRSEHPRVFGALRGIGLSGQMHGATLLDRSGNVLRPAILWNDTRA
FT                   YAECVELEALVPDSRNITGNQAMPGFTAPKLLWLSKYEPAVFRAVHKVLLPKDYIAWRL
FT                   TGEFTSDMSDASGTLWLDVAKRDWSDRMLSAIGMSRENMPRLVEGSEPAAQLRGELQRE
FT                   WCLDGSVTVCGGAGDNAASAIGIGVARPGDAFLSLGTSGVLFAATQGYAPNPGQAVHAF
FT                   CHCVPQQWHQMSVILSAAASLHWLSGLLKSSVAELIEIAPSGQSATAPIFLPYLNGERT
FT                   PHNDATAKGIFYGMTSAHGAQHLAYSVMEGVAFAMADGYAALQAAGTTLSAASFVGGGS
FT                   RSAFWGKLCASALGFELNRNEGSELGAALGAGRLARLACERETLAAVVKAPAVVERYEP
FT                   EAALRSVLRDRFARYRRLYQALKSEFRT"
FT                   /protein_id="YP_003609019.1"
FT   misc_feature    complement(24612..25337)
FT                   /note="FGGY family of carbohydrate kinases, N-terminal
FT                   domain; Region: FGGY_N; pfam00370"
FT                   /db_xref="CDD:144091"
FT                   /locus_tag="BC1002_5586"
FT   misc_feature    complement(23910..25334)
FT                   /note="D-xylulose kinase; Region: XylB; TIGR01312"
FT                   /db_xref="CDD:162297"
FT                   /locus_tag="BC1002_5586"
FT   misc_feature    complement(24105..24587)
FT                   /note="FGGY family of carbohydrate kinases, C-terminal
FT                   domain; Region: FGGY_C; pfam02782"
FT                   /db_xref="CDD:145766"
FT                   /locus_tag="BC1002_5586"
FT   gene            complement(25391..26284)
FT                   /db_xref="GeneID:9090964"
FT                   /locus_tag="BC1002_5587"
FT   CDS_pept        complement(25391..26284)
FT                   /locus_tag="BC1002_5587"
FT                   /gene_family="HOG000160813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6660 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295680446"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:9090964"
FT                   /translation="MNPDLELVHTRQDESFRAWVHDYPHTVAKWHFHPEYEVHVIRASS
FT                   GKFFVGDHIGDFQPGNIVLTGPNLPHNWVTDSDGGASVPSRDLVLQFSRDAVDRMVAAF
FT                   AELSPVMALIDQASQGMQFPDALGLAIAPVMQELSSAHGARRVMLLMSIFDQLIACSSR
FT                   KLLAGPAYNVSAQRYMSSTINQVLSYIQQNLAGNLREVDVAEMAGMSVSSFTRFFKRHT
FT                   GCTFIQYQNRLRLNEACELLMCSDLGVTDICYRVGFNNVSNFNRQFLTQKGIPPSRFRA
FT                   LHRLNDAPSREHKAAA"
FT                   /protein_id="YP_003609020.1"
FT   misc_feature    complement(<26045..26242)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_5587"
FT   misc_feature    complement(25421..25789)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="BC1002_5587"
FT   misc_feature    complement(25592..25717)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5587"
FT   misc_feature    complement(25445..25558)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5587"
FT   gene            complement(26339..27508)
FT                   /db_xref="GeneID:9090965"
FT                   /locus_tag="BC1002_5588"
FT   CDS_pept        complement(26339..27508)
FT                   /locus_tag="BC1002_5588"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6661 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:295680447"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9090965"
FT                   /translation="MANIVCEGLTKQYDGGQPVLHPLDLHIDEGEFVVLLGPSGCGKST
FT                   MLRMIAGLEEISGGSLSIGGRVVNDVPARERNVAMVFQNYALYPHMSVYENIAFGLRRL
FT                   KTPTAEIDRRVREVAAMLNLDALLERKPRAMSGGQQQRAAIARAMIKTPSVFLFDEPLS
FT                   NLDAKLRAQLRTDIKRLHQRLKTTTVYVTHDQLEAMTLADRVILMRGGHIEQEGTPTEL
FT                   YRYPRTIFGAGFIGTPAMNFLDGSVQCTSERVTVSSAAGHWQLRANRFRRLQDGQTIKL
FT                   AVRPNFVRIPESGTTDGDLVLNGAAELVEVLGAEALITVDCSGERVTALVPASAAPHTG
FT                   DHVKLAFSERDLHVFDVATGENVSLEAADEAAAPIPAPRLHAASGLGVH"
FT                   /protein_id="YP_003609021.1"
FT   misc_feature    complement(26429..27508)
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(26858..27499)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(27377..27400)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(order(26930..26932,27029..27034,27260..27262,
FT                   27374..27382,27386..27391))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(27260..27271)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(27077..27106)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(27029..27046)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(27011..27022)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   misc_feature    complement(26924..26944)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5588"
FT   gene            complement(27512..28546)
FT                   /db_xref="GeneID:9090966"
FT                   /locus_tag="BC1002_5589"
FT   CDS_pept        complement(27512..28546)
FT                   /locus_tag="BC1002_5589"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bph:Bphy_6662 alcohol dehydrogenase"
FT                   /db_xref="GI:295680448"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9090966"
FT                   /translation="MKALVLEEARRLSLRDIDLPLAVGPRDVKVRIHTVGVCGSDVHYF
FT                   THGRIGPFKVEQPMVLGHEASGTIVEVGSEVGHLKVGDRVCMEPGVPQFDSRAAMRGLY
FT                   NLDPAVRFWATPPVHGCLTPYVVHPAAFTYRLPDNVSFAQGAIVEPLSIGLQAATKAAM
FT                   KPGDVAVVIGAGTIGAMTALAALAGGASRVILADVVKEKLRHFAGNPAVTTVNAAEQSL
FT                   VDVVRRVTEDWGADVVFEASGNAKVFETLLDLVCPGGCAVLVGMPPGPVALDVVAMQAK
FT                   EIRLESVFRYANIFPRALALISSGMIDVDPFISRKFAFSEGIKAFEEAAAGRPEDVKIQ
FT                   IEMD"
FT                   /protein_id="YP_003609022.1"
FT   misc_feature    complement(27518..28546)
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases [Amino acid transport and metabolism /
FT                   General function prediction only]; Region: Tdh; COG1063"
FT                   /db_xref="CDD:31263"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(27518..28540)
FT                   /note="Sorbitol dehydrogenase; Region: sorbitol_DH;
FT                   cd05285"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(order(27677..27682,27749..27751,28100..28102,
FT                   28202..28204,28211..28213,28358..28360,28388..28390,
FT                   28397..28399,28415..28417,28427..28429,28433..28435))
FT                   /note="inhibitor binding site; inhibition site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(order(28100..28102,28355..28360,28427..28429,
FT                   28433..28435))
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(order(28226..28228,28250..28252,28259..28261,
FT                   28268..28270))
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(order(27677..27685,27749..27757,27815..27817,
FT                   27821..27826,27896..27898,27941..27943,27953..27961,
FT                   28016..28024,28088..28090))
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   misc_feature    complement(order(27635..27637,27644..27649,27656..27658,
FT                   27863..27865,27899..27901,27947..27949,27974..27976,
FT                   27980..27988,27995..27997,28043..28045,28049..28051,
FT                   28082..28084))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176188"
FT                   /locus_tag="BC1002_5589"
FT   gene            complement(28557..29369)
FT                   /db_xref="GeneID:9090967"
FT                   /locus_tag="BC1002_5590"
FT   CDS_pept        complement(28557..29369)
FT                   /locus_tag="BC1002_5590"
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_6663
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680449"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9090967"
FT                   /translation="MGRLISRSTILLLGVALAVVAVFPVLWAVLNSLKNLLDIVTPTPR
FT                   FIFTPTLDNYRQVISSPEVLIALENSSVIVGTAVVLGTLLGVPAAYVIARFHVPAKRDI
FT                   QFFLLSLRFLPPVAIAIPLIAIWVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVFQRMP
FT                   REIEEAATLDGYGPYAVFWRIALPTCGNTLLGGIIFSFVLVWNELMMGLALTSSRSATL
FT                   PVVASAFTSLGQEVPWGVINASTVLLALPPIIFVGVLIRLLNSMLKGK"
FT                   /protein_id="YP_003609023.1"
FT   sig_peptide     complement(29283..29369)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.963 at
FT                   residue 29"
FT                   /locus_tag="BC1002_5590"
FT   misc_feature    complement(28611..29162)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5590"
FT   misc_feature    complement(order(28611..28616,28623..28628,28635..28640,
FT                   28644..28649,28656..28661,28689..28694,28731..28736,
FT                   28743..28754,28773..28775,28782..28787,28827..28829,
FT                   28878..28880,28887..28892,28902..28904,28908..28913,
FT                   28920..28922,28926..28928,28932..28937,28998..29000,
FT                   29004..29009,29016..29045,29049..29060,29088..29090,
FT                   29103..29108,29115..29120))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5590"
FT   misc_feature    complement(order(28737..28754,28998..29042))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5590"
FT   misc_feature    complement(order(28659..28661,28689..28691,28698..28700,
FT                   28734..28736,28950..28952,28998..29000))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5590"
FT   misc_feature    complement(order(28806..28808,28818..28823,28839..28877))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5590"
FT   gene            complement(29357..30235)
FT                   /db_xref="GeneID:9090968"
FT                   /locus_tag="BC1002_5591"
FT   CDS_pept        complement(29357..30235)
FT                   /locus_tag="BC1002_5591"
FT                   /gene_family="HOG000220407" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_6664
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680450"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9090968"
FT                   /translation="MFNRGKTSLPFVFLVPPLVAMAVLGFVPTVAAINLALRNRVLRYP
FT                   DSELVWFRNFVRLAADRRFINSIEVSVIWEIVTVLGAVALGIVVAIYLFEHVHGRLRNA
FT                   ISVLLIIPVLLPRVSAAFIWKFMYSPLNGILSWLAGLFGFTNTAFLSDPGLALYAVALV
FT                   DVWQWGLFFSVVVLKLLETLPPEPLEAARLDYASTWQVYAYIALPMLKAPIMSLVFIKM
FT                   VESLRSFDLIYVMTKGGPGVSTETLDLYAYSQGIGLAGKVSYASSMAVLMMAATTLIFT
FT                   LIWKRVNKWED"
FT                   /protein_id="YP_003609024.1"
FT   misc_feature    complement(29360..30235)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_5591"
FT   sig_peptide     complement(30140..30235)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.430 at
FT                   residue 32"
FT                   /locus_tag="BC1002_5591"
FT   misc_feature    complement(29369..30205)
FT                   /note="ABC-type polysaccharide transport system, permease
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   LplB; COG4209"
FT                   /db_xref="CDD:33938"
FT                   /locus_tag="BC1002_5591"
FT   gene            complement(30331..31602)
FT                   /db_xref="GeneID:9090969"
FT                   /locus_tag="BC1002_5592"
FT   CDS_pept        complement(30331..31602)
FT                   /locus_tag="BC1002_5592"
FT                   /gene_family="HOG000221556" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bph:Bphy_6665 extracellular solute-binding protein"
FT                   /db_xref="GI:295680451"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9090969"
FT                   /translation="MKRFPYCTLCALLSATVPIVSVAQTCDVPVLKVLAQKSLGLTVME
FT                   KSLPDYQKKTGTKIEISYFGENDRRAKSRLDASTGAGSYQIYYVDEANVSEFSTAGWIV
FT                   PLLKYYPKDADYNDFLPGRRAVASYKGVAYFAPLIGGSDFLFYRRDILDKAHMPVPRTL
FT                   DELVADIKKLNAPPNLYGWVARGQRGSGMNVWRWAPFMLAEGGTWTDKEQQPAFNSPSA
FT                   VKATQLYTDLFKYAPPGSATYDWSNALEAFRSGKVAFMIESTPFADWMEDPTKSSVADK
FT                   VGYVRPPAPLPSAAYGHGLAISAVGAKDECTRQAAGKFIAWATSKEQEQARLRDNVFSD
FT                   YNRTSTIESDYFQKHVKPQILAGLKDTTPVSKVTFWPSPQWPDIGDNLGVALEEIFTGT
FT                   QKDIQGALNDSTQYAQDAMEHARK"
FT                   /protein_id="YP_003609025.1"
FT   misc_feature    complement(30346..31602)
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="BC1002_5592"
FT   sig_peptide     complement(31525..31602)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.488 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5592"
FT   misc_feature    complement(30613..31473)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5592"
FT   gene            complement(32339..32556)
FT                   /db_xref="GeneID:9090970"
FT                   /locus_tag="BC1002_5593"
FT                   /pseudo
FT   gene            complement(32651..32965)
FT                   /db_xref="GeneID:9090971"
FT                   /locus_tag="BC1002_5594"
FT   CDS_pept        complement(32651..32965)
FT                   /locus_tag="BC1002_5594"
FT                   /gene_family="HOG000061250" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2278 hypothetical protein"
FT                   /db_xref="GI:295680452"
FT                   /db_xref="GeneID:9090971"
FT                   /translation="MKHLTKTFFASALVMAMSAITYAQVGGSADRTATPRAGAGWTKTP
FT                   SGRGNDSPDVTGSGVGKAGSSRSTGPSRRGKANGLNMGTRDGANSDVNRPRNGPRQDGQ
FT                   "
FT                   /protein_id="YP_003609026.1"
FT   sig_peptide     complement(32894..32965)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 24"
FT                   /locus_tag="BC1002_5594"
FT   gene            33366..33839
FT                   /db_xref="GeneID:9090972"
FT                   /locus_tag="BC1002_5595"
FT   CDS_pept        33366..33839
FT                   /locus_tag="BC1002_5595"
FT                   /gene_family="HOG000187796" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /codon_start="1"
FT                   /product="PRC-barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bpy:Bphyt_4218 PRC-barrel domain protein"
FT                   /db_xref="GI:295680453"
FT                   /db_xref="InterPro:IPR007903"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="GeneID:9090972"
FT                   /translation="MGSINPQGGTRSGANIVGGGVGEGPGPDVMAAATLDGTKVMSSDG
FT                   EHVGKISDIMLDVRNGRIAYAVLSEGGFLGMGSNLHAIPWSALTLDTDQKCFFVDIAAQ
FT                   RLKDDPGFDKDHWPAMADAKWGETTYSYYNRKPYWSATQEGVESDPTFRPSEH"
FT                   /protein_id="YP_003609027.1"
FT   misc_feature    33447..33668
FT                   /note="Photosynthetic reaction center (RC) complex, subunit
FT                   H;  RC is an integral membrane protein-pigment complex
FT                   which catalyzes light-induced reduction of ubiquinone to
FT                   ubiquinol, generating a transmembrane electrochemical
FT                   gradient of protons used to...; Region: PRCH; cl09959"
FT                   /db_xref="CDD:164180"
FT                   /locus_tag="BC1002_5595"
FT   gene            complement(34054..34901)
FT                   /db_xref="GeneID:9090973"
FT                   /locus_tag="BC1002_5596"
FT                   /pseudo
FT   gene            complement(34946..35311)
FT                   /db_xref="GeneID:9090974"
FT                   /locus_tag="BC1002_5597"
FT                   /pseudo
FT   gene            35478..36104
FT                   /db_xref="GeneID:9090975"
FT                   /locus_tag="BC1002_5598"
FT   CDS_pept        35478..36104
FT                   /locus_tag="BC1002_5598"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pmt:PMT0074 DNA polymerase III subunit delta"
FT                   /db_xref="GI:295680454"
FT                   /db_xref="GeneID:9090975"
FT                   /translation="MCPGLGRVESAFVARSRNPPHWSMRGDQAWIALAACCRAHDRNRV
FT                   LDSGPARNGQHQERLVEGRVRRCERRLGPQPSWSALENIGPILWEHGGDLEPFVLHAFE
FT                   KHRLREQRIRHDGLRLRSLVAVYAAIATGRHAGYVTERLAEGLTDGNPGLRPIPAYDIL
FT                   IRYWFFGPHQGLGQLLSEAIKSEAVKPARSPIKEESNGRESQDHG"
FT                   /protein_id="YP_003609028.1"
FT   gene            36524..37291
FT                   /db_xref="GeneID:9090976"
FT                   /locus_tag="BC1002_5599"
FT   CDS_pept        36524..37291
FT                   /locus_tag="BC1002_5599"
FT                   /gene_family="HOG000273991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="GntR domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6391 DNA-binding transcriptional
FT                   regulator GlcC; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295680455"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9090976"
FT                   /translation="MQEVKPEYPSQIADVVAERIESLIVDGVLKPGQALPSERRLMVKL
FT                   GVSRSALREGLKVLRARRIIDTAHGRGSFVAALTSQPALTPMMHLLGSQPRTLYDIFEV
FT                   REMLEAESARLAALRGTQADFALITRRYEEMLAANQSDVDESTRARLDYSFHLAICEAS
FT                   HNPVLVHTLSSLTDLLLSSVFASVNNLYHREAEKRVIDRQHARLYKAVIGKQPEPARKA
FT                   AATHIATTITCLREIEAEEQRLVRATLRLKGWE"
FT                   /protein_id="YP_003609029.1"
FT   misc_feature    36554..37282
FT                   /note="DNA-binding transcriptional regulator GlcC;
FT                   Provisional; Region: PRK09990"
FT                   /db_xref="CDD:170199"
FT                   /locus_tag="BC1002_5599"
FT   misc_feature    36557..36751
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5599"
FT   misc_feature    order(36560..36562,36629..36631,36635..36640,36662..36676,
FT                   36680..36685,36692..36694,36722..36727,36731..36742)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5599"
FT   misc_feature    36821..37186
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_5599"
FT   gene            37497..38867
FT                   /db_xref="GeneID:9090977"
FT                   /locus_tag="BC1002_5600"
FT   CDS_pept        37497..38867
FT                   /locus_tag="BC1002_5600"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   har:HEAR1487 putative transport protein"
FT                   /db_xref="GI:295680456"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9090977"
FT                   /translation="MPSHNPTGASRRPATDRSRTLASTTTTEFESATYAKVTWRLLPFL
FT                   FICYVAAYLDRVNVGFAKLQMLSDLKFSESVYGLGAGIFFIGYFAFEVPSNILLHRVGA
FT                   RVWISRIMVTWALVSAASLFVKTPAMFYTMRFLLGVAEAGFFPGIVLYLTYWYPSVRRG
FT                   RMNALFMIGIPVAGVLGGPLSGGIMQAFNGVRGLSNWQWLFLIEALPSLVLGIVTLFVL
FT                   PNGIRAASWLDERQKQLLEDNIARDGHAGAEASLRSIVSNGRVWRLAAIYFCCMMGLYG
FT                   VSFYLPTLIKAAGVKEALDVGMLTAVPYAVAIVSMILVARSSDRRNERRWHLAMAAVAA
FT                   AAGFYASTLHAGNLALVLFTLSLGTAGVLSMMPVFWTYPSSVLTGTAAAAGIAMINSIG
FT                   NLAGFVSPSIIGWMKDVTHSTNAGLMVVAGALFVGAVLALTQRAPSVTTPAAQPSRA"
FT                   /protein_id="YP_003609030.1"
FT   misc_feature    37602..38759
FT                   /note="4-hydroxyphenylacetate permease; Region: HpaX;
FT                   TIGR02332"
FT                   /db_xref="CDD:131385"
FT                   /locus_tag="BC1002_5600"
FT   misc_feature    37620..38741
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5600"
FT   misc_feature    order(37662..37664,37671..37679,37683..37688,37737..37739,
FT                   37746..37751,37758..37760,37770..37775,37779..37784,
FT                   37920..37925,37932..37937,37944..37949,37956..37958,
FT                   37992..37997,38004..38009,38025..38027,38322..38324,
FT                   38331..38336,38343..38348,38355..38357,38397..38399,
FT                   38409..38411,38421..38423,38430..38432,38442..38444,
FT                   38589..38591,38598..38603,38610..38612,38622..38627,
FT                   38634..38636,38667..38672,38679..38684,38691..38696,
FT                   38703..38705)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5600"
FT   gene            38904..40643
FT                   /db_xref="GeneID:9090978"
FT                   /locus_tag="BC1002_5601"
FT   CDS_pept        38904..40643
FT                   /locus_tag="BC1002_5601"
FT                   /gene_family="HOG000122232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.28"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.28"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_2057 D-lactate dehydrogenase; PFAM:
FT                   D-lactate dehydrogenase membrane binding ; FAD linked
FT                   oxidase domain protein"
FT                   /db_xref="GI:295680457"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="GeneID:9090978"
FT                   /translation="MSDTAYSAISPRDTRRTLLASLGDIVGARNVLTSDAQTRRYRTGY
FT                   RFGNGRVLAVARPGTLVEQWQVLAACVAARAIVITQASNTGLTGGSTPDGDDYDRDVVI
FT                   VSTTRIRRVHLIGGGRQVVCIGGTTLDQLERTLKPLGREPHSVIGSSCIGASVLGGISN
FT                   NSGGSLVHRGPAYTEMAVFAAVDASGKLRLVNHLGIELGNTPEEILSRVEDGTFTDADI
FT                   RNDAAASDHEYATHVRNVDAPTPARFNADPRRLFEASGCAGKLMVFAVRLDTFAAEQGA
FT                   KVFYIGTNDTSVLTDIRRHALANFAHLPIAGEYLHRDAFDVARKYGKDLFVIIDRFGTD
FT                   RLPTFFNLKTRCDALFERLGFIPKHLTDRVLQWISERLPDHLPARLNAYREQYEHHLML
FT                   KVPAAGIEEARAFLSKRFAQSGGAYFECTEEEGRKAFLHRFAAASAAVRYRAVHHREVE
FT                   DIVALDIALRRNDRDWFERLPNETERAIVLKLYYGHFLCHVFHQDYIVAKGNDCLALEH
FT                   EMLELLDIRGAEYPAEHNVGHLYEAKPQLAEFYRKLDPCNCLNPGIGKTSKFAAYRDCT
FT                   VEA"
FT                   /product="D-lactate dehydrogenase"
FT                   /protein_id="YP_003609031.1"
FT   misc_feature    38943..40631
FT                   /note="D-lactate dehydrogenase; Provisional; Region:
FT                   PRK11183"
FT                   /db_xref="CDD:171008"
FT                   /locus_tag="BC1002_5601"
FT   misc_feature    39750..40607
FT                   /note="D-lactate dehydrogenase, membrane binding; Region:
FT                   Lact-deh-memb; pfam09330"
FT                   /db_xref="CDD:117872"
FT                   /locus_tag="BC1002_5601"
FT   gene            40667..40916
FT                   /db_xref="GeneID:9090979"
FT                   /locus_tag="BC1002_5602"
FT                   /pseudo
FT   gene            complement(40945..41886)
FT                   /db_xref="GeneID:9090980"
FT                   /locus_tag="BC1002_5603"
FT   CDS_pept        complement(40945..41886)
FT                   /locus_tag="BC1002_5603"
FT                   /gene_family="HOG000127319" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /codon_start="1"
FT                   /product="copper resistance D domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bph:Bphy_2037 copper resistance D domain-containing
FT                   protein"
FT                   /db_xref="GI:295680458"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="GeneID:9090980"
FT                   /translation="MNDGFLGILRLALVALQNIGFAVLVGALLSDRWLSRSTSRWQSSV
FT                   SGRLLVTVRIASFSTLMSSAFAFWIHCALMSESTLAEAGPAIRSMLVETDFGHAWLAGA
FT                   GLMLVVVILSFAQRRRPIHSRPALWLAIAGVALARSHGGHPVDAGVFSLPVWVDWVHLL
FT                   AISVWVGLVLVTTYIVVPRVFIAPTAERAKAATFVQSLSDAATFALVILLITGAYSGWR
FT                   GVTALEHLWASTYGQVLLVKLALVVTAAALGGHNRFFEMPGLLSSLKDKRTEFTAKPLK
FT                   RFAVILHVESVVLAGALVAAAVLVSSPLPGTT"
FT                   /protein_id="YP_003609032.1"
FT   misc_feature    complement(<41176..41724)
FT                   /note="Copper resistance protein D; Region: CopD; cl00563"
FT                   /db_xref="CDD:153858"
FT                   /locus_tag="BC1002_5603"
FT   gene            complement(41886..42257)
FT                   /db_xref="GeneID:9090981"
FT                   /locus_tag="BC1002_5604"
FT   CDS_pept        complement(41886..42257)
FT                   /locus_tag="BC1002_5604"
FT                   /gene_family="HOG000127318" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /codon_start="1"
FT                   /product="copper resistance protein CopC"
FT                   /transl_table="11"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bph:Bphy_2038 copper resistance protein CopC"
FT                   /db_xref="GI:295680459"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014755"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="GeneID:9090981"
FT                   /translation="MNTNLRKLLVTAAATTVVLSPALAFAHGKLESATPAAGSAIDTSP
FT                   EMLRLTFNEDLESSFSTIKVVDASGAPATKEKANVDSSNPRELIVAVPKLASGSYTVQW
FT                   AVMTHDAHKTKGTYTFAVK"
FT                   /protein_id="YP_003609033.1"
FT   sig_peptide     complement(42177..42257)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT                   /locus_tag="BC1002_5604"
FT   misc_feature    complement(41889..42200)
FT                   /note="Copper resistance protein CopC; Region: CopC;
FT                   cl01012"
FT                   /db_xref="CDD:154145"
FT                   /locus_tag="BC1002_5604"
FT   gene            complement(42327..42677)
FT                   /db_xref="GeneID:9090982"
FT                   /locus_tag="BC1002_5605"
FT   CDS_pept        complement(42327..42677)
FT                   /locus_tag="BC1002_5605"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_2039"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_2039 hypothetical protein"
FT                   /db_xref="GI:295680460"
FT                   /db_xref="GeneID:9090982"
FT                   /translation="MMKKAIASILLGCAVAVSATAFAADDAGNTNTASGAQQDAEATSS
FT                   MSHGEVKKVDTSAGKLTIKHGPLKNLDMEAMTMVFRVKDPVMLSQVKVGDKIDFVAEEI
FT                   DGALTVTKLQKQ"
FT                   /protein_id="YP_003609034.1"
FT   sig_peptide     complement(42606..42677)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT                   /locus_tag="BC1002_5605"
FT   misc_feature    complement(42360..42533)
FT                   /note="Copper binding periplasmic protein CusF; Region:
FT                   CusF_Ec; cl02363"
FT                   /db_xref="CDD:154873"
FT                   /locus_tag="BC1002_5605"
FT   gene            complement(42739..44034)
FT                   /db_xref="GeneID:9090983"
FT                   /locus_tag="BC1002_5606"
FT   CDS_pept        complement(42739..44034)
FT                   /locus_tag="BC1002_5606"
FT                   /gene_family="HOG000127207" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07732"
FT                   /codon_start="1"
FT                   /product="multicopper oxidase type 3"
FT                   /transl_table="11"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 2; KEGG: bph:Bphy_2040 multicopper oxidase
FT                   type 3"
FT                   /db_xref="GI:295680461"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9090983"
FT                   /translation="MVSRRSFLGGSGAALLGAALVSKGGAASLPEAPTMEKTATQPPLV
FT                   PPNGRPYTPVATLNGWTLPWRMKNGWKEFHLTAEPVVREMAPGMKANLWGYNGQAPGPT
FT                   IEAVEGDKVRIFVTNKLPEHTTVHWHGMLVPSGMDGVGGLTQPHIPPGKTFVYEFQLEK
FT                   HGTFMYHPHADEMVQMAMGMMGTFIVHPKDRSVMPVDRDFVFLMSAYDIDPGSFTPRVN
FT                   EMTDFNMWTWNARVFPGIAPLPVRAGDRVRIRFGNLTMTNHPIHLHGYSFEVAGTDGGW
FT                   IPPSARWPEVTADVAVGQMRAIEFTANRPGDWAFHCHKSHHTMNAMGHQVPNFIGVPQK
FT                   DLAKRINKLVPDYMAMGSAGGSMGDMEMPLPDNTLPMMTGTGPFGALEMGGMFSVVKVR
FT                   EGLGRNDYRDPGWFKHPKGTVAYEYTAELPDS"
FT                   /protein_id="YP_003609035.1"
FT   sig_peptide     complement(43954..44034)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.689 at
FT                   residue 27"
FT                   /locus_tag="BC1002_5606"
FT   misc_feature    complement(43456..43776)
FT                   /note="Multicopper oxidase; Region: Cu-oxidase; cl11412"
FT                   /db_xref="CDD:164213"
FT                   /locus_tag="BC1002_5606"
FT   misc_feature    complement(43042..43380)
FT                   /note="Multicopper oxidase; Region: Cu-oxidase; cl11412"
FT                   /db_xref="CDD:164213"
FT                   /locus_tag="BC1002_5606"
FT   gene            complement(44037..45542)
FT                   /db_xref="GeneID:9090984"
FT                   /locus_tag="BC1002_5607"
FT   CDS_pept        complement(44037..45542)
FT                   /locus_tag="BC1002_5607"
FT                   /gene_family="HOG000127096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bph:Bphy_2041 outer membrane efflux protein"
FT                   /db_xref="GI:295680462"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:9090984"
FT                   /translation="MMRLLAHRRATSIALATLFMAGCTTFSKDGGFNTVSSTASERLGK
FT                   EVVYVKTDEDREAVFRRTQELLSKPLGMDDAVQVALLNNRGLQASYGELGISEADLVQA
FT                   GRLPNPGFTFSRTHWSDGFGISRTFSMGVLGILTLPVATHIESQRFEQTRLETANAMLA
FT                   VAADTRKAYVSAVAAEQAALYAAQVKDSAEAGAELALRMRQAGNFSKLDYAREQAFYAE
FT                   SVAEVAKARQQSVIAREKLTRMMGLWGSGTQFKLPERLPDLPNDRPQLNDLEGFAMQNR
FT                   LDIQAAKQRTQSVASSLGLSKATRFINALDVGYLNNFETDKGHERGYEISVEIPIFDWG
FT                   SAKVARAEAIYMQSANRLAQTAIDARSEVRESYSAYVTSYDVARHYRDEVVPVRKTISD
FT                   EMLLRYNGMLASVFELLADSREQVTAVNGYIDALKDFWLAETDLQQSLGGRLPPLAMTR
FT                   ASDAPRSDASDSPAPQTPSAPAQESPLSAPTMQPASPTNSKGE"
FT                   /protein_id="YP_003609036.1"
FT   sig_peptide     complement(45459..45542)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.646) with cleavage site probability 0.617 at
FT                   residue 28"
FT                   /locus_tag="BC1002_5607"
FT   misc_feature    complement(44199..45335)
FT                   /note="type I secretion outer membrane protein, TolC
FT                   family; Region: type_I_sec_TolC; TIGR01844"
FT                   /db_xref="CDD:162556"
FT                   /locus_tag="BC1002_5607"
FT   misc_feature    complement(44805..45326)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="BC1002_5607"
FT   misc_feature    complement(44199..44735)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="BC1002_5607"
FT   gene            complement(45539..45826)
FT                   /db_xref="GeneID:9090985"
FT                   /locus_tag="BC1002_5608"
FT   CDS_pept        complement(45539..45826)
FT                   /locus_tag="BC1002_5608"
FT                   /gene_family="HOG000126875" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_2042"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_2042 hypothetical protein"
FT                   /db_xref="GI:295680463"
FT                   /db_xref="GeneID:9090985"
FT                   /translation="MRTISAALFGASAVLPLLAHATALSDPTDAAISVPAVTVRSAFDG
FT                   YRSYWDGEAPSWQSLNRAVTPGHGRAGMQQCHQSGDASARKKHEHGGESE"
FT                   /protein_id="YP_003609037.1"
FT   sig_peptide     complement(45761..45826)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.805 at
FT                   residue 22"
FT                   /locus_tag="BC1002_5608"
FT   gene            complement(45914..46324)
FT                   /db_xref="GeneID:9090986"
FT                   /locus_tag="BC1002_5609"
FT   CDS_pept        complement(45914..46324)
FT                   /locus_tag="BC1002_5609"
FT                   /gene_family="HOG000126764" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_2043"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: bph:Bphy_2043 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680464"
FT                   /db_xref="GeneID:9090986"
FT                   /translation="MLNFAPMSYWRKIILVVLLTLSLPVQSFATVSMICAASEAVGDDT
FT                   TAPHVHRGDSVDGHALVSDDDGHHGHDHTGVHHAHGCLTCASCCVGAAIPVVPAASAWT
FT                   DQAHFPVPPSPAARVASFLTSGIERPPRLILV"
FT                   /protein_id="YP_003609038.1"
FT   sig_peptide     complement(46235..46324)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.743 at
FT                   residue 30"
FT                   /locus_tag="BC1002_5609"
FT   gene            46502..46705
FT                   /db_xref="GeneID:9090987"
FT                   /locus_tag="BC1002_5610"
FT                   /pseudo
FT   gene            47014..47463
FT                   /db_xref="GeneID:9090988"
FT                   /locus_tag="BC1002_5611"
FT   CDS_pept        47014..47463
FT                   /locus_tag="BC1002_5611"
FT                   /gene_family="HOG000273982" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:METDI4458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mdi:METDI4458 hypothetical protein"
FT                   /db_xref="GI:295680465"
FT                   /db_xref="GeneID:9090988"
FT                   /translation="MNASVISALAALVGAGIGGLTSVLASWLTQRTQVRAEWRVDERAR
FT                   LQDLYKDFIEEATKCHVDALQHNEPDLAGLRNLYAKISRMRLQSSRQVADEADMIGRKI
FT                   VDTYLAPDKTFFEIREMLANGSIDILGKFSDACRAEFESLRAQQF"
FT                   /protein_id="YP_003609039.1"
FT   sig_peptide     47014..47091
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5611"
FT   gene            complement(47795..50281)
FT                   /db_xref="GeneID:9090989"
FT                   /locus_tag="BC1002_5612"
FT   CDS_pept        complement(47795..50281)
FT                   /locus_tag="BC1002_5612"
FT                   /gene_family="HOG000116843" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03074"
FT                   /codon_start="1"
FT                   /EC_number="1.1.5.2"
FT                   /transl_table="11"
FT                   /note="SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat; TIGRFAM: membrane-bound PQQ-dependent
FT                   dehydrogenase, glucose/quinate/shikimate family; KEGG:
FT                   bpy:Bphyt_1682 membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family; PFAM: PQQ-dependent
FT                   enzyme-like; Pyrrolo-quinoline quinone"
FT                   /db_xref="GI:295680466"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019551"
FT                   /db_xref="InterPro:IPR019556"
FT                   /db_xref="GeneID:9090989"
FT                   /translation="MTSPSKRPGVIAVISLLFALLTAVYLVIGGAWLLSLGGSPYYVVT
FT                   GVALLVFAWLLWRASASAFVLYALVLMGTVFWALWESGPDFWALAPRVDVLVVFGVWLL
FT                   LLTRWHLERPSQFAVVSLVIALVVSGGVLVYAHFNDPQQINGTLARSRGTPAPNPDGIQ
FT                   PSEWPAYGRDEQGTRYSPLQQITPANVKNLQIAWTLRTGDMKGPNDPVEITNEVTPIKI
FT                   GDLVYLCSPHQILFALDAKTGELKWKFDPRLKADPSFQHVTCRGVSYIDLSASAASASD
FT                   AAAPSGAEAAASSSDPASATQAAAAPASDTTAAATPSAPNGTCMRRILLPVNDGHLYAL
FT                   DALTGERCTGFGNNGDLDLQHAMPVTTPGMYEPTSPPVVTKKLIVMAGAVEDNFSNREP
FT                   SGVIRGFDVRTGQLVWAFDPGAADPNKIPGPGEHYTWNSPNSWAPAAYDAKLDIVYLPM
FT                   GVKTPDIWGGDRTPDMERYATGLLALHASTGKLAWFYPTVHHDLWDMDQPSQPTLADIT
FT                   DKDGKTVGVVYAPTKTGSLFVLDRRTGALVVPAPEMPVPQGAAPGDHVSPTQPFSQLTF
FT                   RPLKNLTDADMWGATMYDQLVCRVMFHKLRYEGTFTPPSLQGTLVFPGNLGMFEWGGLA
FT                   LDTDRQIAVANPIVLPFVSRLIARGPGNPMEPQAGAKGSGTEVGIQPQYGVPYGVTLNA
FT                   FMSPLRLPCKQPAWGYISAIDLKTNQIVWKKRIGTVRDSSPIPLPFRMGMPMLGGPIVT
FT                   AGGVIFIGATADYYLRAFDVNDGKLLWQARLPAGAQATPMTYSVNGRQFVVIAAGGHGS
FT                   FGTKLGDYVIAYALPQ"
FT                   /product="membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family"
FT                   /protein_id="YP_003609040.1"
FT   misc_feature    complement(47801..50188)
FT                   /note="membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family; Region: PQQ_membr_DH;
FT                   TIGR03074"
FT                   /db_xref="CDD:163126"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(<49469..49816)
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(48200..>49306)
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(order(48326..48328,48338..48346,48353..48355,
FT                   48359..48361,48488..48490,48497..48499,48500..48502,
FT                   48506..48508,48638..48640,48647..48655,48662..48664,
FT                   48668..48670,48803..48805,48812..48820,48827..48829,
FT                   48833..48835,49037..49039,49046..49054,49061..49063,
FT                   49067..49069,49235..49237,49244..49252,49259..49261,
FT                   49265..49267))
FT                   /note="Trp docking motif; other site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(order(48233..48235,48434..48436,48686..48688,
FT                   48770..48772,48902..48904,48956..48958,49103..49114,
FT                   49160..49162))
FT                   /note="active site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(47804..>48289)
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="BC1002_5612"
FT   misc_feature    complement(order(47804..47824,47864..47884,47888..47908))
FT                   /note="'Velcro' closure; other site"
FT                   /db_xref="CDD:73185"
FT                   /locus_tag="BC1002_5612"
FT   gene            complement(50332..50562)
FT                   /db_xref="GeneID:9090990"
FT                   /locus_tag="BC1002_5613"
FT   CDS_pept        complement(50332..50562)
FT                   /locus_tag="BC1002_5613"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bgl:bglu_2g12390 porin, gram-negative type"
FT                   /db_xref="GI:295680467"
FT                   /db_xref="GeneID:9090990"
FT                   /translation="MLTSHSPLFDVRGIHDELREFRLTTPTFTNTAAGFYNPRGEGDGD
FT                   GSHDPASHAMPTSPLPGESQTGAYIGMMHVF"
FT                   /protein_id="YP_003609041.1"
FT   gene            50964..52361
FT                   /db_xref="GeneID:9090991"
FT                   /locus_tag="BC1002_5614"
FT   CDS_pept        50964..52361
FT                   /locus_tag="BC1002_5614"
FT                   /gene_family="HOG000084937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /codon_start="1"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bxe:Bxe_A3840 putative cytochrome oxidase subunit I"
FT                   /db_xref="GI:295680468"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="GeneID:9090991"
FT                   /translation="MNILDALHLARLQFAFTISFHIVFPAISIGMASFLAVLEWRWLVT
FT                   RDSVYKELYVFWSRFFAVGFGMGVVSGVVMAYQFGTNWSRFASFAGSVTGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWRRVSPRAHFFATLMVALGTLVSTFWILASNSFMQTPQGFVIAN
FT                   GRIVPVDWWKVIFNPSFPFRLAHMTIAAFIVTGFVVAGCGAWHLLKGRRDKAILTSFSM
FT                   ALWILLVITPVQIAVGDAHGLNTRKHQPAKIAAIEGLWETERGGTPLNLIGFPDMQAEV
FT                   TRFTVQVPHLGSLILTHSWDGEILGLKEFPPQDRPYSPIVFWSFRIMAGLGMLMLLTAF
FT                   LGLVLRIKGRLYEARWYQRVMLLMGPSGIVALLAGWVTTEVGRQPWTVYGVLRTADSAS
FT                   PVNAQQVGVSLLIFLLVYTLVFGTGVYYMLQMLKRGPSAHIEQEETREHPALNNRALDA
FT                   MKPGELT"
FT                   /protein_id="YP_003609042.1"
FT   misc_feature    50988..52277
FT                   /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
FT                   Bac_Ubq_Cox; cl00562"
FT                   /db_xref="CDD:153857"
FT                   /locus_tag="BC1002_5614"
FT   gene            52358..53368
FT                   /db_xref="GeneID:9090992"
FT                   /locus_tag="BC1002_5615"
FT   CDS_pept        52358..53368
FT                   /locus_tag="BC1002_5615"
FT                   /gene_family="HOG000084825" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /codon_start="1"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A3839 cytochrome bd ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="GI:295680469"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="GeneID:9090992"
FT                   /translation="MTLIDLPIVWACIIGLGVFIYVLLDGFDLGIGLLFPFFDAAQDRQ
FT                   VMMNTVAPVWDGNETFLVLGGAGLYGAFPIAYSTLLPANYMPLILMVIGLIFRGAAFEI
FT                   RGKATRTQHAWDLAFMGGSALASFCQGIVLGSLLQGTETFNGQFVGGAFAWLSPFSLFC
FT                   GIGVLVTYATLACGWLILKTQDVLQRKMRFLMTRLIWLLSAVIGIVSVWTVIGLPAVAH
FT                   RWFASGNLVWFLPVPVLVAACVLGVLRSVRLEHEATPFLLTLGICFLGYSGLVISIWPN
FT                   IVPPSISIWEASSTHSSQLFMLIGTAIVLPVILVYNAMQYRVFRGKVTGRDPGYH"
FT                   /protein_id="YP_003609043.1"
FT   misc_feature    52370..53332
FT                   /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
FT                   pfam02322"
FT                   /db_xref="CDD:145462"
FT                   /locus_tag="BC1002_5615"
FT   misc_feature    52484..53353
FT                   /note="cytochrome d oxidase, subunit II (cydB); Region:
FT                   cydB; TIGR00203"
FT                   /db_xref="CDD:129307"
FT                   /locus_tag="BC1002_5615"
FT   gene            53604..54501
FT                   /db_xref="GeneID:9090993"
FT                   /locus_tag="BC1002_5616"
FT                   /pseudo
FT   gene            54495..54908
FT                   /db_xref="GeneID:9090994"
FT                   /locus_tag="BC1002_5617"
FT                   /pseudo
FT   gene            complement(55136..55732)
FT                   /db_xref="GeneID:9090995"
FT                   /locus_tag="BC1002_5618"
FT   CDS_pept        complement(55136..55732)
FT                   /locus_tag="BC1002_5618"
FT                   /gene_family="HOG000229954" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03807"
FT                   /codon_start="1"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /transl_table="11"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   KEGG: bac:BamMC406_5537 NADP oxidoreductase coenzyme
FT                   F420-dependent"
FT                   /db_xref="GI:295680470"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9090995"
FT                   /translation="MSYAIIGFGKIGHALARAFAGNDIEVSVATTRDPASFASDAAAIG
FT                   PTVIPKTLAEAVKADIIFLAVRFESYAEVAKALPNWSGKTVVDVMNTFSPPEELDGLPS
FT                   SAFVANAFTGARLVKGFNHLAAAVLGQDPAVQGGRRVVFLASDDDGAAAEIGALAERLG
FT                   FAPIQLGGLSEGGLLVHARGNNWGRLIFKDFITFD"
FT                   /protein_id="YP_003609044.1"
FT   misc_feature    complement(55139..55732)
FT                   /note="Predicted dinucleotide-binding enzymes [General
FT                   function prediction only]; Region: COG2085"
FT                   /db_xref="CDD:32268"
FT                   /locus_tag="BC1002_5618"
FT   misc_feature    complement(55460..55723)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5618"
FT   gene            complement(55760..56527)
FT                   /db_xref="GeneID:9090996"
FT                   /locus_tag="BC1002_5619"
FT   CDS_pept        complement(55760..56527)
FT                   /locus_tag="BC1002_5619"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bph:Bphy_6999 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295680471"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9090996"
FT                   /translation="MTQSLKGKTALVTGASRGIGRAIAERLAKDGATVALTYNASKSSA
FT                   DEAIAAIEKAQGSAFAIHANLVDPATVPALFDRLDDEFTKRNGSKALDILVNNAGNSGW
FT                   VGFKDATPDSWDTLMAVYARAPFFIIQAALDRLADGGRIINISSAAATKPVTAAPVYSM
FT                   AKAAINTLTHTLAIELGPRGITANAVAPGFTRTDANADFRANPELVKAVEAQIALGRFG
FT                   EPSEIAAVVAFLASDEGHWVTGQTIEASGGYKL"
FT                   /protein_id="YP_003609045.1"
FT   misc_feature    complement(55772..56521)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:168093"
FT                   /locus_tag="BC1002_5619"
FT   misc_feature    complement(55772..56515)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5619"
FT   gene            complement(56541..57278)
FT                   /db_xref="GeneID:9090997"
FT                   /locus_tag="BC1002_5620"
FT   CDS_pept        complement(56541..57278)
FT                   /locus_tag="BC1002_5620"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bac:BamMC406_5539 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295680472"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9090997"
FT                   /translation="MNNRLHGKTAVITGGATGIGRAAAKRFIEEGAFVFVFGRRQDALD
FT                   AAVAALGPNARAVKGSVSELADLDRLYAAVKAERGTLDIVFANAGTGSPLPLGQITGQH
FT                   IDDTFDTNVKGTIFTVQKALPLMGSGGSIILTGSSAGTTGAPGFTAYSASKAAVRNLAR
FT                   TWAEDLKGTGIRVNVLSPGATATELAKEALGEDGQKAYGAMTPLQRMADPVEIGAVAAF
FT                   LASSDSSFMTASEVAVDGGLAQL"
FT                   /protein_id="YP_003609046.1"
FT   misc_feature    complement(56544..57200)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5620"
FT   misc_feature    complement(56553..57200)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="BC1002_5620"
FT   gene            57386..58303
FT                   /db_xref="GeneID:9090998"
FT                   /locus_tag="BC1002_5621"
FT   CDS_pept        57386..58303
FT                   /locus_tag="BC1002_5621"
FT                   /gene_family="HOG000233520" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bac:BamMC406_5540 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:295680473"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9090998"
FT                   /translation="MLDNVTINQLRAFVAVCDQGSFSGAARELRRAQSAISHAINALES
FT                   AFDVVLFERNTRKATLTAAGRSLLPDARGVISRTEEMKMRAVAIAEAGVPQVSVAVDTY
FT                   FPRAHLIECLRTLQADFPTVAINLRMTTMQDGERLVREGMCALAVTITDVPELSPGTIE
FT                   RQHLCDAQMVTVCAPSHPLASIAGPIPREEFGRHIQLVVTDNQPDAEKTQQGVASERQW
FT                   RVNDLGAKHDLLRGSLCWGHMPRHLVEEDLAKGTLVELQRRAWHMRPLTFMISQRRGYS
FT                   FSECETRLVELLGNRHSPDSARTA"
FT                   /protein_id="YP_003609047.1"
FT   misc_feature    57401..58294
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5621"
FT   misc_feature    57404..57583
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5621"
FT   misc_feature    57671..58168
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5621"
FT   misc_feature    order(57716..57721,57725..57730,57737..57739,57749..57751,
FT                   57755..57775,58049..58063,58079..58084,58088..58093)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5621"
FT   gene            complement(58482..59939)
FT                   /db_xref="GeneID:9090999"
FT                   /locus_tag="BC1002_5622"
FT   CDS_pept        complement(58482..59939)
FT                   /locus_tag="BC1002_5622"
FT                   /gene_family="HOG000273635" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="MmgE/PrpD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bav:BAV0606
FT                   catabolic enzyme"
FT                   /db_xref="GI:295680474"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:9090999"
FT                   /translation="MLTPASAYADATVAPKPPAQRSSGPDDIVALADYCLQTTYDNLPS
FT                   AVIAITKNQIMDTVGAALGGANEPGAKEIREFTIDMAGKREAAIWGTNILVPAQDAARV
FT                   NAIMGDALDYDDTYERSFMHPSVITIPAALAVTDMLGNVSGRDLITATALGVDLACRLA
FT                   NSAQPGVDAFIVGWHNTSLYGYFASTFVAGKLMGLTRDQMVSALGIAFHQASGNSQAHL
FT                   DGALTKRMGAGFASYAGVMAARLSQQGVQGAKNILEGPRGFYYQFHGNKYSRDFLFEGL
FT                   GSTFAATEVSFKPWPSCRGSHTAVDAALTLFAENKIEAPDVESITIYNGPGEYLLLDFP
FT                   LSKKQNLTSVVDAQFSNPWVVACALVDHKVGFEHFTTTAIRRPDLLATVKRIKTAEDKS
FT                   LARPGGGPGATRLDVSLKDGRRFTKTVAFAKGEPKNPMSPIEFRQKFLDCTTKAGMSSA
FT                   QAQALMTDIQRLETLPKAKILTAAMAL"
FT                   /protein_id="YP_003609048.1"
FT   misc_feature    complement(58518..59858)
FT                   /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
FT                   /db_xref="CDD:174454"
FT                   /locus_tag="BC1002_5622"
FT   gene            60603..60985
FT                   /db_xref="GeneID:9091000"
FT                   /locus_tag="BC1002_5623"
FT                   /pseudo
FT   gene            61132..62178
FT                   /db_xref="GeneID:9091001"
FT                   /locus_tag="BC1002_5624"
FT   CDS_pept        61132..62178
FT                   /locus_tag="BC1002_5624"
FT                   /gene_family="HOG000227445" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /codon_start="1"
FT                   /product="oxidoreductase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bja:blr3664 putative oxidoreductase"
FT                   /db_xref="GI:295680475"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091001"
FT                   /translation="MRASSANVTSGRIAHSDQCRLAAIVDPSTEAAACAASLGVPLRRD
FT                   YRELLEEDRIDAVVVCTPNGTHVEIGRACINRGIPVLVEKPIADDLACARAFADASRVA
FT                   RVPVLVGHHRRHNAAVRAAKKAIVEGRIGNVVAANVMCLAYKPEAYFSVPWRRRAGGGP
FT                   ILINMIHEIDLIRHLCGEVVTVQAASTNRTRGYEVEDSAACTLELESGTVVNISLSDTA
FT                   ASPWNWDTAAGEDRQLFDYRPVPTHFFAGTDGALSLPDCALWSYAGEKGRDRPIHDQRI
FT                   SMEEGNVYANQLRHFVDVVRGTAEPLTSAQDATQTLAVTLAVMEAAQTGQKIDLRTDAR
FT                   FKAAGGAT"
FT                   /protein_id="YP_003609049.1"
FT   misc_feature    61168..61464
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5624"
FT   misc_feature    61171..62136
FT                   /note="Predicted dehydrogenases and related proteins
FT                   [General function prediction only]; Region: MviM; COG0673"
FT                   /db_xref="CDD:31017"
FT                   /locus_tag="BC1002_5624"
FT   misc_feature    61510..61797
FT                   /note="Oxidoreductase family, C-terminal alpha/beta domain;
FT                   Region: GFO_IDH_MocA_C; cl11611"
FT                   /db_xref="CDD:159579"
FT                   /locus_tag="BC1002_5624"
FT   gene            62367..63338
FT                   /db_xref="GeneID:9091002"
FT                   /locus_tag="BC1002_5625"
FT   CDS_pept        62367..63338
FT                   /locus_tag="BC1002_5625"
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /codon_start="1"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Shikimate dehydrogenase substrate binding
FT                   domain protein; KEGG: saq:Sare_1274 shikimate dehydrogenase
FT                   substrate binding subunit"
FT                   /db_xref="GI:295680476"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091002"
FT                   /translation="MVESSKLADEKRLLDAPVDALTRLFYILGSPIAHVRAPVVWSTLM
FT                   RRYGVNALMLPADVSASNFDTVMKGLKLTENVDGAIFTMPHKVAAMNHADVLTERARRV
FT                   GSLNLLRRRADGAWEGDNVDGAGFLAGLRADGVSLDGANVYLHGCGGVGGCIGWTLAME
FT                   NIASLTVYDVDERRARGLARSIAAVSNARVTSGSPSMAEIDIAINASPVGLEAGDPLPF
FT                   TVEALPGHATVADAIMEPSITALLGAARRRGLHVHQGRNMMNHAMPIAADFFGLPASFD
FT                   WNGETLYRGLDAQRGCIRHWLQSSTSTQCRSLGSQASFPRPL"
FT                   /protein_id="YP_003609050.1"
FT   misc_feature    62433..63161
FT                   /note="shikimate-5-dehydrogenase, fungal AROM-type; Region:
FT                   Shik-DH-AROM; TIGR01809"
FT                   /db_xref="CDD:162540"
FT                   /locus_tag="BC1002_5625"
FT   misc_feature    62445..62696
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="BC1002_5625"
FT   misc_feature    62736..63161
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_5625"
FT   misc_feature    order(62736..62738,63078..63080,63153..63155)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_5625"
FT   misc_feature    order(62811..62813,62820..62822,62880..62885,62991..62999,
FT                   63072..63074,63141..63143,63150..63155)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="BC1002_5625"
FT   gene            63293..63682
FT                   /db_xref="GeneID:9091003"
FT                   /locus_tag="BC1002_5626"
FT                   /pseudo
FT   gene            complement(63653..63898)
FT                   /db_xref="GeneID:9091004"
FT                   /locus_tag="BC1002_5627"
FT   CDS_pept        complement(63653..63898)
FT                   /locus_tag="BC1002_5627"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   bpd:BURPS668_A2818 transcriptional regulator"
FT                   /db_xref="GI:295680477"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091004"
FT                   /translation="MADLRNVNLKRLAVFIEVVEAGSLTAAAERLRLAKTMVSTHMQRR
FT                   EVEIGASLLARMTRRLNVTEAGRRFYESAREILHAT"
FT                   /protein_id="YP_003609051.1"
FT   misc_feature    complement(63695..63874)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5627"
FT   gene            63931..64680
FT                   /db_xref="GeneID:9091005"
FT                   /locus_tag="BC1002_5628"
FT   CDS_pept        63931..64680
FT                   /locus_tag="BC1002_5628"
FT                   /gene_family="HOG000125744" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpy:Bphyt_5079 glutathione S-transferase domain"
FT                   /db_xref="GI:295680478"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:9091005"
FT                   /translation="MIVYLPRLEHARYAVIPVAVVQRVFFEPGTDAMPIAPKPTRPTRP
FT                   IRLYTTPLSGHGHRVWLFLEMLQIPYETALVDMAAGENRKPEFLAISPFGQVPVIADGE
FT                   VVLFDSNAILVYLAKRYGDTTWLPDDPLGAAAVQRWLSLAAGQIAYGPCSARLVTVFGA
FT                   PLDHQTAKAIAVKLFDVIEPEFAAKAFAIGDQPTIADVAAYAYIAHAPEGGVSLEPYPN
FT                   LRAWLRRVEALPHFVPMPATKAGLLAE"
FT                   /protein_id="YP_003609052.1"
FT   misc_feature    64066..64677
FT                   /note="Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: Gst;
FT                   COG0625"
FT                   /db_xref="CDD:30970"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    64066..64284
FT                   /note="GST_N family, unknown subfamily 4; composed of
FT                   uncharacterized bacterial proteins with similarity to GSTs.
FT                   GSTs are cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of...; Region: GST_N_4; cd03056"
FT                   /db_xref="CDD:48605"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64096..64098,64102..64107,64111..64116,64123..64128,
FT                   64261..64263,64270..64275)
FT                   /note="putative C-terminal domain interface; other site"
FT                   /db_xref="CDD:48605"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64096..64098,64216..64224,64255..64260)
FT                   /note="putative GSH binding site (G-site); other site"
FT                   /db_xref="CDD:48605"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64216..64218,64252..64257,64261..64266,64273..64275)
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:48605"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    64339..64638
FT                   /note="Glutathione S-transferase (GST) family, C-terminal
FT                   alpha helical domain; a large, diverse group of cytosolic
FT                   dimeric proteins involved in cellular detoxification by
FT                   catalyzing the conjugation of  glutathione (GSH) with a
FT                   wide range of endogenous and...; Region: GST_C_family;
FT                   cl02776"
FT                   /db_xref="CDD:155098"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64342..64344,64363..64365,64522..64524,64531..64536,
FT                   64543..64545,64555..64557)
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64342..64347,64354..64356,64468..64470)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="BC1002_5628"
FT   misc_feature    order(64363..64365,64375..64380,64387..64392,64546..64548,
FT                   64555..64557)
FT                   /note="substrate binding pocket (H-site); other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="BC1002_5628"
FT   gene            64712..66737
FT                   /db_xref="GeneID:9091006"
FT                   /locus_tag="BC1002_5629"
FT                   /pseudo
FT   gene            66798..67040
FT                   /db_xref="GeneID:9091007"
FT                   /locus_tag="BC1002_5630"
FT                   /pseudo
FT   gene            complement(67549..68175)
FT                   /db_xref="GeneID:9091008"
FT                   /locus_tag="BC1002_5631"
FT   CDS_pept        complement(67549..68175)
FT                   /locus_tag="BC1002_5631"
FT                   /gene_family="HOG000161265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rlt:Rleg2_5169
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:295680479"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9091008"
FT                   /translation="MNGPVRKRGRPRLLDRDVGLEIAARMFWERGYEGTSIADLTEAMG
FT                   VPPPSLYATFGSKEDLYRLAVDYVSARESKQFMEALQGKMTAYDAISFYLHDAASRFTD
FT                   PKRPRGCMISNAGLQRGEKCESAAQVAAARRSLAIETVKARLDRAVVEGELGSETDTEA
FT                   LARFYGAVVQGMSAQSCDGASKAMLNHLADIALSAWPKVQGKRRK"
FT                   /protein_id="YP_003609053.1"
FT   misc_feature    complement(<67816..68166)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="BC1002_5631"
FT   misc_feature    complement(67987..68118)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="BC1002_5631"
FT   gene            68270..69043
FT                   /db_xref="GeneID:9091009"
FT                   /locus_tag="BC1002_5632"
FT   CDS_pept        68270..69043
FT                   /locus_tag="BC1002_5632"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rlg:Rleg_5749 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295680480"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091009"
FT                   /translation="MSAKLSGKTVLVTGASRGIGRAVALTLAKEGPALIGVHYSSNADA
FT                   AHATVREIEALGVKAVPIAANLTRGKAATDSIWQQFKAAAIEVTGEPKLDILVNNAGIA
FT                   PAALLEQTSEEAFDEVVTINYKAPFFLTQAVSDHLRDGGRIINISTGFTRVAAPTHPAY
FT                   ASTKGAIETLTLALAPHFGPRGITVNAVVPGVTDTDMNADWLKNPEAKAGAEAMSVFKR
FT                   VGQAQDVADVIAFLASPEARWITGQMIDATGGARL"
FT                   /protein_id="YP_003609054.1"
FT   misc_feature    68279..69031
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:168093"
FT                   /locus_tag="BC1002_5632"
FT   misc_feature    68282..69040
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5632"
FT   gene            69203..69607
FT                   /db_xref="GeneID:9091010"
FT                   /locus_tag="BC1002_5633"
FT                   /pseudo
FT   gene            complement(69733..71124)
FT                   /db_xref="GeneID:9091011"
FT                   /locus_tag="BC1002_5634"
FT   CDS_pept        complement(69733..71124)
FT                   /locus_tag="BC1002_5634"
FT                   /gene_family="HOG000261631" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4559 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; aminotransferase class I and
FT                   II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295680481"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9091011"
FT                   /translation="MDSLTHHWLKRLTESRKPAYLVIPDLIEEDLASGRLRPRDRLPGL
FT                   RDLAGALHLNYTTIARAYAEARKRGLLDARAGSGTFVRGRTQTLPLAGGSSVEMSMNMP
FT                   PEPPELAARLRESSASLLAHTDPYRLLRYQDFGGTPDDRAAGRAWLKQRLPDCEEANVL
FT                   VCPGIHSALVALVSQLARPGETICLDTLAYPGIKAIASQMGVRLQPLPRDDEGPLPHAF
FT                   EALCRSEKPGAFYCNPTLQNPSTLTLSLQRREALADVALRYSVPIIEDDAYGWLPSNKP
FT                   VALATLAPELTWYVTGFSKTLGAGLRVAYLRAPTARQTQRVAGALRATTVMPSPFTVML
FT                   ATQWVNDGTAHEMLDAIRKEANARQAIAAQELADWHYDAHDDGFHLWLRIPPHCDWNAP
FT                   ELALQLRNQGVGAVGGPAFSTDGNPPNAIRLCLGGPQDRDDCRYALQCVAQTLNDPHHL
FT                   HIPMM"
FT                   /protein_id="YP_003609055.1"
FT   misc_feature    complement(69763..71082)
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(70876..71073)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(order(70885..70896,70900..70905,70933..70935,
FT                   70942..70947,70951..70965,70987..70992,70996..70998,
FT                   71065..71067,71071..71073))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(69775..70764)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(order(70204..70206,70225..70230,70234..70236,
FT                   70306..70308,70399..70401,70546..70548,70618..70626))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(order(70105..70107,70114..70116,70204..70212,
FT                   70327..70329,70516..70518,70615..70617))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BC1002_5634"
FT   misc_feature    complement(70225..70227)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="BC1002_5634"
FT   gene            71521..72003
FT                   /db_xref="GeneID:9091012"
FT                   /locus_tag="BC1002_5635"
FT   CDS_pept        71521..72003
FT                   /locus_tag="BC1002_5635"
FT                   /gene_family="HOG000074493" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4560"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4560 hypothetical protein"
FT                   /db_xref="GI:295680482"
FT                   /db_xref="GeneID:9091012"
FT                   /translation="MPAVNQPLHQKGDYLVDYEEKVFPDVKAEPGEKALVTFHTVAFEG
FT                   SIGFVNLLQATRLQRKGFDTSVLLYGPGVTLGLQRGFPTLGDEAFPGHLNFNNQLVKFM
FT                   AEGGKVYACRFALQALYGHGEASLIEGIRPINPLDVLDLQLLHRKEDALIIHTWTV"
FT                   /protein_id="YP_003609056.1"
FT   misc_feature    <71701..71955
FT                   /note="DsrE/DsrF-like family; Region: DrsE; cl00672"
FT                   /db_xref="CDD:174340"
FT                   /locus_tag="BC1002_5635"
FT   gene            72022..73041
FT                   /db_xref="GeneID:9091013"
FT                   /locus_tag="BC1002_5636"
FT   CDS_pept        72022..73041
FT                   /locus_tag="BC1002_5636"
FT                   /gene_family="HOG000256364" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /codon_start="1"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bph:Bphy_4561 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="GI:295680483"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="GeneID:9091013"
FT                   /translation="MSEQRIIRAAAVQIAPEFERPGGTLEKVCAAIDEAAQQGVRLIVF
FT                   PETFVPYYPYFSFVRPPVASGADHMRLYEQAVAVPGPVTQAVSERARRHAMVVVLGVNE
FT                   RDHGSLYNTQLVFDIDGRLVLKRRKITPTFHERMIWGQGDAAGLKVAHTGIARVGALAC
FT                   WEHYNPLARYALMTQHEEIHCSQFPGSLVGPIFAEQIEVTIRHHALESGCFVVNSTGWL
FT                   SEAQIESVTTDPKLQKALRGGCMTAIVSPEGQHLAEPLREGEGMVVADLDMALITKRKR
FT                   MMDSVGHYARPELLSLAINDRPATPVAPMSAAFAAASADIGFETTSGGQDECQHESVV"
FT                   /protein_id="YP_003609057.1"
FT   misc_feature    72067..72924
FT                   /note="Nitrilases, cyanide hydratase (CH)s, and similar
FT                   proteins (class 1 nitrilases); Region: nitrilases_CHs;
FT                   cd07564"
FT                   /db_xref="CDD:143588"
FT                   /locus_tag="BC1002_5636"
FT   misc_feature    72088..72924
FT                   /note="Predicted amidohydrolase [General function
FT                   prediction only]; Region: COG0388"
FT                   /db_xref="CDD:30737"
FT                   /locus_tag="BC1002_5636"
FT   misc_feature    order(72160..72162,72406..72408,72418..72420,72427..72429,
FT                   72508..72513,72517..72522,72580..72582)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:143588"
FT                   /locus_tag="BC1002_5636"
FT   misc_feature    order(72160..72162,72406..72408,72508..72510)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:143588"
FT                   /locus_tag="BC1002_5636"
FT   misc_feature    order(72409..72420,72424..72426,72445..72453,72511..72513,
FT                   72517..72531,72535..72540,72625..72630,72634..72642,
FT                   72646..72651,72751..72756,72883..72897)
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:143588"
FT                   /locus_tag="BC1002_5636"
FT   gene            73013..74143
FT                   /db_xref="GeneID:9091014"
FT                   /locus_tag="BC1002_5637"
FT   CDS_pept        73013..74143
FT                   /locus_tag="BC1002_5637"
FT                   /gene_family="HOG000074469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4562 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="GI:295680484"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="GeneID:9091014"
FT                   /translation="MNASMNLSSESASAREMMELRTELQSTGLRLVDPNAGAASRRGGA
FT                   GPSDHKAVTVDGVTIMVPVHTSSAWNSPFVAGVPDEAGESALMRGTIPIANITFPKAPR
FT                   FARLQTLDGVQYSHIATLHGTDVLATTVLQTCIRYESRKKTCKFCAIGQSLAAGRTIAR
FT                   KTPEQLAEVARAAVLLDGVRHMVLTTGTPPTPDRGARILCESAFAIKAAVDLPIQAQCE
FT                   PPDDDVWFERMRASGIDTLGMHLEVVSPEVRARVMPGKASVPISRYMEAFRAAVAVFGK
FT                   GQVSTYILAGLGDTAEAILSISRELIDIGVYPFVVPFVPISGTPLEDHPAPTPEFMKSI
FT                   LAPLGAMLRDAKMRSADIKAGCGKCGACSSLASYEA"
FT                   /protein_id="YP_003609058.1"
FT   misc_feature    73085..74131
FT                   /note="Biotin synthase-related enzyme [General function
FT                   prediction only]; Region: COG2516"
FT                   /db_xref="CDD:32586"
FT                   /locus_tag="BC1002_5637"
FT   misc_feature    73448..73996
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_5637"
FT   misc_feature    order(73448..73450,73454..73462,73574..73576,73580..73585,
FT                   73664..73672,73742..73744,73871..73873,73961..73966)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="BC1002_5637"
FT   gene            74146..74709
FT                   /db_xref="GeneID:9091015"
FT                   /locus_tag="BC1002_5638"
FT   CDS_pept        74146..74709
FT                   /locus_tag="BC1002_5638"
FT                   /gene_family="HOG000228830" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bph:Bphy_4563 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:295680485"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9091015"
FT                   /translation="MYCETFDESDALPLAFTPAEYRVKWATLPWESNQAYALRRAVFCV
FT                   EQGIFVGDDRDDIDRHAKLLVALSCVAGVPEQVVGTVRIHETQPRTWLGSRLAVHAAFR
FT                   SHGKLGSTLIRLAVSSAHALGCETFLAHVQSQNVPLFRRLHWQTVAEEMLFGRPHHLME
FT                   ADLAHYPPCHTPESGFVTSSRGRS"
FT                   /protein_id="YP_003609059.1"
FT   misc_feature    74371..74586
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="BC1002_5638"
FT   gene            74706..75692
FT                   /db_xref="GeneID:9091016"
FT                   /locus_tag="BC1002_5639"
FT   CDS_pept        74706..75692
FT                   /locus_tag="BC1002_5639"
FT                   /gene_family="HOG000226861" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00586"
FT                   /codon_start="1"
FT                   /product="AIR synthase related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: bph:Bphy_4564 AIR
FT                   synthase-like protein"
FT                   /db_xref="GI:295680486"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="GeneID:9091016"
FT                   /translation="MSLRDLVERLRESRGFRHKTDIAGVVASLAAHLPHGARDLAQAVA
FT                   VGDDCAAIADGDGYLLFAIEGLVSDFVASMPWFAGYSSVMVNLSDVYAMGGRPLAVVDA
FT                   LWSDGLGAAEEILAGMAAASRAYGVPVVGGHSNARSAQPQLAVSIVGRARRLLSSFNSR
FT                   PGDCLIMAVDLRGRFEDPYPFWNASVGAPAQRLRDDLELLPLLAESGLCDAAKDISMAG
FT                   VLGTSLMLLECSGVGARIDLDAIPRPTGVDFERWLNAFPSFGFLLSVREEHLEAVLARF
FT                   RQRDLACAMIGRVDASREVVVTQETDAALLWSFADGPFIGAPAQVSV"
FT                   /protein_id="YP_003609060.1"
FT   misc_feature    74706..75647
FT                   /note="Selenophosphate synthetase-related proteins [General
FT                   function prediction only]; Region: COG2144"
FT                   /db_xref="CDD:32327"
FT                   /locus_tag="BC1002_5639"
FT   misc_feature    74733..75584
FT                   /note="AIR synthase (PurM) related protein, subgroup 3 of
FT                   unknown function. The family of PurM related proteins
FT                   includes Hydrogen expression/formation protein HypE, AIR
FT                   synthases, FGAM synthase and Selenophosphate synthetase
FT                   (SelD). They all contain two...; Region: PurM-like3;
FT                   cd02192"
FT                   /db_xref="CDD:100028"
FT                   /locus_tag="BC1002_5639"
FT   misc_feature    order(74880..74891,74895..74897,74901..74903,74973..74975,
FT                   75003..75005,75012..75014,75021..75023,75108..75110,
FT                   75132..75137,75147..75149,75390..75392)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100028"
FT                   /locus_tag="BC1002_5639"
FT   misc_feature    order(74973..74975,75102..75110)
FT                   /note="putative ATP binding site; other site"
FT                   /db_xref="CDD:100028"
FT                   /locus_tag="BC1002_5639"
FT   gene            75689..76858
FT                   /db_xref="GeneID:9091017"
FT                   /locus_tag="BC1002_5640"
FT   CDS_pept        75689..76858
FT                   /locus_tag="BC1002_5640"
FT                   /gene_family="HOG000074447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bph:Bphy_4565 glycosyl transferase group 1"
FT                   /db_xref="GI:295680487"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:9091017"
FT                   /translation="MSTTPLRIALFTHSVNPRGGVVHTLELGRALQDAGHEVTIFAPSV
FT                   NGARMFRASPCRIVLAPVDAHGNDTVSMVQMRIDALKAALRDDAPSDYDVLHAQDGIGG
FT                   NALAELRQEGAIRGFVRTVHHLDAFSDPRLIEWQRRAYADADAVFCVSDTWTRRMLKDY
FT                   GTAASTVSNGVDVERFRAEYAGNDTRALAKFGIDGAPVVLAVGGIEARKNTLQLLDAFA
FT                   LFRRTHSGGQLVIAGGASLLDHDAYTRRFVARATELNLAIGRGEPIVVTGALHDDEIPA
FT                   LMRRADVVSMVSLCEGFGLVVLEALAVGTPVVVSRIEPFTEYLNDRVCCWAQPDDAGSI
FT                   AQALQYALDRRGGIDFEYAVPDLLDRFSWRESARCHIGLYRRYAQPAAA"
FT                   /protein_id="YP_003609061.1"
FT   misc_feature    75704..76846
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="BC1002_5640"
FT   misc_feature    75707..76831
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases and named after YqgM in
FT                   Bacillus licheniformis about which little is known.
FT                   Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to...; Region:
FT                   GT1_YqgM_like; cd03801"
FT                   /db_xref="CDD:99974"
FT                   /locus_tag="BC1002_5640"
FT   gene            76882..77166
FT                   /db_xref="GeneID:9091018"
FT                   /locus_tag="BC1002_5641"
FT   CDS_pept        76882..77166
FT                   /locus_tag="BC1002_5641"
FT                   /gene_family="HOG000074482" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4566"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4566 hypothetical protein"
FT                   /db_xref="GI:295680488"
FT                   /db_xref="GeneID:9091018"
FT                   /translation="MPVMHFRVQWPDGTEANCYSPSTVVGEYFVAGQRYALDDFVERAR
FT                   EALHIGSERVREKYGFACSAAMDQLARIEAQAERFASDAQAKVSIVELL"
FT                   /protein_id="YP_003609062.1"
FT   gene            77237..78538
FT                   /db_xref="GeneID:9091019"
FT                   /locus_tag="BC1002_5642"
FT   CDS_pept        77237..78538
FT                   /locus_tag="BC1002_5642"
FT                   /gene_family="HOG000240760" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: bph:Bphy_4567 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="GI:295680489"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9091019"
FT                   /translation="MSNSNVMTQTGSNQAPHYTVIVVGGGQAGLSISFYLKEAGIDHLV
FT                   IEKHTVTHTWRSQRWDSFCLVTPNWQCALPGYPYRGDDPHGFMKKDEIIAYLDGFIEMV
FT                   DAPVVDHTEVRRVRRQHDGSYVVSTSNGEFTADHVVVASGGYHTPIVPRMAERLPHGIV
FT                   QLQSSHYRSPQSLPEGAVLVVGSGQSGAQIAEDLQIAGRKVYLAVGEAPRCARFYRGRD
FT                   VVDWLADMGYYEMPVDQHPLREGVRDNTNHYVTGRDGGRDIDLRRFALEGMELYGRLDD
FT                   LRDGRLHFAPNLTSNLESADDTYNRINASIDAFIDREGIDAPPGVPYEPVWKPEGERTS
FT                   LDLAASGITSIIWCIGFTPDFSWIDAPVFNGRGYPAHVRGVTPQAGLYFIGLPWLHTWG
FT                   SGRFSGIARDAAHVVDAIRAAIDVSRTASASLAA"
FT                   /protein_id="YP_003609063.1"
FT   misc_feature    77279..78496
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="BC1002_5642"
FT   misc_feature    77294..>77857
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5642"
FT   gene            78535..79356
FT                   /db_xref="GeneID:9091020"
FT                   /locus_tag="BC1002_5643"
FT   CDS_pept        78535..79356
FT                   /locus_tag="BC1002_5643"
FT                   /gene_family="HOG000228829" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4568"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4568 hypothetical protein"
FT                   /db_xref="GI:295680490"
FT                   /db_xref="GeneID:9091020"
FT                   /translation="MKLIHRYRAGMPQLGFTGLSENWLLKECGHLHWQALAAHAGREHP
FT                   DFHDDHGGRSYAAFTAIRLQAYGFDAVEENDEFEICSALCRTGAVRHFSTHCVGRGDAR
FT                   LAQVSMSSTFVTRGEARNNRSVARAALAALPGEVSPMPADAAQMLQIGKRIRAGDGALT
FT                   QTLTAADSEAIEFLPCPYGDFNGAAFLYFASFQAFVDRAEWQRRRFDEPPVVASRSLFY
FT                   YGNVDLGDAVRIRIIGESENEQGIRHWTEVTRNSDGEKIADVITEKHWRRR"
FT                   /protein_id="YP_003609064.1"
FT   gene            79353..81449
FT                   /db_xref="GeneID:9091021"
FT                   /locus_tag="BC1002_5644"
FT   CDS_pept        79353..81449
FT                   /locus_tag="BC1002_5644"
FT                   /gene_family="HOG000003917" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /codon_start="1"
FT                   /EC_number="5.4.99.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: bph:Bphy_4569 methylmalonyl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="GI:295680491"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR014348"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="GeneID:9091021"
FT                   /translation="MNANRTTRSRPVSLKPVYTRADLEGLAHLDSMPGEAPFVRGPFAS
FT                   MYTERPWTIRQYGGYAQAADSNRAFRTALTEGAQGLSVAFDLPTQRGYDSDDPRVSADV
FT                   GMTGVAIDTVEDMARLFEGIALDRISVSMTMNGAVLPVLAAFIVVAEESGVRPSQLTGT
FT                   IQNDILKEFIVRNTCIFAPEPSLRIVTDVVAYLATAVPRFNALSVSGYHFQEAGADAVL
FT                   ELALTMANARAYVDALIRQGMEADHVCERMSFFFGVGTDFYVEIAKLRAARLVWSTLAR
FT                   ESGARSNRACALRMHCQTSGWSLTAHKPMNNVVRTAIEALAAVFGGTQSLHTNAFDEAL
FT                   ALPGASSSRLARDTQLVLQHETGVCDVVDPWAGSYMMESLTADIANRVRLQLDEIEARG
FT                   GVMEAIHSGWIRERIRHSALGVQAEIESRERAILGVNCFERDDDDAPIAISQVDVQQIR
FT                   RHQARRVAEVKAARDSARVRAALGALERAARDGAGNLLELTIECMRARATVGECTQALE
FT                   AVWPRHPIQIQAAAGQFGERLSADPGWSAALKTVKSAASQLGRAPRVLIAKLGQDGHDR
FT                   GVSVVAAALADAGFDVVTGQMFASAAETGIKALKHDVDVIGVSSLAGAHVELASLLIAD
FT                   LQARNATIPIVVGGNIDDSSQAVLKRLGVAECFPTGTSVAHIVAKLAGLSCRGLVERPN
FT                   AFMS"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /protein_id="YP_003609065.1"
FT   misc_feature    79386..81395
FT                   /note="methylmalonyl-CoA mutase; Reviewed; Region:
FT                   PRK09426"
FT                   /db_xref="CDD:169860"
FT                   /locus_tag="BC1002_5644"
FT   misc_feature    79386..80915
FT                   /note="Coenzyme B12-dependent-methylmalonyl coenzyme A
FT                   (CoA) mutase (MCM)-like family; contains proteins similar
FT                   to MCM, and the large subunit of Streptomyces coenzyme
FT                   B12-dependent isobutyryl-CoA mutase (ICM). MCM catalyzes
FT                   the isomerization of methylmalonyl-; Region: MM_CoA_mutase;
FT                   cl00817"
FT                   /db_xref="CDD:154018"
FT                   /locus_tag="BC1002_5644"
FT   misc_feature    81039..81395
FT                   /note="methylmalonyl CoA mutase B12 binding domain. This
FT                   domain binds to B12 (adenosylcobamide), which initiates the
FT                   conversion of succinyl CoA and methylmalonyl CoA by forming
FT                   an adenosyl radical, which then undergoes a rearrangement
FT                   exchanging a hydrogen...; Region: MM_CoA_mut_B12_BD;
FT                   cd02071"
FT                   /db_xref="CDD:30209"
FT                   /locus_tag="BC1002_5644"
FT   misc_feature    order(81063..81083,81090..81092,81201..81209,81213..81221,
FT                   81300..81302,81354..81356,81363..81365,81381..81383)
FT                   /note="B12 binding site; other site"
FT                   /db_xref="CDD:30209"
FT                   /locus_tag="BC1002_5644"
FT   misc_feature    81072..81074
FT                   /note="cobalt ligand; other site"
FT                   /db_xref="CDD:30209"
FT                   /locus_tag="BC1002_5644"
FT   gene            complement(81712..82026)
FT                   /db_xref="GeneID:9091022"
FT                   /locus_tag="BC1002_5645"
FT   CDS_pept        complement(81712..82026)
FT                   /locus_tag="BC1002_5645"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_3630"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3630 hypothetical protein"
FT                   /db_xref="GI:295680492"
FT                   /db_xref="GeneID:9091022"
FT                   /translation="MKSLIQAVAVAVAVVVPVASFAQSNGPITRAQVRAELVQLQKAGY
FT                   RGGDGDQAHYPDAVQAAEAKVAAQQVATNGGYGGAANGSSNAGRPAVSKADWDAMYSHP
FT                   "
FT                   /protein_id="YP_003609066.1"
FT   sig_peptide     complement(81958..82026)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 23"
FT                   /locus_tag="BC1002_5645"
FT   gene            complement(82190..83263)
FT                   /db_xref="GeneID:9091023"
FT                   /locus_tag="BC1002_5646"
FT   CDS_pept        complement(82190..83263)
FT                   /locus_tag="BC1002_5646"
FT                   /gene_family="HOG000063198" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: swd:Swoo_4869 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295680493"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9091023"
FT                   /translation="MAIVRIWVYDGILASGVAGPVDVFSAANQFYARKAATGTTSAPMF
FT                   VWRVESLDGRPVTAASGQTIQVDGKIDPRKRADAVLLTAPFFSNIDEFIGRREQLNELS
FT                   SALRRQRKAGAVLAAYCTANYLLAEAGLLDGRAATTHWARAADFGRRYPRVEVRAHELL
FT                   IAQDGIISGGSVTSYLNLAVRLVETFASEELATMTAKALLIDMNRTSQASFATLLDEHG
FT                   HTDTLVARAQQQMEATLQQGFRLSDLAASLAVSERTLNRRFKEAVGLAPLAYLQNLRIE
FT                   VAKRLLETRPIGLEAVSQRVGYGDISTFRQLFRRKTGLSPSEYRSRSSRGVKNIEAEPG
FT                   RKGETNPTFRFSWHDDV"
FT                   /protein_id="YP_003609067.1"
FT   misc_feature    complement(82649..83254)
FT                   /note="AraC transcriptional regulators having a Type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   GATase1_AraC_2; cd03138"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="BC1002_5646"
FT   misc_feature    complement(82283..83242)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="BC1002_5646"
FT   misc_feature    complement(82901..82903)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153232"
FT                   /locus_tag="BC1002_5646"
FT   misc_feature    complement(82436..82561)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5646"
FT   misc_feature    complement(82289..82402)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5646"
FT   gene            83370..83906
FT                   /db_xref="GeneID:9091024"
FT                   /locus_tag="BC1002_5647"
FT   CDS_pept        83370..83906
FT                   /locus_tag="BC1002_5647"
FT                   /gene_family="HOG000059048" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_4574"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4574 hypothetical protein"
FT                   /db_xref="GI:295680494"
FT                   /db_xref="GeneID:9091024"
FT                   /translation="MPMIDALWPDDALTPEAEARLVKELSDILIEAEGYDPASQIAQRA
FT                   TVFHLHRPAAIYVGGERTGTVRYRIIPSAPEGQYTDESRRSLVREVTEAVARAENRPFD
FT                   DVAPRVWVFPTEIPDGAWGTRGAIWMLPDIHALLAGESERGAGVRRLARRRLEKARITL
FT                   EAALDAASAGIASKP"
FT                   /protein_id="YP_003609068.1"
FT   gene            83921..84406
FT                   /db_xref="GeneID:9091025"
FT                   /locus_tag="BC1002_5648"
FT   CDS_pept        83921..84406
FT                   /locus_tag="BC1002_5648"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mlr1896 hypothetical protein"
FT                   /db_xref="GI:295680495"
FT                   /db_xref="GeneID:9091025"
FT                   /translation="MKFNDTAPVMEPAGGPPLWLTNLAESATLEATVLKRPIEGRADIL
FT                   SVIKHAVSLYEFQHHSYKAAMGNGLYIESYRSQIQGVPIETVVVAHMNEQGETESVIIN
FT                   HRPLNAMLLFSKLMWERVDERFRDRYLTGPEAAALNTVSEDCTRSGCSRPHDETASS"
FT                   /protein_id="YP_003609069.1"
FT   gene            84450..84788
FT                   /db_xref="GeneID:9091026"
FT                   /locus_tag="BC1002_5649"
FT   CDS_pept        84450..84788
FT                   /locus_tag="BC1002_5649"
FT                   /gene_family="HOG000227842" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_3266"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_3266 hypothetical protein"
FT                   /db_xref="GI:295680496"
FT                   /db_xref="GeneID:9091026"
FT                   /translation="MAHTLPMPTTPTTKILAIGTFPPGTDMQLVQHILPSEVRETVQLY
FT                   LDGKVDQWYSLQDRAGVAFILNVTDVSQAHEMLEALPLGKAHLMTFSLLPIGPLKPLGK
FT                   LLNPTSPQ"
FT                   /protein_id="YP_003609070.1"
FT   gene            84848..85822
FT                   /db_xref="GeneID:9091027"
FT                   /locus_tag="BC1002_5650"
FT   CDS_pept        84848..85822
FT                   /locus_tag="BC1002_5650"
FT                   /gene_family="HOG000036637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll6974
FT                   hypothetical protein"
FT                   /db_xref="GI:295680497"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="GeneID:9091027"
FT                   /translation="MFKPVMNATVFPALAAGVSSCKIVPTSSSSAPKLEVGEVQVNPDI
FT                   KLRYMVYRPAHPKGSVLFLHGFPETMYAWKPIAESLSSDYEVHAFDWPGYGQSSRPGAD
FT                   RFSYAPKDYARVLADYIRTSGIDSSKLVIYATDIGALPALLAALEKPDIARKIIVGDFA
FT                   PFNRPQYMYESLQGLKSKPSSDAVRAAMNKNRDEILANTFFRGMSAQERYALPQEFRDD
FT                   IAKGWAGYVTSADAFFHYYSSFTRDQDYFEANMAKLKVPVKVVWGEQDIYIKKEMGVEY
FT                   ANRTGVELSILPKLGHYPHLQAPEQTVHEVHTAFSAGSHPVSD"
FT                   /protein_id="YP_003609071.1"
FT   misc_feature    84968..85798
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="BC1002_5650"
FT   misc_feature    84977..>85141
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5650"
FT   misc_feature    85100..85783
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5650"
FT   gene            86063..86212
FT                   /db_xref="GeneID:9091028"
FT                   /locus_tag="BC1002_5651"
FT                   /pseudo
FT   gene            86589..87773
FT                   /db_xref="GeneID:9091029"
FT                   /locus_tag="BC1002_5652"
FT   CDS_pept        86589..87773
FT                   /locus_tag="BC1002_5652"
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_4497 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:295680498"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="GeneID:9091029"
FT                   /translation="MNTREVVIAHTVRTPIGAFGGSLKDVPATALGALVVRETLRRAAL
FT                   DPKSLSSVVMGNVVQAGNRMNPARQAAIGGGVPVSVPALTVNRVCGSGAQAVVSAAQEI
FT                   ALGYGEVAVAGGMESMERAPYLLDTARWGARMGNAQVHDSMLRDGLVDAFSGEHSGWHT
FT                   EDLATKTDLTRRAQDEWAARSQQRFAAAQERGAFDAELVAVEIEGRKGSVQFTRDEQPR
FT                   PETTVETLARLRPAFRPDGTITAGNAPGLNSGAAAMIVAERGYADTKGIEASARLAAFG
FT                   IAAVEPGMFGLGPVPAVHIALERAGWKLADVERVEINEAFAAVPLAVARQLGLPHDIVN
FT                   VEGGAIAHGHPIGATGAVLITRLVHSMRRDGLKRGIVTLCIGGGQGIALALEIL"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_003609072.1"
FT   misc_feature    86598..87764
FT                   /note="acetyl-CoA acetyltransferase; Provisional; Region:
FT                   PRK05790"
FT                   /db_xref="CDD:168249"
FT                   /locus_tag="BC1002_5652"
FT   misc_feature    86607..87764
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_5652"
FT   misc_feature    order(86661..86663,86742..86744,86784..86786,86793..86795,
FT                   86805..86807,86838..86849,86871..86873,86892..86897,
FT                   86904..86906,86949..86951,87426..87428,87432..87434,
FT                   87438..87440,87498..87500,87735..87740)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_5652"
FT   misc_feature    order(86856..86858,87636..87638,87726..87728)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="BC1002_5652"
FT   gene            87810..88661
FT                   /db_xref="GeneID:9091030"
FT                   /locus_tag="BC1002_5653"
FT   CDS_pept        87810..88661
FT                   /locus_tag="BC1002_5653"
FT                   /gene_family="HOG000264265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04752"
FT                   /codon_start="1"
FT                   /product="ChaC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ChaC family protein; KEGG: vap:Vapar_5351 ChaC
FT                   family protein"
FT                   /db_xref="GI:295680499"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="GeneID:9091030"
FT                   /translation="MVSCDEWQFTLPRYARSSHPAIGWGKHAWSASRCNLLLFCHGNPH
FT                   HFMSGDQKHPASLYELTREHLAQGTLLHALRADPPAGLTLRSDAELERTLRAVLDSHEG
FT                   GRDLHVFGYGSLMWNPAFEVVETSVARVHGWHRGFCLRMIFGRGTPEKPGAMLGLDRGG
FT                   ACNGLLHRIDAAKVEAELRLLWRREMLAGAYDARWVRATAGGRNIRALTFVVNRGHQRY
FT                   IGGSPIDHVAHLIRTGRGPLGTSRAYFDETALTLERLGLLDAGIERLRRAIRDADVADS
FT                   TR"
FT                   /protein_id="YP_003609073.1"
FT   misc_feature    88137..88451
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cd06661"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="BC1002_5653"
FT   misc_feature    order(88137..88139,88146..88148,88152..88157,88368..88373,
FT                   88389..88391)
FT                   /note="putative active site pocket; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="BC1002_5653"
FT   misc_feature    order(88281..88286,88290..88292,88389..88403,88407..88409,
FT                   88440..88442,88449..88451)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="BC1002_5653"
FT   misc_feature    88371..88373
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="BC1002_5653"
FT   gene            complement(88675..89586)
FT                   /db_xref="GeneID:9091031"
FT                   /locus_tag="BC1002_5654"
FT   CDS_pept        complement(88675..89586)
FT                   /locus_tag="BC1002_5654"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mpt:Mpe_A0871 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680500"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091031"
FT                   /translation="MDRIAAMNAFVRVVEAGTFTKAAETLDMPNASLTRLIQKLEEDLK
FT                   VRLLQRTTRSVTVTPEGAIYYERVVRLLAEFADIESSTTHARMKPSGRLRVDAATAIGA
FT                   LVLVPALDDFYRTYPDIGIELQVGNERTDLIAEGFDCAIRAGRVDEQFLVARQIGSFGF
FT                   TTCATPAFLAAHGTPTSPDQLSALPTIGMIPSHAGYPPSFPFLYDDRKDGLQLKHRLVV
FT                   NDTNAYLAAGLASLGIIQAPTYSVRDAIAAGKLVPLLEDWPQPTIPVHVIYPPNRYLSA
FT                   KARVFIDWLVELFERDELLRRR"
FT                   /protein_id="YP_003609074.1"
FT   misc_feature    complement(88720..89586)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK10632"
FT                   /db_xref="CDD:170584"
FT                   /locus_tag="BC1002_5654"
FT   misc_feature    complement(89401..89577)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5654"
FT   misc_feature    complement(88720..89313)
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_CrgA_like_3; cd08472"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="BC1002_5654"
FT   misc_feature    complement(order(88780..88782,88861..88863,88912..88914,
FT                   89104..89106,89110..89112,89152..89154,89269..89271,
FT                   89281..89283))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="BC1002_5654"
FT   misc_feature    complement(order(88885..88887,88894..88899,88918..88932,
FT                   89023..89025,89206..89226,89230..89232,89242..89244,
FT                   89251..89256,89260..89265,89275..89280))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176161"
FT                   /locus_tag="BC1002_5654"
FT   gene            complement(89800..90282)
FT                   /db_xref="GeneID:9091032"
FT                   /locus_tag="BC1002_5655"
FT   CDS_pept        complement(89800..90282)
FT                   /locus_tag="BC1002_5655"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Jann_1769"
FT                   /codon_start="1"
FT                   /product="mucin-associated surface protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jan:Jann_1769 mucin-associated surface
FT                   protein"
FT                   /db_xref="GI:295680501"
FT                   /db_xref="GeneID:9091032"
FT                   /translation="MTLNVDGTAGVPDEIVTTPTDESIQEPNASGDDADLAVAESADVA
FT                   DAAVAESADVADAAVAESGDVADAAVAESGDVADAAVAESGDVADVVEAQSGDVADVPQ
FT                   AESSDVAGLAEVESGDAVDAQVAESLREDADAPADENPAADPVDPAVDQDGEVNED"
FT                   /protein_id="YP_003609075.1"
FT   gene            complement(90946..91761)
FT                   /db_xref="GeneID:9091033"
FT                   /locus_tag="BC1002_5656"
FT   CDS_pept        complement(90946..91761)
FT                   /locus_tag="BC1002_5656"
FT                   /gene_family="HOG000121726" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2412 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:295680502"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9091033"
FT                   /translation="MASIPSTEGAAERRETESGALARGLNVLSRLHEAARPLSLQEIAD
FT                   SVGLAASTCHRLLQSLDQAGYVYREGSLYCPTPRAACPLPLEHPLNRLRRDTAPLMREL
FT                   QERHGPSVLLIAFMGNHRATVDSVAGNYSVAPYFDTNVSAPLHASVSGKLLLSDRTPEQ
FT                   RDLLLGPAPFPARTEFTIRDRAALYAELDQVRQRGWATNENENVIGICAVGTRLSAPSG
FT                   RAVGAIVLTGPSRFFKKGNEAMRDDLLKSAELLNSTSHAVRAMSQFLGI"
FT                   /protein_id="YP_003609076.1"
FT   misc_feature    complement(90997..91707)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="BC1002_5656"
FT   misc_feature    complement(91549..91704)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5656"
FT   misc_feature    complement(90994..91329)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_5656"
FT   gene            92056..93651
FT                   /db_xref="GeneID:9091034"
FT                   /locus_tag="BC1002_5657"
FT   CDS_pept        92056..93651
FT                   /locus_tag="BC1002_5657"
FT                   /gene_family="HOG000164957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: cti:RALTA_B1389 dipeptide ABC transporter, substrate
FT                   binding protein precursor"
FT                   /db_xref="GI:295680503"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091034"
FT                   /translation="MSTRREFLIGATAMVGGSLLGDFAWGASSTTLVANTLPEPAGLAA
FT                   GSTPANPTNVVSSNMFDGLVTYDEAFRPVPQLATSWTESVDRRTITFRLRNDVKWHDGT
FT                   PFTSADVQYSIMEVSKKVHPIARPTFAQIVAVDTPDPYTAVFRLAQPSPVIWSYLDTSS
FT                   AFIFPKHLYAGTDPLTNPYNAKPVGTGGFIFKEWNRGNYIRLVKNPDYWDKGRPRVDEL
FT                   IFRIIPDASARSIALQNGSVQYAPLTPVSLVEARRLEQNQNLVLDTKGWRSNAPMFFMD
FT                   FNLRQKRFQDVRVRQAIAHAINLKLLAKTVFYDFATPATGPVPSYQTRFYAADTPQYPY
FT                   DPQKAEALLDAAGFPRGSDGVRLRFNHLNHTYGEDYQRAGQFIQQQLKRIGVEVTLVNY
FT                   DLPTYLRKIYTEHDFDTMNVFYAAFADPQIGVIRRFWSKNIISGAPWSNGSGYASPEMD
FT                   RVIEAIQTEQDPDKRTQAIHQMQVIAQRDLPSISLAELKFFRIYSRSLQNVNTTPIGVY
FT                   ASLDDVTIGASAHG"
FT                   /protein_id="YP_003609077.1"
FT   misc_feature    92074..93627
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="BC1002_5657"
FT   misc_feature    92146..93582
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_13; cd08517"
FT                   /db_xref="CDD:173882"
FT                   /locus_tag="BC1002_5657"
FT   gene            93644..94669
FT                   /db_xref="GeneID:9091035"
FT                   /locus_tag="BC1002_5658"
FT   CDS_pept        93644..94669
FT                   /locus_tag="BC1002_5658"
FT                   /gene_family="HOG000170251" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cti:RALTA_B1388 dipeptide
FT                   transport protein 1 (ABC superfamily, membrane)"
FT                   /db_xref="GI:295680504"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091035"
FT                   /translation="MADVPIRASRSASRQRRRPLPYPLRRLLQALPLVVTIAVLNFFWL
FT                   RLAPGDLADVMAGEAGAATPEYLAALRHQFGTDQPLALQFLAYLDRMAHLDLGWSFRYN
FT                   ESVLRLILERLPATALLMVGALVIALLFGCVAGTVAAVSRRRSIDIAISILATLGFATP
FT                   LFWLGLMLMVLFSAHLHWLPAGGITTPGLAATGWTRVGDIAAHMALPVFCLAAYYLAIY
FT                   ARLMRASVLEVAGLDFVRTARAKGLSRAATIRAHVVPNALLPIVTMTALQFGTLFSGSV
FT                   AIETVFSWPGLGQLALDAVASRDLNLLLGILLFSSVLVLIVNLAMGLAYGWFDPRIEEQ
FT                   R"
FT                   /protein_id="YP_003609078.1"
FT   misc_feature    93986..94540
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5658"
FT   misc_feature    order(94034..94039,94046..94051,94067..94069,94097..94108,
FT                   94112..94141,94148..94153,94157..94159,94262..94267,
FT                   94271..94273,94277..94279,94316..94321,94325..94327,
FT                   94337..94342,94349..94351,94400..94402,94442..94447,
FT                   94454..94456,94475..94486,94493..94498,94523..94528)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5658"
FT   misc_feature    order(94115..94159,94475..94492)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5658"
FT   misc_feature    order(94157..94159,94217..94219,94493..94495,94517..94519,
FT                   94526..94528)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5658"
FT   misc_feature    order(94352..94390,94406..94411,94421..94423)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5658"
FT   gene            94666..95529
FT                   /db_xref="GeneID:9091036"
FT                   /locus_tag="BC1002_5659"
FT   CDS_pept        94666..95529
FT                   /locus_tag="BC1002_5659"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0142
FT                   peptide/opine/nickel ABC transporter inner membrane
FT                   protein"
FT                   /db_xref="GI:295680505"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091036"
FT                   /translation="MSDIVLTVKPARPWRRVIQSPSLSIGVLLLAAICVLAIGAPYFTH
FT                   NDPLDMAGTPFTWPQTDPAFPLGTDMMGRDVFSGIAYGARVSVEIGIAAGLLATLAGLL
FT                   IGAVAGFYGGLVDDVLMRIAELFQTMPALLFTIVLVVVVHPSVLTIVLGVALTNWPQVA
FT                   RLVRADALRVARAEFVQAATVLGMSRPRIVLTHVLPNVATPAIVMMSILAGNAILTEAV
FT                   LSFLGLGDPNVITWGSMIGSGREALQTAWYMTALPGSAVLVTVLGLNLIGNGLNDLANP
FT                   HRGRTL"
FT                   /protein_id="YP_003609079.1"
FT   misc_feature    94996..95433
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5659"
FT   misc_feature    order(95023..95034,95038..95067,95074..95079,95083..95085,
FT                   95134..95139,95143..95145,95149..95151,95158..95163,
FT                   95167..95169,95179..95184,95191..95193,95242..95244,
FT                   95284..95289,95296..95298,95317..95328,95335..95340,
FT                   95377..95382,95410..95415,95422..95427,95431..95433)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5659"
FT   misc_feature    order(95041..95085,95317..95334)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5659"
FT   misc_feature    order(95083..95085,95335..95337,95371..95373,95380..95382,
FT                   95410..95412)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5659"
FT   misc_feature    order(95194..95232,95248..95253,95263..95265)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5659"
FT   gene            95526..96545
FT                   /db_xref="GeneID:9091037"
FT                   /locus_tag="BC1002_5660"
FT   CDS_pept        95526..96545
FT                   /locus_tag="BC1002_5660"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /codon_start="1"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: app:CAP2UW1_3044 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="GI:295680506"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091037"
FT                   /translation="MNGAALLEVEQLDITFAGAHGRASARAVDGLSFEIRAGETLALVG
FT                   ESGCGKSTTALALMGLLDARAAHIEAARLRFAGTDLLELPEASWRGLRGGSIGMIFQDP
FT                   LAALNPVRTIGRQIGEALKLHRGLSGRAARNETLALLHEVGIPEPARRIDDYPHRLSGG
FT                   MRQRVVIAMALAGQPRLLIADEPTTALDVTIQAQILALLARLQQQTGMALLLITHDLGI
FT                   VGQLADRVAVMYAGRKVEERPAAELFDDARHPYAQRLLQARPLRGGARARLAEIPGAVP
FT                   APGAVARGCAFAPRCTFAQAACREAVPAWRQIGEGGVGCVFDLRAGAINAHDRGSHAA"
FT                   /protein_id="YP_003609080.1"
FT   misc_feature    95541..96473
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism / Inorganic ion transport and metabolism];
FT                   Region: DppD; COG0444"
FT                   /db_xref="CDD:30793"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    95541..96248
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    95658..95681
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    order(95667..95672,95676..95684,95829..95831,96075..96080,
FT                   96177..96179)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    95820..95831
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    96003..96032
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    96063..96080
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    96087..96098
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    96165..96185
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5660"
FT   misc_feature    96240..96491
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="BC1002_5660"
FT   gene            96535..97530
FT                   /db_xref="GeneID:9091038"
FT                   /locus_tag="BC1002_5661"
FT   CDS_pept        96535..97530
FT                   /locus_tag="BC1002_5661"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /codon_start="1"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: xau:Xaut_2765 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="GI:295680507"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091038"
FT                   /translation="MLLEVDRLSVRYTTRRGVLSAVDGLSLQLRRGETLGLVGESGCGK
FT                   SSLGKSIVHLIEPAEGTVRLDGQDLGALSQRQRLPWRRRMQMVFQDPLSALDPRKTVRR
FT                   SLTLPLEVHRVGTPAERRERVDALLHQVGLAATLAERMPHELSGGQRQRVNIARALSVN
FT                   PDVLICDEPVSALDVSLQAQVLNLLSDLQRERGIACLFISHDLAAVGYLADRIAVMYLG
FT                   QIVEILPREALWRHAAHPYTQLLIDSIPARGARLAAPSAAELPDPYAPPRGCRFQQRCP
FT                   HAKSWCGEQPPELIPLGGAHAVACHLYGRDARAHVSNVSNPAPIASVHDA"
FT                   /protein_id="YP_003609081.1"
FT   misc_feature    96538..97461
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism / Inorganic ion transport and metabolism];
FT                   Region: DppD; COG0444"
FT                   /db_xref="CDD:30793"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    96538..97215
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    96649..96672
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    order(96658..96663,96667..96675,96802..96804,97042..97047,
FT                   97144..97146)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    96793..96804
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    96970..96999
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    97030..97047
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    97054..97065
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    97132..97152
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5661"
FT   misc_feature    97201..97455
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="BC1002_5661"
FT   gene            97563..98720
FT                   /db_xref="GeneID:9091039"
FT                   /locus_tag="BC1002_5662"
FT   CDS_pept        97563..98720
FT                   /locus_tag="BC1002_5662"
FT                   /gene_family="HOG000268769" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /codon_start="1"
FT                   /product="Luciferase-like, subgroup"
FT                   /transl_table="11"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bxe:Bxe_B2411
FT                   hypothetical protein"
FT                   /db_xref="GI:295680508"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="GeneID:9091039"
FT                   /translation="MSIPSPAEFPDSPLSRALAQPLMLGLFLPIQSGGWSMSTLPRTTD
FT                   WSFDYNARLTRKAEDLGFDLVFGLAQWLGKDGHGGALRYRRESLDSFITIASLASITHR
FT                   ILLVSTLHILYGNWHPLHLAKFGATLDHISGGRWGLNMVTGHSIDEAEMFGREGHFEHD
FT                   QRYEMAGEFIELMERLWLLDDNLTFDGKWYHTRNAFVSPKPRYGRPVLVNATSSPAGIN
FT                   YAAKHSDLIFITSSAGAQIDAALDVLPAHTAQVRATAQSHGRQVRTLINPTIVCRPTER
FT                   EARAYHDAILSHADFGAVDGFTGRRSDAQAWKGHQREQRVLGGNIQIIGSPEHVVDDLL
FT                   RLKAAGIDGVQLTFYDFEPDLAYFGEAVLPLLEQAGLRVRVQSAG"
FT                   /protein_id="YP_003609082.1"
FT   misc_feature    97626..98429
FT                   /note="Alkanesulfonate monoxygenase is the monoxygenase of
FT                   a two-component system that catalyzes the conversion of
FT                   alkanesulfonates to the corresponding aldehyde and sulfite.
FT                   Alkanesulfonate monoxygenase (SsuD) has an absolute
FT                   requirement for reduced flavin...; Region:
FT                   Alkanesulfonate_monoxygenase; cd01094"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5662"
FT   misc_feature    97632..98693
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5662"
FT   misc_feature    order(97641..97643,97653..97655,97797..97799,97989..97991,
FT                   98055..98057,98211..98216,98256..98258,98373..98375,
FT                   98379..98381)
FT                   /note="active site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5662"
FT   misc_feature    order(97788..97802,97830..97832,97839..97841,97848..97853,
FT                   97860..97862,97917..97919,97923..97928,97935..97940,
FT                   97947..97949,97956..97958,98007..98009,98016..98021,
FT                   98142..98144,98148..98159,98163..98168)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5662"
FT   misc_feature    97890..97895
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5662"
FT   misc_feature    order(97995..98021,98046..98054,98142..98183,98382..98393,
FT                   98412..98429)
FT                   /note="insertion regions; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5662"
FT   gene            98780..100003
FT                   /db_xref="GeneID:9091040"
FT                   /locus_tag="BC1002_5663"
FT   CDS_pept        98780..100003
FT                   /locus_tag="BC1002_5663"
FT                   /gene_family="HOG000219185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   mjl:Mjls_3947 acyl-CoA dehydrogenase type 2"
FT                   /db_xref="GI:295680509"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:9091040"
FT                   /translation="MGTIDSNLAADSGLAVVQPQSTALRELVTAIAAGAAARERGEGDA
FT                   RDAIALVRAARLGVFRVPKHEGGAGATLPQLFELVLDLAEADSNIPHILRNHFAFVEKA
FT                   LRARQLPQYQRWTQRVLAGELFGLGASELGTQNIGDGDGNTRLEPAGAGYRLTGTKYYS
FT                   TGNLYFDHIIVNAKTSDGRFVGARVSVRQPGVDVRDDWDGIGQRQTASGTTVFSNVEVA
FT                   AEDVLVYADEVQLPQQATFAQLYLTTIIAGILRRVAKDAVELVQQRQRNFYHAVAPRPA
FT                   DDPLLQETVGELQSAAFVAEAAVLNAAAVLGEAFDSAIAGQPDDALFVEAALRSAKAKV
FT                   VIDQLALQGATRIFDVGGASAAKQASQLDRHWRNIRTIASHNPGLYKARVLGNHALNGV
FT                   PLPAAAFF"
FT                   /protein_id="YP_003609083.1"
FT   misc_feature    98924..99979
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BC1002_5663"
FT   misc_feature    order(99074..99076,99161..99163,99167..99169,99263..99265,
FT                   99269..99271,99929..99937,99941..99943,99947..99949)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5663"
FT   gene            100079..101743
FT                   /db_xref="GeneID:9091041"
FT                   /locus_tag="BC1002_5664"
FT   CDS_pept        100079..101743
FT                   /locus_tag="BC1002_5664"
FT                   /gene_family="HOG000180868" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2410 rhodanese-like domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="GI:295680510"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9091041"
FT                   /translation="MSQSNVPLIGPAALRAALAARDELAILDVREEGVCARRRLFYSSI
FT                   APVGRLGLVVGQLVPRRTTPIVLVDEAGEYTPRAAALLARFGYTNVSILEGGVSGWEAA
FT                   GFEVFSGTNVPGKAFGEVIEQRLHTPNIDAPTLKRLQDAGENIVVLDSRPFPEYQTMNI
FT                   PGGIECAGAELVYRALAAAPSPDTLIVVNCAGRTRSILGAQSLVNAGIPNPVAALTGGS
FT                   MSWLLAGLELERGQIRTAPRPDETALAGARTLAQRAAAKAGVVEIDRATLARFESETAT
FT                   HTLYRFDVRSPLEYEAGHRAGWRSAPGGQLVQATDEYVGTLHARVVLGDDDGVRARMTA
FT                   SWLVQLGYLQVFVLADDDASAAFEAGPEPREVLRTPGRTRWIEADRLARALEAGSVQVV
FT                   DVDSSLAFRRAHIAGARFIAASALQDLVPRIDDPARQLVLTSSDGVLAGLLADELRERH
FT                   ANVAALLGGTARWLALGLPQAAGDDGNLTGDDDAWYSPYHYPPGQAAQQMESYLAWELQ
FT                   LVAQLERDGIASIDVIDFDTATRARSAEWLATLQSTV"
FT                   /protein_id="YP_003609084.1"
FT   misc_feature    <100268..100399
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    100439..100765
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    100655..100657
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    100877..101161
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    101066..101068
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    101252..101656
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5664"
FT   misc_feature    101399..101401
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5664"
FT   gene            101781..103136
FT                   /db_xref="GeneID:9091042"
FT                   /locus_tag="BC1002_5665"
FT   CDS_pept        101781..103136
FT                   /locus_tag="BC1002_5665"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2409"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2409 hypothetical protein"
FT                   /db_xref="GI:295680511"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091042"
FT                   /translation="MSASRRLHLNTNVTGMGRHPAGWRTLDNPKSIVDLGFFTSIARIA
FT                   ERGKLDAVFLSDALALRGHAHGPSQSLEPTVLLTALAGVTQHVGLIGTASTTFNDPFNL
FT                   ARRFASVDHLSAGRVAWNAVTTYDPQAAANFSFGEAPDKPARYARAAEFVDVVLKLWDS
FT                   WEDDALVADRASGLYADPARVHAIGHRGPHFQVRGPLNLPRSPQGRPVLVQAGGSEAGV
FT                   ALAARDADAVFTAQTTFEGAQAFYRDIKARAAAHGRDPAHLLVLPGLYPVIGGTLAEAR
FT                   QRKAEMDALLERSAELAKFAGALGVEPTDLRLDEPLPYELIDSGARSDVSGGFIRSTVL
FT                   LARSENLTVRDLLDRNPGAHRMLVGTPETIADDIERWFTGRAADGFNLNADVFPSGLAD
FT                   FVDQVVPLLQRKGIFRREYEGTTLREHYGLPRPPSRYADAQAGLAAAADAVS"
FT                   /protein_id="YP_003609085.1"
FT   misc_feature    101799..103022
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5665"
FT   misc_feature    101805..103058
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5665"
FT   misc_feature    order(101814..101816,101826..101828,101991..101993,
FT                   102150..102152,102216..102218,102435..102440)
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5665"
FT   misc_feature    102057..102062
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5665"
FT   gene            103147..103980
FT                   /db_xref="GeneID:9091043"
FT                   /locus_tag="BC1002_5666"
FT   CDS_pept        103147..103980
FT                   /locus_tag="BC1002_5666"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B2408
FT                   nitrate/sulfonate/bicarbonate ABC transporter inner
FT                   membrane protein"
FT                   /db_xref="GI:295680512"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091043"
FT                   /translation="MSMTTRDSTFAVTPAPAAGAMLLRRLTLREPLLRCLVPVLLIAVW
FT                   QLASSLGVASEFVLPSPASVLAAYRELWQSGDLQDALKVSLARAALGLLIGGGAGMLLG
FT                   VASGLSKSAERGFDSVLQMLRTIPFIALVPIFVVWFGIGEVSKVALIVGAAISPMYLST
FT                   YHAIRGIDPKLLELGRTFRLTRAHQVRLIILPMSLPGILVGVRYAAAISLLALVAAEQI
FT                   NASAGIGYILNNANQFQRTDIIIAGILVYAALGISVDALLRYIERKALAWRGAHV"
FT                   /protein_id="YP_003609086.1"
FT   misc_feature    103255..103974
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_5666"
FT   gene            103973..104710
FT                   /db_xref="GeneID:9091044"
FT                   /locus_tag="BC1002_5667"
FT   CDS_pept        103973..104710
FT                   /locus_tag="BC1002_5667"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2407 nitrate/sulfonate/bicarbonate
FT                   ABC transporter ATPase; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:295680513"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091044"
FT                   /translation="MSELAYQTDRQTASVVASLSRVGKRYGENAVLDQVDFTVHKGEVV
FT                   ALVGPSGTGKTTLLRLLAGLESATSGRAEVSANTSVVFQEPRLIGALRVWANVLLDDAR
FT                   KPDAKERARAALQDVGLEDKLSSWPVSLSGGQAQRVAVARALYRRPDLMLLDEPFSALD
FT                   AFTRRSIQSLVLKLWDHYRFGLVIVTHDLDEALILADRIVILSKGRICHETRVDLPRER
FT                   DVTSPEFNALKRDLLRQFSLSVS"
FT                   /protein_id="YP_003609087.1"
FT   misc_feature    104024..104692
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104024..104626
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104117..104140
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    order(104126..104131,104135..104143,104222..104224,
FT                   104438..104443,104540..104542)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104213..104224
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104366..104395
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104426..104443
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104450..104461
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   misc_feature    104528..104548
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5667"
FT   gene            104738..105787
FT                   /db_xref="GeneID:9091045"
FT                   /locus_tag="BC1002_5668"
FT   CDS_pept        104738..105787
FT                   /locus_tag="BC1002_5668"
FT                   /gene_family="HOG000078741" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2406"
FT                   /codon_start="1"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2406 nitrate/sulfonate/bicarbonate
FT                   ABC transporter periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680514"
FT                   /db_xref="GeneID:9091045"
FT                   /translation="MSLKKSLFGGVAALLATFTLASSGTAHAQSQQADLKNAKLVIAYQ
FT                   DPAFPALIRKSGVVDGTPYQIEWVLLTGPAANLSALYAGRIDLGHMGDTSLTIEQANAR
FT                   TDWTKDSTPLRIVAGWRNAYSKDYPPEITALRTSSGITSVQAIKGHKFGYNYGGYNHAQ
FT                   YLATLVKAGLSEKDVQPIKFADGATSAAGFNAGQVDVYSGALGPVLPTIRSGAGHVLLS
FT                   DRDTKIPALNVWTTTSANLKDPAKVAALQDFFSRMSGYWSWHDSHKDEVIGILKDTLKI
FT                   SDERAAFEYQVRSGSFVKFDKGLLGEEQNIADILYDGHAIRKKVKVDVEYDPRFNAAQK
FT                   AIWPIPSRD"
FT                   /protein_id="YP_003609088.1"
FT   sig_peptide     104738..104824
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT                   /locus_tag="BC1002_5668"
FT   misc_feature    104855..105742
FT                   /note="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
FT                   /db_xref="CDD:130789"
FT                   /locus_tag="BC1002_5668"
FT   misc_feature    104930..>105352
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5668"
FT   gene            105846..106478
FT                   /db_xref="GeneID:9091046"
FT                   /locus_tag="BC1002_5669"
FT   CDS_pept        105846..106478
FT                   /locus_tag="BC1002_5669"
FT                   /gene_family="HOG000230108" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C1132"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C1132 hypothetical protein"
FT                   /db_xref="GI:295680515"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="GeneID:9091046"
FT                   /translation="MTTTTNESSSVIAAQRREAIQNLLADARSIILEKGVTREALKAIS
FT                   ALLLELATRHTLFDAADFPPPRLDGGDTSTRYRLNPGEDGLALYLNSLLPGKTTIPHNH
FT                   DTWAVIAAIEGAELNRIYRRTDDGRDPERATLELLHEVVVRPGIPIAFLPDDIHSIHVG
FT                   GAEPTLHLHLYGRPLEMLTGRLGFETDTGLVVRYNAKHLQRATQAVG"
FT                   /protein_id="YP_003609089.1"
FT   misc_feature    <106059..106370
FT                   /note="Cysteine dioxygenase type I; Region: CDO_I; cl02350"
FT                   /db_xref="CDD:154868"
FT                   /locus_tag="BC1002_5669"
FT   gene            106478..108160
FT                   /db_xref="GeneID:9091047"
FT                   /locus_tag="BC1002_5670"
FT   CDS_pept        106478..108160
FT                   /locus_tag="BC1002_5670"
FT                   /gene_family="HOG000180868" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C1130 putative rhodanese-like sulfur
FT                   transferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="GI:295680516"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9091047"
FT                   /translation="MASSDPNFGLSDSPMADTFSLIPATTVREWLNDDEEIAFFDVREA
FT                   GEFGEGHPFFAVPLPYSRLELDIVRLAPRREVRIVLLDAGADDEAISRRAARRLHALGY
FT                   TRLFVLKDGARGWAAAGYTLFKGVNVPSKTFGELVEHAYETPHISAADLARLKTERAPL
FT                   ILLDGRTVEEHTKMTIPGAVSCPNGELAYRFGALAADPRTPVVIHCAGRTRSIIGAQLL
FT                   RSLGVPNPVVALENGTQGWALAGLELERGSARRYPDSVEDSISSEARDRAASLAARFAV
FT                   TTLDARAAQAWLDAADRTTYLLDVRSAAEFARDGVPAAVHAPGGQLLQATDQTIGVRRA
FT                   RVLLVDYDGIRAPVMATWLVQLGLETALVQERDAHALKRHGPHATAHGPVEEDLIDADG
FT                   LRKLRGAADVHVLDLRSSAAYRGGHPERARWSIRPRLAAALEKARRSHRIVLLADSQEL
FT                   AALAAFDLREARFSDVSIAKDGIDTFRQAGYAIEASPRTPADSERIDYLFFVHDRHEGN
FT                   LDAARAYLAWETGLIAQCAPDELRQFCIDVQAAHADTLAQPIR"
FT                   /protein_id="YP_003609090.1"
FT   misc_feature    106556..106834
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    106724..106726
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    106886..107212
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   repeat 2. This CD includes putative rhodanese-related
FT                   sulfurtransferases which contain 4 copies of the Rhodanese
FT                   Homology Domain. This CD aligns the 2nd repeat which does
FT                   contain the putative...; Region: 4RHOD_Repeat_2; cd01533"
FT                   /db_xref="CDD:29096"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    107102..107104
FT                   /note="active site residue"
FT                   /db_xref="CDD:29096"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    107372..107608
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    107513..107515
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    107684..108106
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="BC1002_5670"
FT   misc_feature    107834..107836
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="BC1002_5670"
FT   gene            complement(108180..108434)
FT                   /db_xref="GeneID:9091048"
FT                   /locus_tag="BC1002_5671"
FT   CDS_pept        complement(108180..108434)
FT                   /locus_tag="BC1002_5671"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:GTNG_2608"
FT                   /codon_start="1"
FT                   /product="sulfonate ABC transporter periplasmic
FT                   sulfonate-binding protein SsuA"
FT                   /transl_table="11"
FT                   /note="KEGG: gtn:GTNG_2608 sulfonate ABC transporter
FT                   periplasmic sulfonate-binding protein SsuA"
FT                   /db_xref="GI:295680517"
FT                   /db_xref="GeneID:9091048"
FT                   /translation="MPSAASDIHGRFDRACRQTAQCLSQNTAIRLEIWTRALPRLESGV
FT                   HYPLTDEVVKAQQDCADLAYREHVVLRKIDAREAIVDIR"
FT                   /protein_id="YP_003609091.1"
FT   misc_feature    complement(108195..>108404)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5671"
FT   gene            108567..109550
FT                   /db_xref="GeneID:9091049"
FT                   /locus_tag="BC1002_5672"
FT   CDS_pept        108567..109550
FT                   /locus_tag="BC1002_5672"
FT                   /gene_family="HOG000165071" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.11.17"
FT                   /codon_start="1"
FT                   /EC_number="1.14.11.17"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3116 taurine dioxygenase; PFAM:
FT                   Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="GI:295680518"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="GeneID:9091049"
FT                   /translation="MSSSAQSNLDTSFENLRIRRVAGLIGGEVQDFKLSPALDESVIDT
FT                   LHRALVKYKVLFFRDQGHLDDVSHQAFGARFGQTVAHPTVPSPEGTALFELDASKGGGR
FT                   ADSWHTDVTFVDAFPKISILRGVKIPAYGGDTVWANTAVAYERLPDDLKRLADSLWAVH
FT                   TNDYDYGAERIAGTDTQSAAARLAHHQNVFVSAVYEAEHPIVHVHPVSGERALLLGHFI
FT                   KRIVGLSSSESARIFEILQNRVIRLENTVRWQWRQNDVAIWDNRATQHYAVNDYGTQER
FT                   LVRRVTVAGERAVSVDGRHSRTLRRPEPTTQVDSRQATREPAASAA"
FT                   /product="Taurine dioxygenase"
FT                   /protein_id="YP_003609092.1"
FT   misc_feature    108606..109442
FT                   /note="Clavaminic acid synthetase (CAS) -like;  CAS is a
FT                   trifunctional Fe(II)/ 2-oxoglutarate (2OG) oxygenase
FT                   carrying out three reactions in the biosynthesis of
FT                   clavulanic acid, an inhibitor of class A serine
FT                   beta-lactamases. In general, Fe(II)-2OG...; Region:
FT                   CAS_like; cl00184"
FT                   /db_xref="CDD:174021"
FT                   /locus_tag="BC1002_5672"
FT   misc_feature    108612..109460
FT                   /note="Probable taurine catabolism dioxygenase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: TauD; COG2175"
FT                   /db_xref="CDD:32358"
FT                   /locus_tag="BC1002_5672"
FT   gene            109588..110919
FT                   /db_xref="GeneID:9091050"
FT                   /locus_tag="BC1002_5673"
FT   CDS_pept        109588..110919
FT                   /locus_tag="BC1002_5673"
FT                   /gene_family="HOG000082013" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vap:Vapar_5703 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="GI:295680519"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091050"
FT                   /translation="MTQRRRLLQVAAVLGATAMLPGLVRAQSGAKKYAGVTLNVSVFST
FT                   AYTKLLQQWLPEFEAASGAKVNFDTPSFPVYNQRADLELSTRGSAYDVLNVTFIYSSRW
FT                   INSGWLTPLDDFIKNPALTAADWDVKDFLPGALASETGKDGKLYGIPWNAEALLSGSSR
FT                   FDLVKAAGFAYPDTTDDLVKVLRAVNKKERVAGYVADSHYGWTFVPYLQAFGGNVFRAP
FT                   PDDLFPTLDTPEAIAAAEYYANLISEFGPDGGVTYTPDQVTQALMLGRTNFTDAGQIYL
FT                   AQLGDPVASRTVKTASFGLVPKGPAGRFPGVAVHGLGIPAGSKNKEAAWSFIQWALSKQ
FT                   ITRRTVAAGYGSPARRSDIDSKEFRTRQLISGHDLAELSLQSIDLAAKSGHMKYRTVAV
FT                   YPQVDQQLNAAIARIATKQLSARQAMQQAQAASIAELRRAGIKI"
FT                   /protein_id="YP_003609093.1"
FT   sig_peptide     109588..109668
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.983 at
FT                   residue 27"
FT                   /locus_tag="BC1002_5673"
FT   misc_feature    109738..110607
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5673"
FT   gene            110930..111841
FT                   /db_xref="GeneID:9091051"
FT                   /locus_tag="BC1002_5674"
FT   CDS_pept        110930..111841
FT                   /locus_tag="BC1002_5674"
FT                   /gene_family="HOG000220407" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_5702
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680520"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091051"
FT                   /translation="MSTPLLPAASWVSQQRRAFLLGLTPSLIALAAVTLVPTVVLIVVS
FT                   LTPLSLTNPAASFRFDDPLVNYRQLLHDTRFLDSVRTQLKLSVASVTSQLAIGLGLALL
FT                   LDGKSAFLRGVRTVFLIPMVLPPIVAALIWKILYSPDISPLHRALESAGYPVSSLIANP
FT                   STALWAVAAADTWQWFPFTMLMVLATLQTIPDDPLEAASLDGAGRWQLFRYIVLPYLRP
FT                   VLVVCGLFRLIDSFKAFPLIYVLTNGGPGTVTEVTNYYSFIEAFNFSYWGYGSAIATVI
FT                   LVGVFLLSWLVGKLGWNSHDAD"
FT                   /protein_id="YP_003609094.1"
FT   misc_feature    111266..111787
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5674"
FT   misc_feature    order(111272..111283,111287..111316,111323..111328,
FT                   111332..111334,111452..111457,111464..111466,
FT                   111470..111472,111479..111484,111488..111490,
FT                   111500..111505,111512..111514,111563..111565,
FT                   111605..111610,111617..111619,111638..111649,
FT                   111656..111661,111704..111709,111737..111742,
FT                   111749..111754,111758..111763,111770..111775,
FT                   111782..111787)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5674"
FT   misc_feature    order(111290..111334,111638..111655)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5674"
FT   misc_feature    order(111332..111334,111437..111439,111656..111658,
FT                   111698..111700,111707..111709,111737..111739)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5674"
FT   misc_feature    order(111515..111553,111569..111574,111584..111586)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5674"
FT   gene            111828..112757
FT                   /db_xref="GeneID:9091052"
FT                   /locus_tag="BC1002_5675"
FT   CDS_pept        111828..112757
FT                   /locus_tag="BC1002_5675"
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_5701
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680521"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091052"
FT                   /translation="MTQTSSSIDRDLPGAIGVSEDGHTAPVGRRRRKATRMYRLGAALQ
FT                   SHARAVVVVALLLVLLFPFLWLVQLALRPADTIFDDGLLFKPTLDAFRGLFHSSFVGSF
FT                   VNSLIVSTLSTLLSLLIGVPAAYTLTRWKFRARKQVALWILTTRMAPPIAFTIPFYLAY
FT                   RWLGLQDTIAGLVIVYLTFNLSIVVWLMQTFFEAVPRTLEEAAQIDGCGIWQAFWRVTL
FT                   PLAAPGLAATAVLCFIFSWNDFFYALILTRTNAITAPVSIVNFLQYEGWEWTKVAAAGT
FT                   LVMLPVVLFTVLVRTYLVRGLTAGGLKD"
FT                   /protein_id="YP_003609095.1"
FT   misc_feature    112191..112694
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5675"
FT   misc_feature    order(112197..112202,112215..112217,112245..112256,
FT                   112260..112289,112296..112301,112305..112307,
FT                   112368..112373,112377..112379,112383..112385,
FT                   112392..112397,112401..112403,112413..112418,
FT                   112425..112427,112476..112478,112518..112523,
FT                   112530..112532,112551..112562,112569..112574,
FT                   112611..112616,112644..112649,112656..112661,
FT                   112665..112670,112677..112682,112689..112694)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5675"
FT   misc_feature    order(112263..112307,112551..112568)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5675"
FT   misc_feature    order(112305..112307,112353..112355,112569..112571,
FT                   112605..112607,112614..112616,112644..112646)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5675"
FT   misc_feature    order(112428..112466,112482..112487,112497..112499)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5675"
FT   gene            112790..113860
FT                   /db_xref="GeneID:9091053"
FT                   /locus_tag="BC1002_5676"
FT   CDS_pept        112790..113860
FT                   /locus_tag="BC1002_5676"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ara:Arad_8127 sugar ABC transporter; PFAM: ABC
FT                   transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:295680522"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091053"
FT                   /translation="MSSLSIRNVHKRYDNTEAIRGIDVEIAEGEFVALVGPSGCGKSTL
FT                   LRMIAGLESVTEGDIMLGDQSINEFAPKDRNIAMVFQNYALYPHMTVAQNLAFSLQLKG
FT                   ASKAEMAVRVNDVAQSLGLTPLLERLPRQLSGGQRQRVAMGRAIVRQPQAFLFDEPLSN
FT                   LDASLRVKMRTEIKALHQRLRTTTIYVTHDQVEAMTMADRIVVLKDGLIEQVGTPLELY
FT                   DTPRNAFVAGFIGSPSMNFIHGHLDLNNGARVITDGGLQLPLATRPNAEQGARVVYGAR
FT                   PEDFRLDASGRGLPAEVVVVEPTGSETQIAVRFAGQDLIVAYRERIDARPGDRIHLLPC
FT                   GERAHLFDAYSGGRLN"
FT                   /protein_id="YP_003609096.1"
FT   misc_feature    112790..113857
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    112799..113437
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    112895..112918
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    order(112904..112909,112913..112921,113033..113035,
FT                   113261..113266,113363..113365)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113024..113035
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113189..113218
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113249..113266
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113273..113284
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113351..113371
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="BC1002_5676"
FT   misc_feature    113630..113830
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BC1002_5676"
FT   gene            complement(114124..114381)
FT                   /db_xref="GeneID:9091054"
FT                   /locus_tag="BC1002_5677"
FT   CDS_pept        complement(114124..114381)
FT                   /locus_tag="BC1002_5677"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:295680523"
FT                   /db_xref="GeneID:9091054"
FT                   /translation="MAAPLLKYRTLPTARIGIDELRSYVVRRYRSYAYRTEGFSMTVSG
FT                   RPFLTRTGSFIRSATMKFSFISWWSSDATCPPFFKESCFA"
FT                   /protein_id="YP_003609097.1"
FT   gene            complement(114530..114697)
FT                   /db_xref="GeneID:9091055"
FT                   /locus_tag="BC1002_5678"
FT                   /pseudo
FT   gene            complement(114816..115052)
FT                   /db_xref="GeneID:9091056"
FT                   /locus_tag="BC1002_5679"
FT   CDS_pept        complement(114816..115052)
FT                   /locus_tag="BC1002_5679"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ATP-dependent RNA helicase, putative; K10901
FT                   bloom syndrome protein"
FT                   /db_xref="GI:295680524"
FT                   /db_xref="GeneID:9091056"
FT                   /translation="MMETTVIDPAEDALYDHIRLLLFSADLPVHRLEADIEDIGRFTAP
FT                   DVRSPHLRLVEALPPLTPAAEAIVRAMIRAGWY"
FT                   /protein_id="YP_003609098.1"
FT   gene            complement(115183..115425)
FT                   /db_xref="GeneID:9091057"
FT                   /locus_tag="BC1002_5680"
FT   CDS_pept        complement(115183..115425)
FT                   /locus_tag="BC1002_5680"
FT                   /gene_family="HOG000268912" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6101"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_6101 hypothetical protein"
FT                   /db_xref="GI:295680525"
FT                   /db_xref="GeneID:9091057"
FT                   /translation="MQAENMMEYHGCEIRPVVTATEKGRYAATAVVTDRAGEIRTLGVD
FT                   GDFSNVEEARDEALELAVAWIHGRSVVSERYVRRT"
FT                   /protein_id="YP_003609099.1"
FT   gene            115659..116297
FT                   /db_xref="GeneID:9091058"
FT                   /locus_tag="BC1002_5681"
FT   CDS_pept        115659..116297
FT                   /locus_tag="BC1002_5681"
FT                   /gene_family="HOG000263104" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bamb_6394"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6394 hypothetical protein"
FT                   /db_xref="GI:295680526"
FT                   /db_xref="GeneID:9091058"
FT                   /translation="MELFDRLQEQIDTVRLPLFAVTVTAVAQVNTPLFAILHWHGFRRA
FT                   TPLVLPGIEIPRRPVPGSAFRFDAPWHSFETVDAMLLDAAWQSGAWDVERVERRGCNVI
FT                   GASEAEALACRQAFGSYPEHGARDPQLVSDDMDRDALMRLAAHSGYLRWLFRPVKGGLW
FT                   GTLNEPDDTLDADGGRQPPCPVPPEPLRPDRRGRTVYRLGKVQRLLLPR"
FT                   /protein_id="YP_003609100.1"
FT   gene            116466..116783
FT                   /db_xref="GeneID:9091059"
FT                   /locus_tag="BC1002_5682"
FT   CDS_pept        116466..116783
FT                   /locus_tag="BC1002_5682"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /codon_start="1"
FT                   /product="Chaperonin Cpn10"
FT                   /transl_table="11"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: bam:Bamb_6393
FT                   chaperonin Cpn10"
FT                   /db_xref="GI:295680527"
FT                   /db_xref="InterPro:IPR001476"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="GeneID:9091059"
FT                   /translation="MQIRPLYDRVIVKRIETQRTTASGIVIPDSAAEKPEQGEVVAVGS
FT                   GRLLQDGTLRALQLKVGDHVLFGKYAGQTVKVDGEDLLVMREEDVMGVLEADAGAARKA
FT                   A"
FT                   /protein_id="YP_003609101.1"
FT   misc_feature    116472..116747
FT                   /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
FT                   cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
FT                   to assist the folding and assembly of proteins and is found
FT                   in eubacterial cytosol, as well as in the matrix of
FT                   mitochondria and chloroplasts...; Region: cpn10; cd00320"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5682"
FT   misc_feature    order(116475..116477,116481..116483,116490..116492,
FT                   116571..116576,116637..116639,116667..116669,
FT                   116682..116684,116688..116690,116736..116744)
FT                   /note="oligomerisation interface; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5682"
FT   misc_feature    116517..116558
FT                   /note="mobile loop; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5682"
FT   misc_feature    order(116598..116600,116631..116633)
FT                   /note="roof hairpin; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5682"
FT   gene            116860..118482
FT                   /db_xref="GeneID:9091060"
FT                   /locus_tag="BC1002_5683"
FT   CDS_pept        116860..118482
FT                   /locus_tag="BC1002_5683"
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /codon_start="1"
FT                   /product="chaperonin GroEL"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_6096 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="GI:295680528"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="GeneID:9091060"
FT                   /translation="MSAKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFG
FT                   APTITKDGVSVAKEIELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQAIVQEGM
FT                   KHVAAGMNPMDLKRGIDKAVAAVLDELRNLSKPISTNREIAQVGSISANSDEAIGKIIA
FT                   EAMEKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILL
FT                   HDKKISSIRDLLPALEATSKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGF
FT                   GDRRKAMLEDIAVLTGATVISEETGKQLQNATLEDLGRAKRVEVRKGDTIIIDGAGDEK
FT                   RIEARVKSIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALLRARSVVTSLKGLNSDQDAGIQIVLRALEAPMRVIASNA
FT                   GDEPSVVIAKVLEGKGNFGYNAATGEFGDLVEAGVVDPTKVARTALQNAASIAGLILTT
FT                   DATVAEAPKDEKPAQASTPELEY"
FT                   /protein_id="YP_003609102.1"
FT   misc_feature    116866..118458
FT                   /note="chaperonin GroEL; Reviewed; Region: groEL; PRK12849"
FT                   /db_xref="CDD:171768"
FT                   /locus_tag="BC1002_5683"
FT   misc_feature    116869..118428
FT                   /note="GroEL_like type I chaperonin. Chaperonins are
FT                   involved in productive folding of proteins. They share a
FT                   common general morphology, a double toroid of 2 stacked
FT                   rings, each composed of 7-9 subunits. The symmetry of type
FT                   I is seven-fold and they are found...; Region: GroEL;
FT                   cd03344"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5683"
FT   misc_feature    order(116869..116871,116881..116883,116932..116934,
FT                   116965..116976,116980..116982,116995..117000,
FT                   117004..117006,117034..117036,117040..117042,
FT                   117064..117066,117076..117078,117085..117087,
FT                   117448..117450,117544..117546,117628..117630,
FT                   118009..118011,118015..118017,118234..118236,
FT                   118396..118398,118405..118425)
FT                   /note="ring oligomerisation interface; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5683"
FT   misc_feature    order(116950..116958,117118..117120,117130..117132,
FT                   117307..117309,118051..118053,118102..118104,
FT                   118219..118221,118336..118338,118342..118344)
FT                   /note="ATP/Mg binding site; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5683"
FT   misc_feature    order(117184..117186,118159..118161,118213..118215,
FT                   118240..118242,118246..118251,118258..118260)
FT                   /note="stacking interactions; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5683"
FT   misc_feature    order(117280..117282,117415..117417,117436..117438,
FT                   117982..117984,118084..118089)
FT                   /note="hinge regions; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5683"
FT   gene            complement(118545..118617)
FT                   /note="tRNA-Lys4"
FT                   /db_xref="GeneID:9091061"
FT                   /locus_tag="BC1002_R0097"
FT   tRNA            complement(118545..118617)
FT                   /db_xref="GeneID:9091061"
FT                   /locus_tag="BC1002_R0097"
FT                   /product="tRNA-Lys"
FT   gene            complement(118660..119223)
FT                   /db_xref="GeneID:9091062"
FT                   /locus_tag="BC1002_5684"
FT   CDS_pept        complement(118660..119223)
FT                   /locus_tag="BC1002_5684"
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /codon_start="1"
FT                   /product="heat shock protein Hsp20"
FT                   /transl_table="11"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   bac:BamMC406_6093 heat shock protein HSP20"
FT                   /db_xref="GI:295680529"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="GeneID:9091062"
FT                   /translation="MNSDSKKWNPFKFLRGTAPKTDADNPESTPAGEQWRSAWPDIPRL
FT                   FSREPWRSVEEFFHDPFAGHGALERWFGDFSSSRFQPRIDVVDEGPVLRVTAELPGMER
FT                   EDVSASVEDGVIVLHGEKKQDVHSEENGCYRLERAHGHFVRTIPMPEYADPGRALAKFD
FT                   NGVLTLTVPKIKPAPSASRASGIS"
FT                   /protein_id="YP_003609103.1"
FT   misc_feature    complement(118663..119082)
FT                   /note="Molecular chaperone (small heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: IbpA; COG0071"
FT                   /db_xref="CDD:30420"
FT                   /locus_tag="BC1002_5684"
FT   misc_feature    complement(118705..118971)
FT                   /note="Alpha-crystallin domain (ACD) of
FT                   alpha-crystallin-type small(s) heat shock proteins (Hsps).
FT                   sHsps are small stress induced proteins with monomeric
FT                   masses between 12 -43 kDa, whose common feature is the
FT                   Alpha-crystallin domain  (ACD). sHsps are...; Region:
FT                   ACD_sHsps-like; cd06464"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5684"
FT   misc_feature    complement(order(118726..118731,118789..118791,
FT                   118921..118926,118930..118932,118936..118938,
FT                   118957..118971))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5684"
FT   gene            complement(119372..119779)
FT                   /db_xref="GeneID:9091063"
FT                   /locus_tag="BC1002_5685"
FT   CDS_pept        complement(119372..119779)
FT                   /locus_tag="BC1002_5685"
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /codon_start="1"
FT                   /product="heat shock protein Hsp20"
FT                   /transl_table="11"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bxe:Bxe_A2601
FT                   HSP20 family heat-shock protein"
FT                   /db_xref="GI:295680530"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="GeneID:9091063"
FT                   /translation="MSDTTELSKREPSAVTRSESGSSARRMTITPAVDIYEDTQGVTLW
FT                   ADLPGVTKEKLDVRVHDGNLAIEAEAVVPTPANLRLQHAEIREPRFARTFTLSPDFDTS
FT                   KIEASLKDGVLKLTIPRRDEARPRRIEVSTG"
FT                   /protein_id="YP_003609104.1"
FT   misc_feature    complement(119417..119680)
FT                   /note="Alpha-crystallin domain (ACD) of
FT                   alpha-crystallin-type small(s) heat shock proteins (Hsps).
FT                   sHsps are small stress induced proteins with monomeric
FT                   masses between 12 -43 kDa, whose common feature is the
FT                   Alpha-crystallin domain  (ACD). sHsps are...; Region:
FT                   ACD_sHsps-like; cd06464"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5685"
FT   misc_feature    complement(order(119438..119443,119501..119503,
FT                   119630..119635,119639..119641,119645..119647,
FT                   119666..119680))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5685"
FT   gene            complement(119795..120235)
FT                   /db_xref="GeneID:9091064"
FT                   /locus_tag="BC1002_5686"
FT   CDS_pept        complement(119795..120235)
FT                   /locus_tag="BC1002_5686"
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /codon_start="1"
FT                   /product="heat shock protein Hsp20"
FT                   /transl_table="11"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   bac:BamMC406_6091 heat shock protein HSP20"
FT                   /db_xref="GI:295680531"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="GeneID:9091064"
FT                   /translation="MSDLYYGTDLFSEFDRLQRQMAHFFGTFPSSLRASRLGSLPPVNI
FT                   GATDDSIHIVAFAPGVNAAELDISIDKGLLTISGERKPARPDTGEDARVYAQERFTGAF
FT                   RRVIELPENADPDKVEARYENGCLSIAIGKRESSKPRAITVQ"
FT                   /protein_id="YP_003609105.1"
FT   misc_feature    complement(119801..120205)
FT                   /note="Molecular chaperone (small heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: IbpA; COG0071"
FT                   /db_xref="CDD:30420"
FT                   /locus_tag="BC1002_5686"
FT   misc_feature    complement(119834..120094)
FT                   /note="Alpha-crystallin domain (ACD) of
FT                   alpha-crystallin-type small(s) heat shock proteins (Hsps).
FT                   sHsps are small stress induced proteins with monomeric
FT                   masses between 12 -43 kDa, whose common feature is the
FT                   Alpha-crystallin domain  (ACD). sHsps are...; Region:
FT                   ACD_sHsps-like; cd06464"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5686"
FT   misc_feature    complement(order(119855..119860,119918..119920,
FT                   120056..120061,120065..120067,120071..120073,
FT                   120092..120094))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="BC1002_5686"
FT   gene            120483..120866
FT                   /db_xref="GeneID:9091065"
FT                   /locus_tag="BC1002_5687"
FT   CDS_pept        120483..120866
FT                   /locus_tag="BC1002_5687"
FT                   /gene_family="HOG000058981" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5263"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5263 hypothetical protein"
FT                   /db_xref="GI:295680532"
FT                   /db_xref="GeneID:9091065"
FT                   /translation="MEFDTDWLTLGPHRVRLRSTKGFPTEAMRKAVEVVRIAVDSNMSA
FT                   RARLVEVVCRQEKIYEVTIGTTVAKDKACAPQLETFIAGVLGLPSDHINLIVTTVEQSE
FT                   VDLHFGVYERMLAEKLGTAPPIQ"
FT                   /protein_id="YP_003609106.1"
FT   gene            121559..121852
FT                   /db_xref="GeneID:9091066"
FT                   /locus_tag="BC1002_5688"
FT   CDS_pept        121559..121852
FT                   /locus_tag="BC1002_5688"
FT                   /gene_family="HOG000121748" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2607"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2607 hypothetical protein"
FT                   /db_xref="GI:295680533"
FT                   /db_xref="GeneID:9091066"
FT                   /translation="MKTIKIERCNGYEIGIRTVLVHDGNGRPEADATSAGGYAAFVQIA
FT                   RDGEVCVDWHMPQRQRRCATREDAQAQAMDYAVHLVERRPFDGLPPDFPDAA"
FT                   /protein_id="YP_003609107.1"
FT   gene            122007..122378
FT                   /db_xref="GeneID:9091067"
FT                   /locus_tag="BC1002_5689"
FT   CDS_pept        122007..122378
FT                   /locus_tag="BC1002_5689"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2604"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2604 hypothetical protein"
FT                   /db_xref="GI:295680534"
FT                   /db_xref="GeneID:9091067"
FT                   /translation="MKRRLCVLVPAAMIAGLWSENVMSASPLPTLPLQHDIWITGTVER
FT                   GGGKYALGDYPTIVLDRPSTSPCNDSVLSDIPLADGGEAAPSLLLPYLNQRVAVKGRVS
FT                   CPDSGIQFTPQPDVVFPVW"
FT                   /protein_id="YP_003609108.1"
FT   sig_peptide     122007..122081
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.976 at
FT                   residue 25"
FT                   /locus_tag="BC1002_5689"
FT   gene            122650..122959
FT                   /db_xref="GeneID:9091068"
FT                   /locus_tag="BC1002_5690"
FT                   /pseudo
FT   gene            complement(122960..123742)
FT                   /db_xref="GeneID:9091069"
FT                   /locus_tag="BC1002_5691"
FT   CDS_pept        complement(122960..123742)
FT                   /locus_tag="BC1002_5691"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0193 peptide/opine/nickel ABC
FT                   transporter ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:295680535"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091069"
FT                   /translation="MIDVDALTVRFKTRTGRFDAVRAASFHVGEGEVFGLVGESGSGKS
FT                   TILRALTGLAPVAGGHMKIGSHVLGKKLDRSFRRDVQMVFQDPYGSLHPRFTIDQSLRE
FT                   PLTINGIGGQEERIVDALREVGLGPSYRFRYPHQLSGGQRQRVAIARALIVEPRVLLLD
FT                   EPTSALDVSVQAEILNLLTRLHRERNLTMMLVSHNLAVVGFLCSRVAVMRHGEIVEQRD
FT                   IASIRAQQIEHEYTRSLLLATAGYRRKSVAVDGADALS"
FT                   /protein_id="YP_003609109.1"
FT   misc_feature    complement(122993..123742)
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism / Inorganic ion transport and metabolism];
FT                   Region: DppF; COG1124"
FT                   /db_xref="CDD:31321"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123083..123742)
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123608..123631)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(order(123152..123154,123251..123256,
FT                   123485..123487,123605..123613,123617..123622))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123485..123496)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123299..123328)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123251..123268)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123233..123244)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   misc_feature    complement(123146..123166)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5691"
FT   gene            complement(123739..124617)
FT                   /db_xref="GeneID:9091070"
FT                   /locus_tag="BC1002_5692"
FT   CDS_pept        complement(123739..124617)
FT                   /locus_tag="BC1002_5692"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6304 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295680536"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9091070"
FT                   /translation="MPVEMARILCEIDDLRIGFRGHGGELSEAVRGLSLTLRRGERLGI
FT                   VGESGSGKSLTGRALLGLLPPEAQCHAKAMKFDGQDLLAMPARKRRQLCGQQMGMILQD
FT                   PKYSLNPVMTVAQQMREAFELHGSKFGRREIREKIIEALAAVHIRDPERVADSYPHELS
FT                   GGMGQRVMIAMMVSSGPRLLIADEPTSALDVLVSMQVLGILDEMIAKHDTGLIFISHDL
FT                   PLVMSFCDRVVVMFAGRVVETCAARDLVHAQHPYTRALLAANPPLVDPPEQLPVLKRDA
FT                   AWLTQPAGESA"
FT                   /protein_id="YP_003609110.1"
FT   misc_feature    complement(123808..124593)
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism / Inorganic ion transport and metabolism];
FT                   Region: DppF; COG1124"
FT                   /db_xref="CDD:31321"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(123889..124593)
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(124456..124479)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(order(123958..123960,124057..124062,
FT                   124309..124311,124453..124461,124465..124470))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(124309..124320)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(124105..124134)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(124057..124074)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(124039..124050)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   misc_feature    complement(123952..123972)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5692"
FT   gene            complement(124619..125533)
FT                   /db_xref="GeneID:9091071"
FT                   /locus_tag="BC1002_5693"
FT   CDS_pept        complement(124619..125533)
FT                   /locus_tag="BC1002_5693"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_6303
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680537"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091071"
FT                   /translation="MNAAPRRWKDWLLSDTPASRKQAALGLAYRRWRRFAGNPLSVFGL
FT                   VILALLIIIAAIGPLMSPHDPLQQVLSDRLLPPGSPSHWFGTDQLGRDILSRLIYGSRL
FT                   TLSIAILVVVIVVPVGLLIGTTAGFFGGWVDNLLMRITDVALAFPKIVLALAFAAALGP
FT                   GVINAVIAISITAWPAYARLARAETLRLVQADFIHVARLQGASRKRILLLYIMPLCSSS
FT                   VIVRATLDMAGIILTVAGLGFLGLGAQPPSPEWGFMVASGRNVLLDSWWVATIPGFAIL
FT                   LVSLAFNLLGDGLRDVFDPRHGG"
FT                   /protein_id="YP_003609111.1"
FT   misc_feature    complement(124679..125164)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5693"
FT   misc_feature    complement(order(124679..124684,124691..124696,
FT                   124703..124708,124712..124717,124724..124726,
FT                   124730..124732,124760..124765,124805..124810,
FT                   124817..124828,124847..124849,124856..124861,
FT                   124901..124903,124952..124954,124961..124966,
FT                   124976..124978,124982..124987,124994..124996,
FT                   125000..125002,125006..125011,125060..125062,
FT                   125066..125071,125078..125107,125111..125122,
FT                   125150..125152))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5693"
FT   misc_feature    complement(order(124811..124828,125060..125104))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5693"
FT   misc_feature    complement(order(124730..124732,124760..124762,
FT                   124769..124771,124808..124810,125024..125026,
FT                   125060..125062))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5693"
FT   misc_feature    complement(order(124880..124882,124892..124897,
FT                   124913..124951))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5693"
FT   gene            complement(125598..126668)
FT                   /db_xref="GeneID:9091072"
FT                   /locus_tag="BC1002_5694"
FT   CDS_pept        complement(125598..126668)
FT                   /locus_tag="BC1002_5694"
FT                   /gene_family="HOG000170242" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_6302
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680538"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091072"
FT                   /translation="MSTRLTTFERMRALSVESASVRWTLRLVRWIVTLVVTFAGLLAVT
FT                   FVIGRKIPIDPVLAILGDRASAAAYAAARLQLGLDAPLAVQFLIYVRDVLHGNFGMSLL
FT                   TAHPVIEDIQRVFPATLELATLSTIIGVLIGVPLGVIAAVRHNRWIDHVARFVGLVGSS
FT                   VPVFWLGLMGLLLFYAKLHWVAGPGRVDPVFDGMVDTRTGSLLIDSLIAGEWDVFFNAF
FT                   SHIALPAAILGYYSVAYLSRMTRSFMLDQLSQEYITTARAKGLPERRVVWRHAFGNIAV
FT                   PLLTVIALTYSYLLEGSVLTEIVFAWPGIGSYLTGALLNADMNAVLGSTLVIGVTFIAL
FT                   NLLTDALYRVFDPRAR"
FT                   /protein_id="YP_003609112.1"
FT   misc_feature    complement(125628..126320)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5694"
FT   misc_feature    complement(order(125628..125633,125640..125645,
FT                   125652..125657,125661..125666,125673..125678,
FT                   125706..125711,125760..125765,125772..125783,
FT                   125802..125804,125811..125816,125856..125858,
FT                   125907..125909,125916..125921,125931..125933,
FT                   125937..125942,125949..125951,125955..125957,
FT                   125961..125966,126147..126149,126153..126158,
FT                   126165..126194,126198..126209,126240..126242,
FT                   126255..126260,126267..126272))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5694"
FT   misc_feature    complement(order(125766..125783,126147..126191))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5694"
FT   misc_feature    complement(order(125676..125678,125706..125708,
FT                   125715..125717,125763..125765,125979..125981,
FT                   126147..126149))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5694"
FT   misc_feature    complement(order(125835..125837,125847..125852,
FT                   125868..125906))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5694"
FT   gene            complement(126724..128331)
FT                   /db_xref="GeneID:9091073"
FT                   /locus_tag="BC1002_5695"
FT   CDS_pept        complement(126724..128331)
FT                   /locus_tag="BC1002_5695"
FT                   /gene_family="HOG000200399" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bpy:Bphyt_6301 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="GI:295680539"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="GeneID:9091073"
FT                   /translation="MKLVLRNALTAAVISSALTLSFTAAVPAAAATPKDMFVMATLLDE
FT                   FTTLDPGEIYELVPEEYVANTYDRLVRVDLKDPSKFNGDVAQSWSVSPDGLTFTFKIRP
FT                   GLKFHSGNALSADDVAWSIQRTVLLDKGAAAVLQGIGLTKDNVLANVKKVDDTTVSVTT
FT                   DQKYAPTFVLNVLGSWPASVVDKQLLLTHQKGNDFGNEWLRTNEAGSGAYKLVKWTAND
FT                   SIVLQRFDGYRVPLAMKRIVLRHVPEASSQRLLLENGDVDVARNLSPDDLVALTKSGKA
FT                   HVSAVPQATLLYLGLNVKNPNLVKPEVQQAMKWLIDYNGIQSNVAKTTYKVHETFLPEG
FT                   FLGALNTDPYQQNVVKAKELLAKAGLPNGFSVTMDVRNGYPYSEIAEAVQANLAQGGIK
FT                   VQIIPGDNKQTLAKYRSRSHDIYIGEWSADYIDPHSNAQGFTWNPDNSDKSAYKMLAWR
FT                   NSWDIPGLTKETNAALAESSTAKRADLYQTMQKQVLASSPFVIMFQQVSQVAARPGVTG
FT                   LEVGPINDLVSYRDLKKQ"
FT                   /protein_id="YP_003609113.1"
FT   sig_peptide     complement(128239..128331)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 31"
FT                   /locus_tag="BC1002_5695"
FT   misc_feature    complement(126781..128232)
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_7; cd08512"
FT                   /db_xref="CDD:173877"
FT                   /locus_tag="BC1002_5695"
FT   misc_feature    complement(126988..128094)
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 5 Middle; Region: SBP_bac_5; pfam00496"
FT                   /db_xref="CDD:144185"
FT                   /locus_tag="BC1002_5695"
FT   gene            complement(128395..128958)
FT                   /db_xref="GeneID:9091074"
FT                   /locus_tag="BC1002_5696"
FT   CDS_pept        complement(128395..128958)
FT                   /locus_tag="BC1002_5696"
FT                   /gene_family="HOG000200848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01427"
FT                   /codon_start="1"
FT                   /product="peptidase M15D vanX D-ala-D-ala dipeptidase"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   KEGG: bpy:Bphyt_6300 D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="GI:295680540"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="GeneID:9091074"
FT                   /translation="MTQPRLIEITAATHGVDIDLVYATERNLTGKPIYKEAHCLLLEPA
FT                   EAALREAVEIARNAGLTVRIFDAYRPPQAQQVLWNFLPDPTYIAELGRGSNHSRGTAID
FT                   LTLLDADGNELDMGTGFDAMTIESEHFHTGLPAHVQRNRVLLLGIMHAAGFIHIKSEWW
FT                   HYELPGSRALPLIDNSESGPLRLM"
FT                   /protein_id="YP_003609114.1"
FT   misc_feature    complement(128398..128958)
FT                   /note="D-alanyl-D-alanine carboxypeptidase; Region: VanY;
FT                   cl00813"
FT                   /db_xref="CDD:174403"
FT                   /locus_tag="BC1002_5696"
FT   gene            complement(129028..129877)
FT                   /db_xref="GeneID:9091075"
FT                   /locus_tag="BC1002_5697"
FT                   /pseudo
FT   gene            130591..131061
FT                   /db_xref="GeneID:9091076"
FT                   /locus_tag="BC1002_5698"
FT                   /pseudo
FT   gene            130988..131530
FT                   /db_xref="GeneID:9091077"
FT                   /locus_tag="BC1002_5699"
FT                   /pseudo
FT   gene            complement(131860..132765)
FT                   /db_xref="GeneID:9091078"
FT                   /locus_tag="BC1002_5700"
FT   CDS_pept        complement(131860..132765)
FT                   /locus_tag="BC1002_5700"
FT                   /gene_family="HOG000263700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_5259
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680541"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091078"
FT                   /translation="MQAIRVKHRERRPASFYWLALLFGLFVLFLYGPVITIFILSFQGP
FT                   EGGLTFPMRGVSLHWFAALRDGVGDVDIWGAFGRSVRLALAVTVLTVLFSVAAGLAFRR
FT                   KFRGDTAVFYVSVASLIMPSIIVSLGIGLTFRLLDNGVKYLASTWGYQSFSDSYTTSMG
FT                   LFTSALGAHLTWTLPFGLLVMFAVFNRFNPGYEEASRDLGATPWQSFLHVVLPIIGPSV
FT                   VGVAMFGFTLSWDEIARTSQAIGDQNTLPLELQGLTTSVTTPVIYALGTMTTVLSLTVM
FT                   GGCLLAVRVLARRRAVAGLK"
FT                   /protein_id="YP_003609115.1"
FT   misc_feature    complement(131923..132468)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5700"
FT   misc_feature    complement(order(131923..131925,131932..131937,
FT                   131944..131949,131953..131958,131965..131970,
FT                   131998..132003,132040..132045,132052..132063,
FT                   132082..132084,132091..132096,132136..132138,
FT                   132187..132189,132196..132201,132211..132213,
FT                   132217..132222,132229..132231,132235..132237,
FT                   132241..132243,132247..132249,132370..132372,
FT                   132376..132381,132388..132417,132421..132432,
FT                   132460..132462))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5700"
FT   misc_feature    complement(order(132046..132063,132370..132414))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5700"
FT   misc_feature    complement(order(131968..131970,131998..132000,
FT                   132007..132009,132043..132045,132262..132264,
FT                   132370..132372))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5700"
FT   misc_feature    complement(order(132115..132117,132127..132132,
FT                   132148..132186))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5700"
FT   gene            complement(132768..133682)
FT                   /db_xref="GeneID:9091079"
FT                   /locus_tag="BC1002_5701"
FT   CDS_pept        complement(132768..133682)
FT                   /locus_tag="BC1002_5701"
FT                   /gene_family="HOG000263581" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_5258
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680542"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091079"
FT                   /translation="MATIDLPSHAQDTTVKHRRAPAWLQATPLSLTFLLFFIVPLVITL
FT                   IVSFWDFNEYQIIPAFTLKNYAAIFNGCSSMTDVCVTFKTYWSTLKFCAIVWAMTLLLG
FT                   FSIAYFLAFHVRTTSMQTVLFLVCTIPFWTSNVIRMISWMPLLGRNGLVNQVLLGAHLI
FT                   DQPLEWLLYSNFSVVLAFVHLYTFFMIVPIFNAMMRIERSLLEAARDAGASGWQVVRDV
FT                   VLPLSKTGIVIGSIFVITIVMGDFLTVGVMGGQQIASVGKVIQVQTGYLQFPAAAANAI
FT                   ILLAVVLMIVWGLTRVVDIRREL"
FT                   /protein_id="YP_003609116.1"
FT   misc_feature    complement(132921..133427)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5701"
FT   misc_feature    complement(order(132930..132935,132942..132953,
FT                   132972..132974,132981..132986,133026..133028,
FT                   133077..133079,133086..133091,133101..133103,
FT                   133107..133112,133119..133121,133125..133127,
FT                   133131..133133,133137..133139,133251..133253,
FT                   133257..133262,133269..133298,133302..133313,
FT                   133347..133349,133362..133367,133374..133379))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5701"
FT   misc_feature    complement(order(132936..132953,133251..133295))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5701"
FT   misc_feature    complement(order(132933..132935,133152..133154,
FT                   133251..133253))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5701"
FT   misc_feature    complement(order(133005..133007,133017..133022,
FT                   133038..133076))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5701"
FT   gene            complement(133811..135106)
FT                   /db_xref="GeneID:9091080"
FT                   /locus_tag="BC1002_5702"
FT   CDS_pept        complement(133811..135106)
FT                   /locus_tag="BC1002_5702"
FT                   /gene_family="HOG000005619" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5257"
FT                   /codon_start="1"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5257 ABC spermidine/putrescine
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="GI:295680543"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091080"
FT                   /translation="MSETNESPAAAATDVKEKGLSRRTFIKGAVAAAGIAGFPYVHAQE
FT                   KITLRYLGTAVNQSADIAKKFKEDTGIEIQYVPVTTDDVAKRIITQPNSFDIVDTEYFA
FT                   LKKLIPAGTLAGMDAKRIKLADKITPVLTRGEVNGKKIGDQGTAPKKVMFLTGPRSTEF
FT                   SATPTEWMTLIPTTYNADTLGIRPDLIKRPIDSWAELLNPQFKGKAALLNIPAIGIMDS
FT                   AMAIEAMGHMKYGDKGNMTRAEIDQTIKILIDAKHAGQFRAFWKDFNESVNLMASGEVV
FT                   IQSMWSPAVTKVRTMGIACKFQPLKEGYRSWASGFGFPRSLQGKKLDAAYEFVNWFQDG
FT                   WAGAYLMRQGYYPGVIETAKTHMQPYEWDYWIEGKAAAQDIKAPDGQLLEKAGAVRDGG
FT                   SYTQRMSAIACWNAVMDENIYMVQKWNEFIAA"
FT                   /protein_id="YP_003609117.1"
FT   misc_feature    complement(134018..135055)
FT                   /note="Spermidine/putrescine-binding periplasmic protein
FT                   [Amino acid transport and metabolism]; Region: PotD;
FT                   COG0687"
FT                   /db_xref="CDD:31031"
FT                   /locus_tag="BC1002_5702"
FT   misc_feature    complement(<134096..>134587)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5702"
FT   gene            complement(135188..136246)
FT                   /db_xref="GeneID:9091081"
FT                   /locus_tag="BC1002_5703"
FT   CDS_pept        complement(135188..136246)
FT                   /locus_tag="BC1002_5703"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1362 ABC spermidine/putrescine
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="GI:295680544"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091081"
FT                   /translation="MIQPASTVLETKAADIELVHVSKQYGDSLAVDAIDLRIAGGQYCC
FT                   LLGPSGCGKTSTLRMIAGHESVTEGDILIAGRNVTRAEPAARGTAMVFQNYALFPHLSA
FT                   LDNVAFSLKVRGVAKDVRRKRAAELLELVAMSAYAERKPAQLSGGQQQRVALARALLNQ
FT                   PGCLLLDEPLSALDPFLRVQMRAELKRWQKDLGITFVHVTHSQEEAMALADLVVVMSHG
FT                   RIEQSGTPHEVFNRPRTEFVARFLGGHNVFNTNGRLFTVRADHLRVVPHGVTPVQNAGG
FT                   ESGLTRIGGVPCRVREAEYQGTHLRMTLDPLDGSPELISLVSDGDYDATRLGPDARVVI
FT                   WWNERDAHPLAA"
FT                   /protein_id="YP_003609118.1"
FT   misc_feature    complement(135191..136216)
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135506..136201)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(136082..136105)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(order(135635..135637,135734..135739,
FT                   135965..135967,136079..136087,136091..136096))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135965..135976)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135782..135811)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135734..135751)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135716..135727)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135629..135649)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5703"
FT   misc_feature    complement(135203..135394)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BC1002_5703"
FT   gene            136472..137530
FT                   /db_xref="GeneID:9091082"
FT                   /locus_tag="BC1002_5704"
FT   CDS_pept        136472..137530
FT                   /locus_tag="BC1002_5704"
FT                   /gene_family="HOG000077503" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /codon_start="1"
FT                   /product="polysaccharide deacetylase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1363 hypothetical protein; manually
FT                   curated; PFAM: polysaccharide deacetylase"
FT                   /db_xref="GI:295680545"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="GeneID:9091082"
FT                   /translation="MRLRSVSGHELTNPVHPLRVVALFVIHDFLLMNDTRNMPLAENRA
FT                   RQSLATHGRFAYRPITDSDAFRWPGDTGLAVYLGFNIEHFAFGEGLGAALGPLSPQPDV
FT                   LNHSWREYGNRVGAWRCIELFDQLALPAGTLINTALYDHCPELIAACVARGDELIGHGH
FT                   TNAHRQSDLDESGERELLLHCCERIAEESGTPPQGWLSPWISESHLTPDLLAETGYRYT
FT                   LNWCHDDRPVRMATRGAPLWSIPYPQELNDLPMMVGRHMDGRAFADMIVDQFDEMLEQA
FT                   NRGAQAQALVMGIALHPYLVGQPYRLRHLRRALEHIATARARGDVWITTPGEIASHMDD
FT                   LERAGIVRPAVA"
FT                   /protein_id="YP_003609119.1"
FT   misc_feature    <136802..137482
FT                   /note="putative urate catabolism protein; Region:
FT                   uraD_N-term-dom; TIGR03212"
FT                   /db_xref="CDD:163185"
FT                   /locus_tag="BC1002_5704"
FT   misc_feature    136802..137134
FT                   /note="Polysaccharide deacetylase; Region: Polysacc_deac_1;
FT                   cl12061"
FT                   /db_xref="CDD:164326"
FT                   /locus_tag="BC1002_5704"
FT   gene            137527..138282
FT                   /db_xref="GeneID:9091083"
FT                   /locus_tag="BC1002_5705"
FT   CDS_pept        137527..138282
FT                   /locus_tag="BC1002_5705"
FT                   /gene_family="HOG000273995" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1364 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295680546"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091083"
FT                   /translation="MSAKAGAANAKKNAGDDTDINARIYQSIFDGVMNHRLIPGTKLPE
FT                   PELCQLFGVGRAVVRRVLEKLAYDGIVVLRPNKGAVIAEPSPEETREIFEARRSVERML
FT                   VELAVQRASATDIKALRQQLASEHDAMHRYDQPSWATLASGFHMRIAALAGNSILQNYL
FT                   KELVSRCSLIVGVYEPPGHAPCEHAEHAAIVDCIEARDSAGAMGHMEAHLRDLEERIET
FT                   SRMRGEKSLGQLLGIIEPTTTNQAARHGN"
FT                   /protein_id="YP_003609120.1"
FT   misc_feature    137593..138219
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   GntR; COG1802"
FT                   /db_xref="CDD:31987"
FT                   /locus_tag="BC1002_5705"
FT   misc_feature    137593..137775
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5705"
FT   misc_feature    order(137656..137658,137659..137664,137686..137700,
FT                   137704..137709,137716..137718,137746..137751,
FT                   137755..137766)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5705"
FT   misc_feature    137800..138171
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_5705"
FT   gene            138272..138862
FT                   /db_xref="GeneID:9091084"
FT                   /locus_tag="BC1002_5706"
FT   CDS_pept        138272..138862
FT                   /locus_tag="BC1002_5706"
FT                   /gene_family="HOG000260253" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /codon_start="1"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: bpy:Bphyt_5253 flavin reductase domain protein
FT                   FMN-binding"
FT                   /db_xref="GI:295680547"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="GeneID:9091084"
FT                   /translation="MEIDFEAITEYQRYKLMASLIVPRPIALVTTLGADGTINAAPFSM
FT                   FNMLGEEPPIVMISINRVADGTLKDTAVNIVRTGEFVVHLADETIAEKMHRCGERLPPN
FT                   VSELVEVGLTPVPSSCVAPPRIAEAPVAFECTIWETLETTTRQIFIGRVHRLHARDELI
FT                   DTETWRVRLQHYFPVGRFGASDYVTTRDRFTLG"
FT                   /protein_id="YP_003609121.1"
FT   misc_feature    138308..138853
FT                   /note="Flavin Reductases; Region: FlaRed; cl00801"
FT                   /db_xref="CDD:154006"
FT                   /locus_tag="BC1002_5706"
FT   gene            complement(139038..140624)
FT                   /db_xref="GeneID:9091085"
FT                   /locus_tag="BC1002_5707"
FT   CDS_pept        complement(139038..140624)
FT                   /locus_tag="BC1002_5707"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /codon_start="1"
FT                   /EC_number="2.3.2.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: gamma-glutamyltransferase; KEGG:
FT                   bpy:Bphyt_5252 gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="GI:295680548"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:9091085"
FT                   /translation="MRDTRLAGPTGGMVTSPHALASEAGRDVLRAGGNAIEAAIAIGAA
FT                   LCVTYPHFTGLGGDAFWVIGDREGTLRTLSGIGQAPAQLPAFDGAIPLRGAASALTTAA
FT                   TVDAWQHAYEVSKSAWGGTQSWSSLFDRALNYAGDGFPVTPSQHFWQSLRADELNTLPG
FT                   FAATFAPHGRIPAVDERFTQPALAKSIERIARFGAREFYEGELAERIARGLQQAGSPLT
FT                   SSDLARTRARDEAPLRVAYRGGELVSLRPPTQGVTTLQIMGTLDRFDIGAIREGSADYY
FT                   HLLVEAVKCAFVDRDRFVSDPEFNIVPVEQMLSPATLDAHARSIDPHRARAWPHVFHPG
FT                   DTVFIGATDSQGRSVSVLQTVYFDWGSGVVAGDTGILWHNRGASFSTHPAHHNAVQPGK
FT                   RPFHTLNPGMYLKDGRPYLLFGTQGADGQPQTLAAILTRLIDYGMDPLTALARPRFLLG
FT                   KTFSDTRDALKLEEDAGADVFAALAARGHEVSVIPTQSPLAGHPGVIRIDADGAVSGAH
FT                   DPRSDGRALTV"
FT                   /product="gamma-glutamyltransferase"
FT                   /protein_id="YP_003609122.1"
FT   misc_feature    complement(139047..140606)
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:174918"
FT                   /locus_tag="BC1002_5707"
FT   misc_feature    complement(139056..140549)
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="BC1002_5707"
FT   gene            140775..141491
FT                   /db_xref="GeneID:9091086"
FT                   /locus_tag="BC1002_5708"
FT   CDS_pept        140775..141491
FT                   /locus_tag="BC1002_5708"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1430"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1430 hypothetical protein"
FT                   /db_xref="GI:295680549"
FT                   /db_xref="GeneID:9091086"
FT                   /translation="MPQRSGVYRPQRVNIVNARVSPPPGGLSLDRNGLELRQHASVLSD
FT                   FTDPAAIERIYYPESEALLRGWTGAKRAVIFDHTIRDGHAARPGTVREPVKFIHNDQTF
FT                   VSGPRRVRDHLPPHEAEKLLKGRVVNLWRPIGSTVESSPLALCDARSIAPTDLVPSDLI
FT                   YQDKVGETYAFVFNPKHRWYYFPLMKAEEVLLLKIYDSAGDGVARLTAHMAFDDPSSPP
FT                   DARPRRSIELRTLLFF"
FT                   /protein_id="YP_003609123.1"
FT   gene            complement(141477..141644)
FT                   /db_xref="GeneID:9091087"
FT                   /locus_tag="BC1002_5709"
FT                   /pseudo
FT   gene            complement(141789..143225)
FT                   /db_xref="GeneID:9091088"
FT                   /locus_tag="BC1002_5710"
FT   CDS_pept        complement(141789..143225)
FT                   /locus_tag="BC1002_5710"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_6340"
FT                   /codon_start="1"
FT                   /product="flavin-dependent oxidoreductase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcm:Bcenmc03_6340 flavin-dependent
FT                   oxidoreductase-like protein"
FT                   /db_xref="GI:295680550"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091088"
FT                   /translation="MTKPIRFNAFEMNCVGHQSPGLWAHPRDRSWQYKDLEYWTDLAKV
FT                   LEKGIFDGIFVADVIGYYDVYKGNNYHALHQAAQIPVNDPLQLAAPIAMVTEHLGIGIT
FT                   ASTSFEHPYTFARRLSTADHLTKGRLAWNIVTSYLESGAKNISEGGLRDHGNRYEVATE
FT                   YVEVLYKLLEGSWEDGAVVRDREKRVFTHPEKVHEIGHKGKYFEVPGYHLCEPSPQRTP
FT                   VLFQAGASGPGKAFAAQHAECVFVAAPTQAVLKNYVSDVRRQAAEAGRDPAKLLIYNLV
FT                   TVIVDETDAKAQAKFEEYKRYVSYDGSLVFMSGWTGIDFGQYAPTDLVRRVETNAIVSA
FT                   VEHLSGGDKAWTIEELAIWGGVGGMGPVFVGSPSTVADILQQWVKATGVDGFNLAYAIA
FT                   HETFEDVVHYLVPELQRRGVYPTAYTPGTLREKLFGDGARLPQTHPATRFRDIERIKRE
FT                   SQQAQHVTVTPADAEPAAVR"
FT                   /protein_id="YP_003609124.1"
FT   misc_feature    complement(141966..143213)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5710"
FT   misc_feature    complement(141930..143207)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5710"
FT   misc_feature    complement(order(142530..142535,142755..142757,
FT                   142821..142823,142980..142982,143184..143186,
FT                   143196..143198))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5710"
FT   misc_feature    complement(142911..142916)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5710"
FT   gene            complement(143231..144472)
FT                   /db_xref="GeneID:9091089"
FT                   /locus_tag="BC1002_5711"
FT   CDS_pept        complement(143231..144472)
FT                   /locus_tag="BC1002_5711"
FT                   /gene_family="HOG000219185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bvi:Bcep1808_5391 acyl-CoA dehydrogenase type 2"
FT                   /db_xref="GI:295680551"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091089"
FT                   /translation="MTSSHAADLSVGTDYESLANRFRPIFARIAEGAAQRDRSRELPHE
FT                   AIGWLKDAGFGAVRIPVAHGGAGASLPQLFRLLIELAAADSNLPQALRAHFAFVEDWLN
FT                   VPPGTDRNTWFDRFVSGQLVGSAWSEVGDVAVGTLSTRVSRRDGQYVLNGSKYYSTGSI
FT                   FAEWIDVLAKREEDGADVIAAVSTNQPGVLRKDDWDGFGQTTTGSGTTVFINASVDAHN
FT                   IIAFERRFRYQTAFYQLVHVATLAGIGAAITRDVGTLVRQRKRIYSHGNAPHVSEDAQI
FT                   QQVAGEIASWAYAAQALTVQAAQPLQRAYEARFSDDTEAEHRANVDAEIESAQSQLVVS
FT                   ELVLRAATHLFDALGASATSTTQALDRHWRNARTVSSHNPLVYKARIVGDWVINGKEPP
FT                   FIWSIGNGPGQGSK"
FT                   /protein_id="YP_003609125.1"
FT   misc_feature    complement(143273..144421)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BC1002_5711"
FT   misc_feature    complement(143279..144412)
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5711"
FT   misc_feature    complement(order(143993..143995,143999..144001))
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5711"
FT   gene            144750..146249
FT                   /db_xref="GeneID:9091090"
FT                   /locus_tag="BC1002_5712"
FT   CDS_pept        144750..146249
FT                   /locus_tag="BC1002_5712"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:BCAS0440 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:295680552"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9091090"
FT                   /translation="MNQPVLKAVSITKRFGATTALTHLDLDIRAGEVVALMGANGAGKS
FT                   TLVKIISGVYGADSGALTLRGEPFAPWSPQQAKGLGVATVHQSTADAVVPTLSVADNLL
FT                   LDQLCDAATAWRMTPTVRVDAARPLALRVGLEVDLSAPLHTLSLAGQQLVTLARALAGN
FT                   PSLLILDEPTASLSAPEAERLFALIERLRADGAAILLVSHRLGDLRRIADRVTVMRDGR
FT                   IVANLRPPIDFDAAIETMIGHALPADRAAPHDSGTSSNVVFSARDLKLTPASIPFDLDV
FT                   EEGKIVAIAGPIGGGKSRLARVIFGETRAVQGDMQLLGKPWRPRSPADAIRAGVYLAGE
FT                   DRWRSSLFPDSVPFASIAGTLSFPFLSRWHKGGFVRRETERAAAGEAIAAFGVRCTGPD
FT                   DRLSRMSGGNQQKVVLARWHAEPSKLLLLDEPFQGVDAGARADIVALLRKRAAGRATLV
FT                   FVSDLEEAFEIADRVVHFDRGTTLERAAPADSLSFVALPHS"
FT                   /protein_id="YP_003609126.1"
FT   misc_feature    144750..146189
FT                   /note="ABC-type sugar transport system, ATPase component
FT                   [Carbohydrate transport and metabolism]; Region: MglA;
FT                   COG1129"
FT                   /db_xref="CDD:31325"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    144765..145427
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    144861..144884
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    order(144870..144875,144879..144887,145008..145010,
FT                   145257..145262,145356..145358)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    144999..145010
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    order(145038..145052,145200..145214)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    145245..145262
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    145269..145280
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    145344..145364
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5712"
FT   misc_feature    145530..146186
FT                   /note="This family represents domain II of the carbohydrate
FT                   uptake proteins that transport only monosaccharides
FT                   (Monos).  The Carb_Monos family is involved in the uptake
FT                   of monosaccharides, such as pentoses (such as xylose,
FT                   arabinose, and ribose) and hexoses (; Region:
FT                   ABC_Carb_Monos_II; cd03215"
FT                   /db_xref="CDD:72974"
FT                   /locus_tag="BC1002_5712"
FT   gene            146246..147304
FT                   /db_xref="GeneID:9091091"
FT                   /locus_tag="BC1002_5713"
FT   CDS_pept        146246..147304
FT                   /locus_tag="BC1002_5713"
FT                   /gene_family="HOG000212232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_6575 inner-membrane translocator"
FT                   /db_xref="GI:295680553"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9091091"
FT                   /translation="MKSTTPSVTTTNVPAESTARPRSGSLRVHLERTGILLLLAVLIVV
FT                   FAVREPAFLNVDNLLSILQAVSIVALLGIGVTITLAAGGFDLSVGSVAATAQMVASYVL
FT                   IVWHGGAWSAVLACLAFGVVAGLFNGVLITRLRVPDQLATLGTLFLLAGLQLIPTGGRS
FT                   LATGTVLPDGTEATGSFPDLFLALGRSRLLDIVPLPVLLLAALTAVACFVMEATRWGRV
FT                   IYAIGGNETAARLAGAPTARYRIAAYVASSTIAALGGVLIAARVGRGDVSAGHSLLLDA
FT                   VAAALVGYAVWGAKRPNVPGTVVGAVFVGVLLNGLTMLNAPYYMQDFIKGVLLVFALAF
FT                   TFSVGSRSGARL"
FT                   /protein_id="YP_003609127.1"
FT   misc_feature    146441..147268
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5713"
FT   misc_feature    146936..146992
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5713"
FT   gene            147415..148650
FT                   /db_xref="GeneID:9091092"
FT                   /locus_tag="BC1002_5714"
FT   CDS_pept        147415..148650
FT                   /locus_tag="BC1002_5714"
FT                   /gene_family="HOG000219184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: bvi:Bcep1808_5390
FT                   acyl-CoA dehydrogenase type 2"
FT                   /db_xref="GI:295680554"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091092"
FT                   /translation="MAETDVADQQQTDAQARAVRVIADDAQAIAIAHELARRIAAGASE
FT                   RDRERRLPREEIEWFSQSGLWGITVPKAYGGAGVSFVTLTEVIKIVSAADPSLGQLPQN
FT                   HFGLVDVIVLTGTEEQKRYFFAEILAGKRFGNGFSEKGTKNVLDLRTTVRRDGDDYVID
FT                   GTKFYSTGALFAHYVPVLGLDEERKAWLAYIPKGTAGLEVVDDWSGFGQRTTASGTVTL
FT                   EDVRVRASHVLPAQRVSDEPTLNGPVSQIIQAAIDAGIAKAAIADTLEFVRTRARPWVD
FT                   SGVDKAGDDPLTLREIGRLHIQLHAAEALLERAARVLDEFLAKGATTEDDVARASVAVG
FT                   EAKVVTTEIALLAGEKLFELAGTQSTLSEHNFDRHWRNARTHTLHDPVRWKYHLVGNYY
FT                   LNGVKPARHAWN"
FT                   /protein_id="YP_003609128.1"
FT   misc_feature    147511..148629
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5714"
FT   misc_feature    order(147916..147918,147922..147924)
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5714"
FT   gene            148689..149759
FT                   /db_xref="GeneID:9091093"
FT                   /locus_tag="BC1002_5715"
FT   CDS_pept        148689..149759
FT                   /locus_tag="BC1002_5715"
FT                   /gene_family="HOG000268714" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bcm:Bcenmc03_6181
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="GI:295680555"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:9091093"
FT                   /translation="MKSLFHSRSIWVRALGALTLCSAAVLSAASAHSEPLKGAPAPFDK
FT                   GGVRIALVNYLSTGDFFQAYEAGAQKQARALGVDLRIYEGRQDASEQREQIQQAISLGV
FT                   SAIIVNHGLPESLKDVVQRALDKGIKVVAFDVDLANPKVPQIEQSDHDLASLLLDQAVK
FT                   DNGDAFAAGYVYVAGFAPLDRRDAVWRDFKRAHPNVQEKARWGTVDNPIAQSVANQASA
FT                   AYRAHPEIRVVFAPYDEFARGAKLAADEARLSSKLRIYSADISTADIEAIRAPGSAWVA
FT                   TAATNPAVVGAVSVRAAALLVAGQDPGHHIVVKPTLITRDDLLKNDIKTIADLGEKFPA
FT                   FRSSDAATAAWIPAAQ"
FT                   /protein_id="YP_003609129.1"
FT   sig_peptide     148689..148790
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 34"
FT                   /locus_tag="BC1002_5715"
FT   misc_feature    148833..149645
FT                   /note="Methylthioribose-binding protein-like of ABC-type
FT                   transport systems that belong to a family of pentose/hexose
FT                   sugar-binding proteins of the type I periplasmic binding
FT                   protein (PBP1) superfamily; Region:
FT                   PBP1_methylthioribose_binding_like; cd06305"
FT                   /db_xref="CDD:107300"
FT                   /locus_tag="BC1002_5715"
FT   misc_feature    order(148869..148871,149091..149093,149241..149243,
FT                   149475..149477,149541..149543)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107300"
FT                   /locus_tag="BC1002_5715"
FT   gene            150891..151133
FT                   /db_xref="GeneID:9091094"
FT                   /locus_tag="BC1002_5716"
FT   CDS_pept        150891..151133
FT                   /locus_tag="BC1002_5716"
FT                   /gene_family="HOG000260299" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /codon_start="1"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_5139 putative addiction module
FT                   antidote protein, CopG/Arc/MetJ family; TIGRFAM: addiction
FT                   module antidote protein, CC2985 family; PFAM: protein of
FT                   unknown function UPF0156"
FT                   /db_xref="GI:295680556"
FT                   /db_xref="InterPro:IPR005360"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="GeneID:9091094"
FT                   /translation="MSKNTSVSLGDHFAEFVEDRVRAGRYSTASDVVRAGLRLLEEQEA
FT                   KLDVLRVELEKGERSGQSRPFDFDAFLARKRKSAT"
FT                   /protein_id="YP_003609130.1"
FT   misc_feature    150891..151130
FT                   /note="Uncharacterized protein family (UPF0156); Region:
FT                   RHH_2; cl01448"
FT                   /db_xref="CDD:163980"
FT                   /locus_tag="BC1002_5716"
FT   gene            151130..151429
FT                   /db_xref="GeneID:9091095"
FT                   /locus_tag="BC1002_5717"
FT   CDS_pept        151130..151429
FT                   /locus_tag="BC1002_5717"
FT                   /gene_family="HOG000138821" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /codon_start="1"
FT                   /product="plasmid stabilization system"
FT                   /transl_table="11"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   pla:Plav_0711 plasmid stabilization system protein"
FT                   /db_xref="GI:295680557"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="GeneID:9091095"
FT                   /translation="MKAFVFSPAAEEDLDSIWDYAVENWGQRQAERYIRMIQDTVIGLT
FT                   DGTQPSQSAQHVRSGYRKVLVGTHVIFFKEDEHLIDLIRILHQRMDPSYHLNEH"
FT                   /protein_id="YP_003609131.1"
FT   misc_feature    151130..151417
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="BC1002_5717"
FT   gene            complement(151671..152174)
FT                   /db_xref="GeneID:9091096"
FT                   /locus_tag="BC1002_5718"
FT                   /pseudo
FT   gene            complement(152512..152910)
FT                   /db_xref="GeneID:9091097"
FT                   /locus_tag="BC1002_5719"
FT   CDS_pept        complement(152512..152910)
FT                   /locus_tag="BC1002_5719"
FT                   /gene_family="HOG000262838" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1530"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1530 hypothetical protein"
FT                   /db_xref="GI:295680558"
FT                   /db_xref="GeneID:9091097"
FT                   /translation="MKSKLLAQLMIAALIGVSIPAFAQPHDNQRHSDWSVHGPKRHDMR
FT                   PPPAHGHGPMPHEAYRGRPGGPMPHADWRQGDRLPAEYRNHNYVVDDWRGHGLRPPPHG
FT                   YHWVGVNGDYVLAAIATGIIADVLFSSH"
FT                   /protein_id="YP_003609132.1"
FT   sig_peptide     complement(152839..152910)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT                   /locus_tag="BC1002_5719"
FT   misc_feature    complement(152530..152685)
FT                   /note="Domain of unknown function (DUF3315); Region:
FT                   DUF3315; cl02275"
FT                   /db_xref="CDD:154832"
FT                   /locus_tag="BC1002_5719"
FT   gene            complement(153066..153407)
FT                   /db_xref="GeneID:9091098"
FT                   /locus_tag="BC1002_5720"
FT   CDS_pept        complement(153066..153407)
FT                   /locus_tag="BC1002_5720"
FT                   /gene_family="HOG000114317" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1677"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1677 hypothetical protein"
FT                   /db_xref="GI:295680559"
FT                   /db_xref="GeneID:9091098"
FT                   /translation="MKPLVKLAAFVAAIAFAAPITVFAAANVAANHPLTRAEVRQQLVE
FT                   IEAAGYNPARANPREYPADIQAAEAKVAAQHGDTSGVGGVISGSSAAGSHAYTSEAART
FT                   GPGSVYFGQ"
FT                   /protein_id="YP_003609133.1"
FT   sig_peptide     complement(153333..153407)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 25"
FT                   /locus_tag="BC1002_5720"
FT   gene            complement(153657..154112)
FT                   /db_xref="GeneID:9091099"
FT                   /locus_tag="BC1002_5721"
FT                   /pseudo
FT   gene            154119..154400
FT                   /db_xref="GeneID:9091100"
FT                   /locus_tag="BC1002_5722"
FT                   /pseudo
FT   gene            154815..155176
FT                   /db_xref="GeneID:9091101"
FT                   /locus_tag="BC1002_5723"
FT                   /pseudo
FT   gene            155320..155682
FT                   /db_xref="GeneID:9091102"
FT                   /locus_tag="BC1002_5724"
FT                   /pseudo
FT   gene            complement(155776..156027)
FT                   /db_xref="GeneID:9091103"
FT                   /locus_tag="BC1002_5725"
FT                   /pseudo
FT   gene            complement(156074..157105)
FT                   /db_xref="GeneID:9091104"
FT                   /locus_tag="BC1002_5726"
FT   CDS_pept        complement(156074..157105)
FT                   /locus_tag="BC1002_5726"
FT                   /gene_family="HOG000162428" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0118"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   lpc:LPC_1516 transporter, permease"
FT                   /db_xref="GI:295680560"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="GeneID:9091104"
FT                   /translation="MNQGLLKCTCAAILATLLGWGLYVGRPVLVPIAFGIIATYVVFGL
FT                   ANLLRSFPYVGARLREGPRHAIAATLMLFTVYLSVSLLLSDRDRLMAVAPKYEATLLVL
FT                   LTKFAALLHIETEANWTAIRRDLLASVNVQAIMTSTLSSVSSLFAAIIVVLLYATFFLI
FT                   EHAKYRRKLVKFAGGSTRIVSVIDEINSKIGVYLAMKTLLGAILGIASWICMWLVGLEF
FT                   AELWAVLIGLLNFIPYAGSWISVAVPTLLAALQFGQWNAAIVLFISLTLANFVVGHLLD
FT                   PWLMGGSLNLSPAMILISLAVWSSIWGIAGAFLAVPITVGLVIALTAFESTRRFAVLLT
FT                   NDD"
FT                   /protein_id="YP_003609134.1"
FT   misc_feature    complement(156119..>156694)
FT                   /note="Domain of unknown function DUF20; Region: UPF0118;
FT                   cl00465"
FT                   /db_xref="CDD:174221"
FT                   /locus_tag="BC1002_5726"
FT   gene            complement(157153..157824)
FT                   /db_xref="GeneID:9091105"
FT                   /locus_tag="BC1002_5727"
FT   CDS_pept        complement(157153..157824)
FT                   /locus_tag="BC1002_5727"
FT                   /gene_family="HOG000105368" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B4005"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4005 hypothetical protein"
FT                   /db_xref="GI:295680561"
FT                   /db_xref="GeneID:9091105"
FT                   /translation="MAMFIQFVSQLEQDLETLLAQHGPLAYAIIGAIVFGSVGVLPLVI
FT                   LPADMLLFMSGALAAVGVLHPLWLAPLLVAAAVGGTVFNYALARAVASVWKPKRSGWIN
FT                   KVSARTRALYARHGAALLLYSPFIAIVRAVAPALAGAMKMPFRRFVRFTTGGAVIWICS
FT                   LAGPGYFFGNVPWVRSHLPAAMAIVIGAGVVALVVSLLWRGRRKRRVVDSMLPDEKSRC
FT                   D"
FT                   /protein_id="YP_003609135.1"
FT   misc_feature    complement(157282..157812)
FT                   /note="SNARE associated Golgi protein; Region: SNARE_assoc;
FT                   cl00429"
FT                   /db_xref="CDD:174199"
FT                   /locus_tag="BC1002_5727"
FT   gene            complement(158155..158343)
FT                   /db_xref="GeneID:9091106"
FT                   /locus_tag="BC1002_5728"
FT   CDS_pept        complement(158155..158343)
FT                   /locus_tag="BC1002_5728"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6857 transposase IS66"
FT                   /db_xref="GI:295680562"
FT                   /db_xref="GeneID:9091106"
FT                   /translation="MAQQGRDHARFVVKGIEVRGFGTLRKMKEAAALTRYCDEGQLEID
FT                   SLPVEGAQREFPLAPEN"
FT                   /protein_id="YP_003609136.1"
FT   gene            158622..159182
FT                   /db_xref="GeneID:9091107"
FT                   /locus_tag="BC1002_5729"
FT   CDS_pept        158622..159182
FT                   /locus_tag="BC1002_5729"
FT                   /gene_family="HOG000263463" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bpy:Bphyt_1446 transcriptional regulator, XRE family"
FT                   /db_xref="GI:295680563"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:9091107"
FT                   /translation="MKRDDRKSNARLVMGSKIRALHERLAYLGRNCNGGRNLEAVPFSG
FT                   RGRTGDAVHSVISRYCASAWRNNAVLRRSANRSEVRAPRKRKAVLQLCRLDESVCSPQQ
FT                   CSARQATRRDSHPNACWSAAVGTTTHAGEEFLHVLSNQVSLNLEGRTFVLDPGDSAHFE
FT                   STAPHGSQSRPSALNAAVVDTRS"
FT                   /protein_id="YP_003609137.1"
FT   misc_feature    159006..>159128
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_5729"
FT   gene            complement(159179..160072)
FT                   /db_xref="GeneID:9091108"
FT                   /locus_tag="BC1002_5730"
FT   CDS_pept        complement(159179..160072)
FT                   /locus_tag="BC1002_5730"
FT                   /gene_family="HOG000218590" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /codon_start="1"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mag:amb3335 ferric reductase; manually
FT                   curated; PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="GI:295680564"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="GeneID:9091108"
FT                   /translation="MIVLALIRQFPYRWFAKTHNWLAVLYLPLAFHTVVLLRFGYWRAP
FT                   VGVVVVVLLAAGIVSVVRVLGGHVGRQCKVEGRIASLTWYPELRVLQTAIDLRPGWPGH
FT                   ASGQFAFVTSDRSEGAHPYTIASAWNPRVPRVVFLTKELGDHTSRLKDRLREGMPVTVE
FT                   GPYGCFTFADQRAHQIWIGAGIGITPFVARMKELAQHRDRRHRIDLFHSTADFSQKAID
FT                   QLVADAKAAEVQLHLLVDAKHGRLNGERVRTAIPDWASASVWFCGPPAFGEAVRDDLVA
FT                   HGLDSADFHQELFQLR"
FT                   /protein_id="YP_003609138.1"
FT   misc_feature    complement(159191..159796)
FT                   /note="NAD(P) binding domain of  ferredoxin reductase-like
FT                   proteins catalyze electron transfer between an
FT                   NAD(P)-binding sub-domain of the alpha/beta class and a
FT                   discrete (usually N-terminal) domain, which varies in
FT                   orientation with respect to the NAD(P)...; Region:
FT                   FNR_like_3; cd06198"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   misc_feature    complement(order(159518..159520,159632..159637,
FT                   159641..159646,159650..159652,159656..159658,
FT                   159701..159712,159746..159748))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   misc_feature    complement(order(159701..159706,159710..159712))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   misc_feature    complement(order(159572..159574,159578..159580,
FT                   159602..159604,159623..159625,159632..159634,
FT                   159641..159643))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   misc_feature    complement(order(159506..159508,159512..159523,
FT                   159533..159535))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   misc_feature    complement(order(159269..159274,159431..159439,
FT                   159515..159520))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99795"
FT                   /locus_tag="BC1002_5730"
FT   gene            160928..161995
FT                   /db_xref="GeneID:9091109"
FT                   /locus_tag="BC1002_5731"
FT   CDS_pept        160928..161995
FT                   /locus_tag="BC1002_5731"
FT                   /gene_family="HOG000219288" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06516"
FT                   /codon_start="1"
FT                   /product="purine nucleoside permease"
FT                   /transl_table="11"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   bpy:Bphyt_4530 purine nucleoside permease"
FT                   /db_xref="GI:295680565"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="GeneID:9091109"
FT                   /translation="MRKHAFGAAVSSLLLAGAAVSPAIAHTDDGFAQDDGASHGRPVKV
FT                   MIISMFGPEGQVWLDHLGPWQDITVAGLSPDYPAVHCNRQEICVMTTGMGHANAAASIM
FT                   ALTFSPRFDLRRTYFMVAGIAGIDPLQGTVGSAAWANWLVDFGIQWEVDGREIPPGWNT
FT                   GYLGINTTGPTQKPPLDYRTEVFQLNPALSNAAFALSRNVTLTDDPPAQAARAKYNYAP
FT                   ANRPPTVIQCDTLAGDTWWSGTDLGERARQWTKILTDGKGTYCTTQQEDNATFEALTRA
FT                   ASAHRVDLARVAVLRAGSDFDRPYADQSSADNLLNYASQGGFTIAINNLFLTGNPLVQD
FT                   IVTHWGEWSDGVPRR"
FT                   /protein_id="YP_003609139.1"
FT   sig_peptide     160928..161005
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5731"
FT   misc_feature    161048..161989
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="BC1002_5731"
FT   gene            162346..163359
FT                   /db_xref="GeneID:9091110"
FT                   /locus_tag="BC1002_5732"
FT   CDS_pept        162346..163359
FT                   /locus_tag="BC1002_5732"
FT                   /gene_family="HOG000114767" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bac:BamMC406_6587 integrase catalytic region"
FT                   /db_xref="GI:295680566"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="GeneID:9091110"
FT                   /translation="MPTVRKRSARVLTLAEREEISRGIYAGVSIREIAASLGRSPSTIS
FT                   REIARHRGLSRYRATSADARAWELAKRPKPCRLAVNDKLCRLVARKLQLKWAPQQIAGW
FT                   LKLQYPDDETMQVSHETIYRSLFIQARGVLKAELMKHLRTRRMMRRSKKASAKGQPRGQ
FT                   IIDAVSIRERPAEAEDRAIPGHWEGDLLSGSNNTHIATLVERHSRFTILVKVKGKDTDS
FT                   VVSALSKQVRKLPAELRKSVTWDRGMELAQHKEFTIATDVQVYFCDPQSPWQRGTNENT
FT                   NGLLRQYFPKGTTLASYSQGDLNKIALQLNQRPRKTLGFMTPADKLNASIGVAFTG"
FT                   /protein_id="YP_003609140.1"
FT   misc_feature    162358..163320
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="BC1002_5732"
FT   misc_feature    162877..163212
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="BC1002_5732"
FT   gene            complement(163369..163635)
FT                   /db_xref="GeneID:9091111"
FT                   /locus_tag="BC1002_5733"
FT                   /pseudo
FT   gene            complement(163699..164111)
FT                   /db_xref="GeneID:9091112"
FT                   /locus_tag="BC1002_5734"
FT                   /pseudo
FT   gene            complement(164118..164909)
FT                   /db_xref="GeneID:9091113"
FT                   /locus_tag="BC1002_5735"
FT                   /pseudo
FT   gene            165079..165321
FT                   /db_xref="GeneID:9091114"
FT                   /locus_tag="BC1002_5736"
FT   CDS_pept        165079..165321
FT                   /locus_tag="BC1002_5736"
FT                   /gene_family="HOG000268912" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6101"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_6101 hypothetical protein"
FT                   /db_xref="GI:295680567"
FT                   /db_xref="GeneID:9091114"
FT                   /translation="MQTDKVMEYHGYEIRPMVTPTETGRYAAAAIVTDRAGDTRTLGVD
FT                   VDFANAQEGRDEALELAIAWIQQRSVVSDRYVRRI"
FT                   /protein_id="YP_003609141.1"
FT   gene            165429..166004
FT                   /db_xref="GeneID:9091115"
FT                   /locus_tag="BC1002_5737"
FT   CDS_pept        165429..166004
FT                   /locus_tag="BC1002_5737"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ATP-dependent RNA helicase, putative; K10901
FT                   bloom syndrome protein"
FT                   /db_xref="GI:295680568"
FT                   /db_xref="GeneID:9091115"
FT                   /translation="MTDTAVIDPAEDALYERIRILLFSADLPAQRLESDIDDIGRFTAP
FT                   DVRSSQLRLIEVMPPLAPAAEAIVRAMIRAYGTELFGRGSANSALRAMIKAGPVRFGQT
FT                   ALTLGPDAPLPERVRPLVAEINRIFERYPESGFSHARYFLSAIGLPVGRDRLPQVHRSV
FT                   QRGRNLEGSPDSRVALNNPELRVFRSSI"
FT                   /protein_id="YP_003609142.1"
FT   gene            complement(165993..166160)
FT                   /db_xref="GeneID:9091116"
FT                   /locus_tag="BC1002_5738"
FT   CDS_pept        complement(165993..166160)
FT                   /locus_tag="BC1002_5738"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bgl:bglu_1g18480 hypothetical protein"
FT                   /db_xref="GI:295680569"
FT                   /db_xref="GeneID:9091116"
FT                   /translation="MRATIAQLIGTDLSRILPGTLRTDALGMVVWGQPGQLSLALYRGW
FT                   HLPSADTLDT"
FT                   /protein_id="YP_003609143.1"
FT   gene            166278..167198
FT                   /db_xref="GeneID:9091117"
FT                   /locus_tag="BC1002_5739"
FT   CDS_pept        166278..167198
FT                   /locus_tag="BC1002_5739"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A2079 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680570"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091117"
FT                   /translation="MELKQIQYFIALFEEGTVTRAARRLNIAQPALSMQIAKLETEIRQ
FT                   KLFERGPHGMAPTEAARLMYRLYTPIMRDIDHAREHLSRRDVIVTGRVSLGMVSSEAQS
FT                   VLPESLARFDALFPQVEVSVADGFSAQLIDAVESGRLDAAIINKPRGRLTLHVEPLLVE
FT                   EMVLVTSVEHGPKLPDEIDLTQQSDIEFVLPTRRNGLRGALDAALMAADVVIKPKFEID
FT                   LLSTIVQFVEQSGVATILPRVVVQAKVDEGRLRARTIASPQIVRHIIQVTHPKRPIGPA
FT                   AQALITIITEEIKRVTTGVLGKQAP"
FT                   /protein_id="YP_003609144.1"
FT   misc_feature    166278..167165
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5739"
FT   misc_feature    166284..166463
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5739"
FT   misc_feature    166551..167144
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5739"
FT   misc_feature    order(166596..166601,166605..166610,166617..166619,
FT                   166629..166631,166635..166655,166929..166946,
FT                   166962..166967,166971..166976)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5739"
FT   gene            complement(167195..167896)
FT                   /db_xref="GeneID:9091118"
FT                   /locus_tag="BC1002_5740"
FT   CDS_pept        complement(167195..167896)
FT                   /locus_tag="BC1002_5740"
FT                   /gene_family="HOG000230065" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dshi_3702"
FT                   /codon_start="1"
FT                   /product="fatty acid hydroxylase"
FT                   /transl_table="11"
FT                   /note="KEGG: dsh:Dshi_3702 fatty acid hydroxylase"
FT                   /db_xref="GI:295680571"
FT                   /db_xref="GeneID:9091118"
FT                   /translation="MKYEEDVRARSYKFRDEYVNATPWWYRGEMHLGFTLLFTGGVIVY
FT                   CLMQLHAPTLAEWLAVIPLFLFGNWAEWAAHRYVLHRPTKYFSMIYKRHCAVHHRFFTH
FT                   VTLEYKGHRHWRALLFPPFAPVAFVLAAVPFALVIGFVFSRNAGYIALLTMAAYFLMYE
FT                   GLHTLSHVTDSPLLDRVPFVNTVRRLHATHHDPEVMATQNFNLTFPICDTLFGTRSDVP
FT                   SRAREPLERGR"
FT                   /protein_id="YP_003609145.1"
FT   gene            complement(167959..169335)
FT                   /db_xref="GeneID:9091119"
FT                   /locus_tag="BC1002_5741"
FT   CDS_pept        complement(167959..169335)
FT                   /locus_tag="BC1002_5741"
FT                   /gene_family="HOG000042674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_2179 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:295680572"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091119"
FT                   /translation="MAVAAHDGATVLPVNQRQVMGAVMASCFGWALDLFDLFVLLYVAP
FT                   VVGRLFFPSEHAMLSLAAVYASFAVTLLMRPLGSALFGSYADRHGRKGAMIVAVVGVGL
FT                   STAAFGALPTVAQVGLVAPVLFLLLRLVQGVFVGGVVASTHTIGTESVAPKYRGAVSGL
FT                   IGGGGAGLGALLASLTYLAMSAIFPGDAFDAWGWRCMFFTGILSSVLGLFVFNGLEESP
FT                   LWKKLAAEKAAKAAEQKKIVNADKARSPIRTLFSREYRGVLFVNLLLTIGGGSGYYLTS
FT                   GYLPTFLKVVSHAPNGAAAAILMICSVAVVIASVAAGHVSTFIGRKGAFIWIGIIRLIA
FT                   MPALFLLLPTAQSITMVGVYAVLLSALGSAGYAPVLIFLNERFPTAIRATGTGLSWNIG
FT                   FAIGGMMPTFVSLVAKDAGQLPSTLAIFVGAISVIFLVGAFVVPETLGKLEGGSARSRS
FT                   "
FT                   /protein_id="YP_003609146.1"
FT   misc_feature    complement(168028..169191)
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="BC1002_5741"
FT   gene            complement(169403..171124)
FT                   /db_xref="GeneID:9091120"
FT                   /locus_tag="BC1002_5742"
FT   CDS_pept        complement(169403..171124)
FT                   /locus_tag="BC1002_5742"
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /codon_start="1"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bpy:Bphyt_2180
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="GI:295680573"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="GeneID:9091120"
FT                   /translation="MNRFDYVIVGGGSAGCVLAHRLSAAPSVRVALIEAGADTPPGAVP
FT                   AAILDSYPMPVFCGDAYIWPDLKAKATQHAAPRVYEQGRVMGGGSSINVQSANRGLPRD
FT                   YDEWAANGAEGWSWRDVLPYFRKLERDVNFPGGELHGSDGPVPIRRIMPKDWPAFCHAF
FT                   AKGLRANGFAELQDQNGEFGDGFFPGAFSNIDDKRVSTAIAYLDEATRKRTNLSIYSNL
FT                   RVERIVMAGATARGVVAIAANGERVHFDAGEVVLSAGALQSPAMLMRAGIGDARQLVAM
FT                   GIPCVADVPGVGRNLQDHPSLTFCHFLEPRFRMPLARRRASMMAARMSSGVAGCDESDL
FT                   YLSSATRAAWHALGNRLGLFFLWCNRPYSRGRVQLASPDAAVAPRVDLNLLDDERDLQR
FT                   LAAGVRMLARVVDASGLGRDSRDFFPAAFSPRVKALSKVGEGNALLTSILGVLLDTPAP
FT                   LRRLLIERFFTRGLQMTSLIHDERALADFIRANVFGVWHASGTCRMGSAQDLDAVTDTE
FT                   GRVRGTRGLRVVDASLMPRLPSANTNIPTIMIAEKIADAMVAQRRASVASPFASAH"
FT                   /protein_id="YP_003609147.1"
FT   misc_feature    complement(169442..171112)
FT                   /note="choline dehydrogenase; Region: betA; TIGR01810"
FT                   /db_xref="CDD:162541"
FT                   /locus_tag="BC1002_5742"
FT   misc_feature    complement(<170996..171112)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5742"
FT   misc_feature    complement(170225..170881)
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_N; pfam00732"
FT                   /db_xref="CDD:109776"
FT                   /locus_tag="BC1002_5742"
FT   misc_feature    complement(169466..170026)
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
FT                   /db_xref="CDD:147408"
FT                   /locus_tag="BC1002_5742"
FT   gene            complement(171170..171976)
FT                   /db_xref="GeneID:9091121"
FT                   /locus_tag="BC1002_5743"
FT   CDS_pept        complement(171170..171976)
FT                   /locus_tag="BC1002_5743"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bpy:Bphyt_2181 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:295680574"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:9091121"
FT                   /translation="MSDLTHRGQTLLQDLDGFSVEIDAQRERADIILHRPPFNVISMHA
FT                   RDQLRAVFEALDEDDRVRVIVVRAKGEHFSSGGDIKGFLEASPEHVSKLAWNIAAPARC
FT                   SKPVIAANRGFCFGVGFELSLACDFRIVTDTTFYALPEQKLGQIPGSGGSARLQSMVGI
FT                   GRTKDIVMRSRRIPGEQAYEWGIAVEFVADAELEAATDALVDELRAFSPLAQRTAKKLL
FT                   NDSEDAPLSIAIELEGHCYSRLRSSDDFREGVEAFHGKRKPVFRGS"
FT                   /protein_id="YP_003609148.1"
FT   misc_feature    complement(171176..171925)
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK06142"
FT                   /db_xref="CDD:168419"
FT                   /locus_tag="BC1002_5743"
FT   misc_feature    complement(171410..171886)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5743"
FT   misc_feature    complement(order(171542..171544,171551..171556,
FT                   171620..171628,171632..171634,171737..171751,
FT                   171761..171763,171857..171859,171863..171865))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5743"
FT   misc_feature    complement(order(171620..171622,171743..171745))
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5743"
FT   misc_feature    complement(order(171413..171415,171422..171424,
FT                   171455..171457,171464..171469,171473..171478,
FT                   171482..171487,171500..171505,171509..171517,
FT                   171521..171523,171539..171550,171584..171595,
FT                   171656..171658,171680..171682))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5743"
FT   gene            complement(171983..173557)
FT                   /db_xref="GeneID:9091122"
FT                   /locus_tag="BC1002_5744"
FT   CDS_pept        complement(171983..173557)
FT                   /locus_tag="BC1002_5744"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bpy:Bphyt_2182 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:295680575"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="GeneID:9091122"
FT                   /translation="MLDLGRTFLQSVERSPNALALVDGDVQLTYAQWHRMILNVADGLR
FT                   ELGLEHGDRLLVVLQNRWEMATLHWAGQFAGIVIVPLNWRAKPEEVDYCVTDAGVKAIV
FT                   YEPVSADSVAQSAAAQKVPRVGLDDAPGRTTAFDALIVERTRSADVTDTTHATADDISL
FT                   ILYTSGTTGKGKGVPRRHRHERAGALAHVAQNLYRRGERTLGVMPLYHTMGVRSLLAMA
FT                   LVDGLFVCVRRWNAKLALECISKHALTCLYLVPTLYHDLLADSAFASTDTSSVRKLGFA
FT                   GAPMNDGLLKRLSAAFEPELFVNHYGSSEVYTFSIDQDATKKPGSAGRAGINTRLRVVK
FT                   LDALSPDAIAEAGEEGQIIVDLLGDEAFEGYWNRPDANAKCLREGWYFTGDTGYLDRDG
FT                   DLYVTGRVDDMIISGGENISPVDIESVLSLHPAVDEVAVAGVKDERWGQRVVAFIKRRE
FT                   YVDADSLDAWCRQSDLVNFKRPRDYVFVDDIPKSPVGKILRRKLQAGEYTPDSNALPAQ
FT                   PTATTKE"
FT                   /protein_id="YP_003609149.1"
FT   misc_feature    complement(172052..173557)
FT                   /note="long-chain-fatty-acid--CoA ligase; Validated;
FT                   Region: PRK06187"
FT                   /db_xref="CDD:168450"
FT                   /locus_tag="BC1002_5744"
FT   misc_feature    complement(<173249..173521)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="BC1002_5744"
FT   misc_feature    complement(172049..>172942)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="BC1002_5744"
FT   gene            complement(173550..174086)
FT                   /db_xref="GeneID:9091123"
FT                   /locus_tag="BC1002_5745"
FT   CDS_pept        complement(173550..174086)
FT                   /locus_tag="BC1002_5745"
FT                   /gene_family="HOG000166647" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /codon_start="1"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: bph:Bphy_6671 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /db_xref="GI:295680576"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="GeneID:9091123"
FT                   /translation="MSKIPDTIMRHGEARRIALTLNGRERSGYCEPRELLSDFIRHELG
FT                   ATGTHVGCEHGVCGACTVQVNGVAARSCLMLAVQADGRRIDTVEGLAPDQTLGDLQQAF
FT                   QRHHALQCGFCTAGILMSCADYLRRVPDPSEEQVREMLSGHICRCTGYTPIVAAVLDVA
FT                   ARRRAEVSAKEAEHA"
FT                   /protein_id="YP_003609150.1"
FT   misc_feature    complement(173622..174038)
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs [Energy production and
FT                   conversion]; Region: CoxS; COG2080"
FT                   /db_xref="CDD:32263"
FT                   /locus_tag="BC1002_5745"
FT   misc_feature    complement(173622..173828)
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="BC1002_5745"
FT   gene            complement(174083..174904)
FT                   /db_xref="GeneID:9091124"
FT                   /locus_tag="BC1002_5746"
FT   CDS_pept        complement(174083..174904)
FT                   /locus_tag="BC1002_5746"
FT                   /gene_family="HOG000244728" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /codon_start="1"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bpy:Bphyt_2184 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="GI:295680577"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="GeneID:9091124"
FT                   /translation="MKPAPFDYLRAMTAQDALDALAQYGEDARVLAGGQSLMAVLNMRL
FT                   AQPKVLVDISRTAELDAVRVDQQARHLVVNAAATQGSVEWRSTLTDEAPLLAMAFPHIS
FT                   HFQIRNRGTVCGSIAHADPSAELPLVLAALGGDVMLRSRKRRRTLAAQDFFQGMLMTAR
FT                   EPDELVEAVRFPLRKEGERYAFAEFSARHGDFAIVACAAVVTDESIRIAVGGVADRPVT
FT                   EQWPRLRGDDLRGALNDLSWKLNAQDDAHISAKYRRNLVRQLGWRVIEEAK"
FT                   /protein_id="YP_003609151.1"
FT   misc_feature    complement(174089..174895)
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM homologs [Energy production and
FT                   conversion]; Region: CoxM; COG1319"
FT                   /db_xref="CDD:31510"
FT                   /locus_tag="BC1002_5746"
FT   misc_feature    complement(174377..174892)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="BC1002_5746"
FT   misc_feature    complement(174089..174346)
FT                   /note="CO dehydrogenase flavoprotein C-terminal domain;
FT                   Region: CO_deh_flav_C; pfam03450"
FT                   /db_xref="CDD:146206"
FT                   /locus_tag="BC1002_5746"
FT   gene            complement(174901..177942)
FT                   /db_xref="GeneID:9091125"
FT                   /locus_tag="BC1002_5747"
FT   CDS_pept        complement(174901..177942)
FT                   /locus_tag="BC1002_5747"
FT                   /gene_family="HOG000244714" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /codon_start="1"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; carbon monoxide dehydrogenase
FT                   subunit G; KEGG: bpy:Bphyt_2185 aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="GI:295680578"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="GeneID:9091125"
FT                   /translation="MNQRETAFADMDARVAGNEVRAASAPQRHIGRSMQRLEDPAILTG
FT                   RGRYGDDIAVKPGTLHAAILRSPHAHADILSIDTQAASKLAGVRAVLTRDDLRPWSRPF
FT                   VVGVKSPMEQWALAMDRVRYVGEPVAVVMAESRALAEDALDLIKVDYAMLDPVTSIEQA
FT                   AKDDAPVLHERVGSNVISDRHFRYGEPEAAFERAPHRVKLVAHYPRNTCAPIECGVVIA
FT                   EYLSGEEGYDVTSNFMGPFSLHAVMAMALNVPANRLRHKAPRDSGGSFGVKQAVFPYVV
FT                   LMCLASRKAGAPVKWVEDRLEHLSAATSATARVSTIEAAVEADGRIVALSYDQLEDVGG
FT                   YVRAPEPATFYRMHGCLTGAYAIPNLIVRNRVVLTNKTPTGLVRGFGGPQVYFALERLI
FT                   QRIAIELKLDVLDVYRRNFVPADAFPYRAAAGALLDSGNYQEALRRSLDEGGYGELVAR
FT                   RDAARSEGRLYGIGFAAIVEPSVSNMGYITTVMPADARKKAGPKNGAIASATVSVDLLG
FT                   GVVVTIASTPAGQGHMTVCAQVVADVLGLDPKDIVVNVEFDTHKDAWSVAAGNYSSRFA
FT                   GAVAGTVHLAATRVRDKLARVLAKQFNCAPGDVRFEGARVFPHDAEDRALPFSRAASNA
FT                   PHWAPALLPEGEEPGLRETVFWSPPHMDAPDEQDRINTSAAYGFAFDMCGVEVDRATGR
FT                   VRIDRYVTVHDAGTLLNPALADGQIRGAFAQGLGAALMEEFRYGADGSFQSGTLADYLM
FT                   PTTCEVPDPLIVHLETPSPFTPLGAKGLGEGNNMSTPPCIANAVADALGVEDICLPLTP
FT                   PRVMAMIGMDDPEPSRPEYREAPAAKSATPGGGRALTAQGAVDLPATPEAVFAVLLDPK
FT                   ALANVIPGCHALEETAPNQYRADVTVGVGMIKARFEARIGLSEIDAPRRLRLAGAGISP
FT                   LGSARGSGLVELTPQGSGTRLTYDYEAQVSGKVAAVGGRMLEGAAKVVLKQLFESLGRQ
FT                   AAGKPVQAHGSWIARLLARFRRHA"
FT                   /protein_id="YP_003609152.1"
FT   misc_feature    complement(175483..177855)
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit CoxL/CutL homologs [Energy production and
FT                   conversion]; Region: CoxL; COG1529"
FT                   /db_xref="CDD:31718"
FT                   /locus_tag="BC1002_5747"
FT   misc_feature    complement(177478..177813)
FT                   /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
FT                   hammerhead domain; Region: Ald_Xan_dh_C; pfam01315"
FT                   /db_xref="CDD:144787"
FT                   /locus_tag="BC1002_5747"
FT   misc_feature    complement(175663..177396)
FT                   /note="Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
FT                   /db_xref="CDD:145733"
FT                   /locus_tag="BC1002_5747"
FT   misc_feature    complement(174970..175389)
FT                   /note="Polyketide cyclase / dehydrase and lipid transport;
FT                   Region: Polyketide_cyc2; cl10449"
FT                   /db_xref="CDD:175214"
FT                   /locus_tag="BC1002_5747"
FT   gene            complement(177947..178561)
FT                   /db_xref="GeneID:9091126"
FT                   /locus_tag="BC1002_5748"
FT   CDS_pept        complement(177947..178561)
FT                   /locus_tag="BC1002_5748"
FT                   /gene_family="HOG000225438" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /codon_start="1"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2072 putative aromatic acid
FT                   decarboxylase, flavoprotein; TIGRFAM:
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; PFAM:
FT                   flavoprotein"
FT                   /db_xref="GI:295680579"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="GeneID:9091126"
FT                   /translation="MAERKKRIVVGISGASGAVIGVRLLAALRRLGTHETHLIVSSSGA
FT                   VTAAQELGLARGDLEAAADVVHNVRDIGAAVASGSFLTEGMVIAPCSMKTLAGVANGFA
FT                   DNLLTRAADVMLKERRRLVLVARETPLNLAHLRNMTLATQMGAIVMPPVPAFYAHPQTI
FT                   DDVVDHTVGRILDLFEIEHDEIARRWSGLADEFGGRAAREE"
FT                   /protein_id="YP_003609153.1"
FT   misc_feature    complement(177989..178549)
FT                   /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   Provisional; Region: PRK06029"
FT                   /db_xref="CDD:168355"
FT                   /locus_tag="BC1002_5748"
FT   misc_feature    complement(178181..178546)
FT                   /note="Flavoprotein; Region: Flavoprotein; cl08021"
FT                   /db_xref="CDD:174911"
FT                   /locus_tag="BC1002_5748"
FT   gene            complement(178554..180047)
FT                   /db_xref="GeneID:9091127"
FT                   /locus_tag="BC1002_5749"
FT   CDS_pept        complement(178554..180047)
FT                   /locus_tag="BC1002_5749"
FT                   /gene_family="HOG000227663" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /codon_start="1"
FT                   /product="UbiD family decarboxylase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2071 carboxylyase-like protein;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="GI:295680580"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="GeneID:9091127"
FT                   /translation="MNTRDAATHGNPSFTWARDHADTGSLSLRDWLAHLAKTGRVATMD
FT                   KPVALEHELAAVAKRLDGEQAAFFTQPRGHAIPVVSGFMSKRAWIAEAMDVEESALLAR
FT                   FSAAAAAPLASKLIQREDAPCQQVVHTSGIDLHALLPIPTHSEHDNGPYITAGLVIARN
FT                   PRTGVQNVSINRIQVHGPDRMAILLLPRHLYAFQRDAEAAGDALDVAVAIGVDPLTMLA
FT                   SQAITPIDHDELEIAGALHGAPLPVARCVTNGVHVPAFAEIVIEGRILPNVREPEGPFG
FT                   EFPKYYSAKEAREVIEVTAVTHRRDPIFHTIVPAEMEHLLLGAIPREATLLAHLQRSHP
FT                   AVKDVHLSVGGVCRYHLWVQFDKQREGEAKNVILCAFGAHYDIKQVVVVDTDVNVHDPA
FT                   EIEWAIATRFQADRDLVVIAGAQGSPLDPSTTVGQPDDAPSHLQGVSAKMGLDATRPVV
FT                   YPAHVFTRVRIPGQDTVNLQALVAADNSAFDAYLSRDHG"
FT                   /protein_id="YP_003609154.1"
FT   misc_feature    complement(178773..179954)
FT                   /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   Region: UbiD; cl00311"
FT                   /db_xref="CDD:174100"
FT                   /locus_tag="BC1002_5749"
FT   gene            180327..181268
FT                   /db_xref="GeneID:9091128"
FT                   /locus_tag="BC1002_5750"
FT   CDS_pept        180327..181268
FT                   /locus_tag="BC1002_5750"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A2070 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680581"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091128"
FT                   /translation="MDLKQIQYFIALFEDGSVTRAAKRLNIVQPALSMQIAKLEDELHQ
FT                   QLFERGAHGMAPTAAGRLMYRLFLPIVRDLAHARQQLVQRDEVVTGHVGIGLIASVTES
FT                   VLADSLSRFHARYPDVEVTVADGYSATFIDWVAGGQLDAALINKPRARLSLDSRPLLDE
FT                   EMVLATSAAHGPDLPHAIELAQLPELELVLPTKRHGLRGVLDSAAQHEDVLLAPRFEID
FT                   VLSTILKLVEHTRFATILPRIVVERAARHGTLRAYPILAPRIVRHIVCVNHPRRPLSAA
FT                   AEALIEIIGDELHRASSLSGDEPSHTIKERSS"
FT                   /protein_id="YP_003609155.1"
FT   misc_feature    180327..181157
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5750"
FT   misc_feature    180333..180512
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5750"
FT   misc_feature    180609..181157
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5750"
FT   misc_feature    order(180645..180650,180654..180659,180666..180668,
FT                   180678..180680,180684..180704,180978..180995,
FT                   181011..181016,181020..181025)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5750"
FT   gene            181265..182704
FT                   /db_xref="GeneID:9091129"
FT                   /locus_tag="BC1002_5751"
FT   CDS_pept        181265..182704
FT                   /locus_tag="BC1002_5751"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rpc:RPC_0853
FT                   aldehyde dehydrogenase"
FT                   /db_xref="GI:295680582"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="GeneID:9091129"
FT                   /translation="MNARHWIAGEWTGTPNIDSIDPATGDAIGRFADGGSSEADAAIAA
FT                   ARHAFDRTTWAQDARLRQDVLLGWASALEAERDMLATLLTRENGKAIAQSRDEIAGAIS
FT                   EVRYYAGLARHIAGHVLEPEPGTISTMLREAAGVAAIIVPWNAPAVLLVRSLAPALAAG
FT                   CTVIVKPAAQTSLLTAAMLRCFEHTALPEGAVNLVNERGYAASQRLVDSHGVDVVSFTG
FT                   STATGKKIMAAAADSMKKLSLELGGKSCCVVFDDADVAAIAPRLARAATIISGQQCTAA
FT                   RRVLVHASRAAQMREQLASALASLRVGPGIDPATDIGALIDGTTRDAVARTIERACGTA
FT                   ERVLLRGTCSGHAFLSPTLVEHDDPKAFFCQDEIFGPFVTLEVFENEMEAIEKANDTVF
FT                   GLSASVWTHDGARALRVARALRNGTVWINDHNKLFAEAETGGYRQSGLGRLHGYDALAD
FT                   FTELKHICMPAGVAEGIAPLR"
FT                   /protein_id="YP_003609156.1"
FT   misc_feature    181283..182659
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="BC1002_5751"
FT   misc_feature    181319..182665
FT                   /note="NAD(P)+-dependent aldehyde dehydrogenase
FT                   superfamily; Region: ALDH-SF; cl11961"
FT                   /db_xref="CDD:176616"
FT                   /locus_tag="BC1002_5751"
FT   misc_feature    order(181688..181702,181724..181726,181769..181771,
FT                   181775..181780,181922..181933,181940..181942,
FT                   181949..181954,181994..182002,182096..182098,
FT                   182381..182383,182387..182389,182465..182467,
FT                   182579..182581)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="BC1002_5751"
FT   misc_feature    order(181700..181702,181994..181996,182087..182089,
FT                   182096..182098)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="BC1002_5751"
FT   gene            182724..183746
FT                   /db_xref="GeneID:9091130"
FT                   /locus_tag="BC1002_5752"
FT   CDS_pept        182724..183746
FT                   /locus_tag="BC1002_5752"
FT                   /gene_family="HOG000244667" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF182"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   bxe:Bxe_A4357 hypothetical protein"
FT                   /db_xref="GI:295680583"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091130"
FT                   /translation="MDSVDLEVLKSSARWLADGHRVLLVTVVKTWGSSPRPVGAMLAVR
FT                   ADGQVVGSVSGGCIEDDLIDRVRQRGIEQESPQVLKYGVSAQEAHRFGLPCGGTIQLVL
FT                   EPLTLASGIAGLCAAVEAGRLVARTLDMATGAARLEPAQATDGLLFDGTTLLSIHGPRY
FT                   RMLVIGAGQLSRYLCSIAVGLDYQVTVCDPREEYTVEWNVPGTTVVRAMPDDTVMDMKL
FT                   DERSAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNAARRNRLKEFDLTDEELAR
FT                   LHGPVGIYIGSRTPPEIALSILAELTAAKNGVSLPELLRVEGAKAVREMAGNAVGCDAL
FT                   "
FT                   /protein_id="YP_003609157.1"
FT   misc_feature    182739..183716
FT                   /note="Xanthine and CO dehydrogenases maturation factor,
FT                   XdhC/CoxF family [Posttranslational modification, protein
FT                   turnover, chaperones]; Region: XdhC; COG1975"
FT                   /db_xref="CDD:32158"
FT                   /locus_tag="BC1002_5752"
FT   misc_feature    182760..182972
FT                   /note="XdhC and CoxI family; Region: XdhC_CoxI; pfam02625"
FT                   /db_xref="CDD:145661"
FT                   /locus_tag="BC1002_5752"
FT   gene            complement(183872..184867)
FT                   /db_xref="GeneID:9091131"
FT                   /locus_tag="BC1002_5753"
FT   CDS_pept        complement(183872..184867)
FT                   /locus_tag="BC1002_5753"
FT                   /gene_family="HOG000233516" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_5745 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295680584"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091131"
FT                   /translation="MSSALHRDDGAGAIAPGRFDPTRLKTRQLALIVQLDTHRSVLRAA
FT                   DAAHMTQPGATKLLRELEETMGVPLFERHPRGVEPTWYGEVLIRHARSVLAELQHAYDE
FT                   VSALKAGLTGQAMIGTEVTAATNVVPQAVALLKKRFPQIRVNIEMEFSEVLVQRLQEGK
FT                   LDMIVARIRNPDDLAELHYAPLAEAQHALFARVGHPLARRKALSWNELAPQTWILPPKG
FT                   NVMRNQFTQLFLERRLALPTDVVESSSLPVITSLLQISDMIAPLAREPLRPYCIAGALE
FT                   PLPFELDLKLGPAGIVTRRGDRLSPGARAMLQALREAAGFDTGAPDADND"
FT                   /protein_id="YP_003609158.1"
FT   misc_feature    complement(183908..184804)
FT                   /note="pca operon transcription factor PcaQ; Region:
FT                   TF_pcaQ; TIGR02424"
FT                   /db_xref="CDD:162852"
FT                   /locus_tag="BC1002_5753"
FT   misc_feature    complement(184613..184789)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5753"
FT   misc_feature    complement(183923..184516)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5753"
FT   misc_feature    complement(order(184091..184096,184100..184105,
FT                   184121..184138,184421..184441,184445..184447,
FT                   184457..184459,184466..184471,184475..184480))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5753"
FT   gene            185054..186220
FT                   /db_xref="GeneID:9091132"
FT                   /locus_tag="BC1002_5754"
FT   CDS_pept        185054..186220
FT                   /locus_tag="BC1002_5754"
FT                   /gene_family="HOG000061340" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /codon_start="1"
FT                   /product="peptidase M24"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M24; KEGG: bpy:Bphyt_5744 peptidase
FT                   M24"
FT                   /db_xref="GI:295680585"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="GeneID:9091132"
FT                   /translation="MNIRTADIPPEGITTDEFLGRVAKVRSALDKAGLVGLLAFGDCWR
FT                   GANIGYFTEFRPLDGVSDIANAILLLPVDGDPVLFVSDQCFDYATSVTAFEVRSLREVT
FT                   QQVQAFSARHRSGTVGLAGAAYIPADLLQRLNAGLGELKLEPTMVMAEIKAIKSEPEVA
FT                   LMRKAAALTDSAMAAIRDALADGRPYTERELALIADRAMLAGGADRTAFDSMVQSGPRS
FT                   AYNLARPTDRILQPGDLIMTDIGARYRGYVADGGRGFTYGPANPEKMAIVAAAARAVEA
FT                   GLAAARPGMAALELNAVIQQALVKSNYEQYSSEARGHGTGHGTGMDPEEEAPWIGPGNR
FT                   TVLQENMVFTLKATITVPNVGGLRTERIVRLTSGGVETLDHFPMELHW"
FT                   /protein_id="YP_003609159.1"
FT   misc_feature    185090..186214
FT                   /note="Xaa-Pro aminopeptidase [Amino acid transport and
FT                   metabolism]; Region: PepP; COG0006"
FT                   /db_xref="CDD:30356"
FT                   /locus_tag="BC1002_5754"
FT   misc_feature    185114..185494
FT                   /note="Creatinase/Prolidase N-terminal domain; Region:
FT                   Creatinase_N; pfam01321"
FT                   /db_xref="CDD:144790"
FT                   /locus_tag="BC1002_5754"
FT   misc_feature    185537..186178
FT                   /note="A family including aminopeptidase P, aminopeptidase
FT                   M, and prolidase. Also known as metallopeptidase family
FT                   M24. This family of enzymes is able to cleave amido-,
FT                   imido- and amidino-containing bonds. Members exibit
FT                   relatively narrow substrate...; Region: APP_MetAP; cl00279"
FT                   /db_xref="CDD:174086"
FT                   /locus_tag="BC1002_5754"
FT   misc_feature    order(185729..185731,185780..185782,185813..185815,
FT                   186017..186019,186107..186109,186149..186151)
FT                   /note="active site"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="BC1002_5754"
FT   gene            186310..187695
FT                   /db_xref="GeneID:9091133"
FT                   /locus_tag="BC1002_5755"
FT   CDS_pept        186310..187695
FT                   /locus_tag="BC1002_5755"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /codon_start="1"
FT                   /product="General substrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bpy:Bphyt_5743 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:295680586"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091133"
FT                   /translation="MKTSPISSGNAPVISRSAVNRVLVASVVGTAIEWYDFFLYATASA
FT                   LVFAKLFFPSFDPMVGTIAAFGSFAVGYLARPFGAVFFGHFGDRIGRKATLVATLTIMG
FT                   VGTFVIGLLPTYASIGVWAPMLLVAMRFLQGLGVGGEWGGAVLMVVETAPARKRGFFGA
FT                   FPQLGVPLGLMLSTAVFNAVSSLPSQAFYSWGWRLPFLLSVALIAIGLFIRLRVMESPV
FT                   FEQIKASRQVVKAPLIELLRRHPKDLVLTIGTRFAVDITFNVINVFVLMYGTTRLGLSR
FT                   GLLLNAIIVGCVVALFTLPLFGKLSDAIGRRTVFMLGAVFVTIYGFAFFPLLETRNPTL
FT                   IFVAYVCGIALSQASVYGVQSTWFAELFGTRVRYTGASLPYQIAGIITSGPTPLIATYL
FT                   FATYGQTLPISIYIAATALLSLVCAFFLAETFKRDLSAEPGDEAAAAPGARASAPSPHP
FT                   LAR"
FT                   /protein_id="YP_003609160.1"
FT   misc_feature    186376..187587
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5755"
FT   misc_feature    186394..187572
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="BC1002_5755"
FT   misc_feature    order(186418..186420,186427..186435,186439..186444,
FT                   186514..186516,186523..186528,186535..186537,
FT                   186547..186552,186556..186561,186721..186726,
FT                   186733..186738,186745..186750,186757..186759,
FT                   186793..186798,186805..186810,186826..186828,
FT                   187084..187086,187093..187098,187105..187110,
FT                   187117..187119,187159..187161,187171..187173,
FT                   187183..187185,187192..187194,187204..187206,
FT                   187357..187359,187366..187371,187378..187380,
FT                   187390..187395,187402..187404,187435..187440,
FT                   187450..187455,187462..187467,187474..187476)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5755"
FT   gene            complement(187827..188999)
FT                   /db_xref="GeneID:9091134"
FT                   /locus_tag="BC1002_5756"
FT   CDS_pept        complement(187827..188999)
FT                   /locus_tag="BC1002_5756"
FT                   /gene_family="HOG000236957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /codon_start="1"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bmj:BMULJ_03928 fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="GI:295680587"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9091134"
FT                   /translation="MISNDLPPFVPADLPDALLVGRIWRDAPIDGPSVVVVRSGQVYDI
FT                   TASAPTSSDLFERVDLLEFARHVEGEALGPVENIGQALLAPCDLQAIKACGVTFAVSLL
FT                   ERVIEEQAAGDATQADTVRATITQLIGTDLSRIRPGTPAADSLKRELERSGAWSQYMEV
FT                   GIGPDAEVFTKSQPMSAVGYGADVGLHPASHWNNPEPEIVLAVNSRGTIVGATLGNDVN
FT                   LRDIEGRSALLLGKAKDNNGSCSIGPFIRLFDDRFTMDSVRAASVSLSIEGADDGFILD
FT                   GVSHMREISRDPEELVAQTAGPHHQYPDGFMLFLGTMFSPIKDRHAPGSGFTHHLGDKV
FT                   TIATPQLGALVNTVQSSTEIAPWRFGVRALYEALAKRLALARAMGPVSDA"
FT                   /protein_id="YP_003609161.1"
FT   misc_feature    complement(187899..188975)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family protein
FT                   [General function prediction only]; Region: COG3970"
FT                   /db_xref="CDD:33751"
FT                   /locus_tag="BC1002_5756"
FT   misc_feature    complement(187938..188519)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="BC1002_5756"
FT   gene            complement(188962..190266)
FT                   /db_xref="GeneID:9091135"
FT                   /locus_tag="BC1002_5757"
FT   CDS_pept        complement(188962..190266)
FT                   /locus_tag="BC1002_5757"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /codon_start="1"
FT                   /product="glycosyl hydrolase family 88"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   ctu:Ctu_14680 unsaturated glucuronyl hydrolase"
FT                   /db_xref="GI:295680588"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="GeneID:9091135"
FT                   /translation="MNASYQDQGLSSERSALFTGVLDRMAAKVAEDEPTLGVEFPQITA
FT                   ADGKWVLLPASLSAGYSGSAWSHGNWFCGFWVGLLLTSYLHTGEDKYLSWARERMRLVA
FT                   QRAQDPNTHDIGFIFDSSAVPGYEITRDPWYAQIAMEAADKLRARLVTTHSGAYLASWG
FT                   PLDDPRGRSASAIDTMANLSLLYWAANHSGDGSYRLAAEAHSVMTAKSFIRPDGSTYHA
FT                   VEYDVTTGERRRGYTFQGAFDESAWSRGQAWAVYGYVNTARETGKRIWLDLAGRLAAYY
FT                   LRRLDGRLVPPWDFDATGADAEIKDTAAAAVMASALIELGRLHPDPASSVHWREHGLAM
FT                   LEALCRDEFAYEPAHRGLLRNSCYSKPHNEGVDGATMFGDFFFAEALSRVMLPGKLRPG
FT                   TQRVSLAGSTPASRFRTLASQSIHDIERSSAFRTC"
FT                   /protein_id="YP_003609162.1"
FT   misc_feature    complement(<189427..190071)
FT                   /note="Glycosyl Hydrolase Family 88; Region:
FT                   Glyco_hydro_88; cl01723"
FT                   /db_xref="CDD:154553"
FT                   /locus_tag="BC1002_5757"
FT   gene            complement(190411..191304)
FT                   /db_xref="GeneID:9091136"
FT                   /locus_tag="BC1002_5758"
FT   CDS_pept        complement(190411..191304)
FT                   /locus_tag="BC1002_5758"
FT                   /gene_family="HOG000082200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_5549 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295680589"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9091136"
FT                   /translation="MPSSCGCELPVFKIAHYEYGSRIKSIDFHLAPLEDMKSTLPYPHR
FT                   HEFYHIVWVESGSGHHIIDSIRYEVRPNTLFFMAPGQIHDFALSEDTIGHAISFSSEFF
FT                   AFKVQNRHSQTEIPVYDFERIPNTVYMSDAQAQDLRRVLDGINAEYQGEEAGYEDVIWS
FT                   YLRVLLIKSARLGGDAVTEVNSSRSVLLSRRFKSLLEKHFATIHDVARYACLLNVTERA
FT                   LNEATRQALGSTAAKLIRERVMLEAKRLLLHSEVNVAEIATQLAFDDPAYFSRCFRKHT
FT                   GRSPIDFRRSLEKLSI"
FT                   /protein_id="YP_003609163.1"
FT   misc_feature    complement(190438..191253)
FT                   /note="4-hydroxyphenylacetate catabolism regulatory protein
FT                   HpaA; Region: HpaA; TIGR02297"
FT                   /db_xref="CDD:131350"
FT                   /locus_tag="BC1002_5758"
FT   misc_feature    complement(<191032..191178)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_5758"
FT   misc_feature    complement(190435..190551)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5758"
FT   gene            complement(191488..191949)
FT                   /db_xref="GeneID:9091137"
FT                   /locus_tag="BC1002_5759"
FT   CDS_pept        complement(191488..191949)
FT                   /locus_tag="BC1002_5759"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   azc:AZC_2420 bifunctional enoyl-CoA hydratase/phosphate
FT                   acetyltransferase"
FT                   /db_xref="GI:295680590"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="GeneID:9091137"
FT                   /translation="MKTHPNRCHEMLRFDDIEIGRCQILVHTIAESDVNAFGHLSGDLN
FT                   PLHMDPHFAARTPFGQRVAHGLLTAALVSTTHTGLTGPGFVYVGQELRFLGPVFIDDTI
FT                   KIHVTVVEKKPAKRILVMDTMVRNQDGKPVLTGLSALKELRFQSADVMS"
FT                   /protein_id="YP_003609164.1"
FT   misc_feature    complement(191539..191901)
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase]
FT                   catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway. (R)-hydratase
FT                   contains a hot-dog fold similar to those of...; Region:
FT                   R_hydratase; cd03449"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   misc_feature    complement(order(191668..191670,191674..191676,
FT                   191680..191688,191692..191697,191725..191730,
FT                   191737..191739,191818..191826,191830..191835,
FT                   191839..191841,191863..191865,191869..191871))
FT                   /note="dimer interaction site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   misc_feature    complement(order(191545..191547,191578..191580,
FT                   191584..191586,191626..191628,191668..191670,
FT                   191674..191676,191680..191682,191689..191691,
FT                   191731..191733,191740..191742,191749..191751,
FT                   191755..191757,191806..191808,191815..191817,
FT                   191821..191823,191839..191841))
FT                   /note="substrate-binding tunnel; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   misc_feature    complement(order(191749..191754,191761..191763,
FT                   191806..191808,191815..191817,191821..191823,
FT                   191836..191838))
FT                   /note="active site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   misc_feature    complement(order(191752..191754,191806..191808,
FT                   191815..191817,191821..191823))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   misc_feature    complement(order(191689..191691,191695..191697,
FT                   191728..191730))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5759"
FT   gene            complement(191946..193139)
FT                   /db_xref="GeneID:9091138"
FT                   /locus_tag="BC1002_5760"
FT   CDS_pept        complement(191946..193139)
FT                   /locus_tag="BC1002_5760"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: msm:MSMEG_0489 racemase"
FT                   /db_xref="GI:295680591"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:9091138"
FT                   /translation="MLEGIKVVSFTHFLQGPAAVQMLADVGADVIKIEPPGGAFERSWS
FT                   GFDAYVEGVSMFFLLGNRNQRSISLDLRDERAREIVWRLIKEADVLIENYRPGVLQRMG
FT                   FGYDDVREINPRLVYCSCTGYGSSGPYLKRPGQDLLLQAISGMTMLSGDADSPPTPVGS
FT                   AIVDQHAAALAAFGVVAALQARERTGKGTLVESNLLNAALDLQIEPFTYYLNKGPLWPR
FT                   TNPPTGSRFHPAPYGIYRTLDGWIAVSLTPTEKLAAALSQPTLAGFSHPKDNVRRRDEL
FT                   NRIVYDALTTRTTADWMTTFDAHDVWYAPVNDYDQVEADPQVAHNHIIMEVDHPQAGPV
FT                   RLLAHPVRYDGAAPPLTRQPPRQGEHTREVLAELGYEPHEINTLVEAGTALTERRTA"
FT                   /protein_id="YP_003609165.1"
FT   misc_feature    complement(191970..193139)
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:174385"
FT                   /locus_tag="BC1002_5760"
FT   gene            complement(193184..194329)
FT                   /db_xref="GeneID:9091139"
FT                   /locus_tag="BC1002_5761"
FT   CDS_pept        complement(193184..194329)
FT                   /locus_tag="BC1002_5761"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   reu:Reut_C6425 butyryl-CoA dehydrogenase"
FT                   /db_xref="GI:295680592"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091139"
FT                   /translation="MPHWLNEQHTAIRDAVRRFAENEIAPVSEELWEAEAFPYDIWKRA
FT                   GELGFAGLPYPESWGGGGGEWLSYVIVLEELARVDCAIANSLMANSTVASLLSNYGTDE
FT                   QKDRYLRPILDGRKVGAIGLSEPNAGSDAANIATRATLEGDRWIIDGSKTFISNSGTEV
FT                   TGPVVIAAVTGTRPDGRKEISNFIVPNGTPGFSYGRKLRKIGWRASSTYELFFERCAIP
FT                   AANLLGERGAGLRQTLAQISTGRILIGALALGILQGSLDRSIAYMKERRAFGKPIAEFQ
FT                   ALQFKIADMAAHAHAARLMLYDTAALKDAGVRFDQQASMAKLFATECAMEAAHQALQIH
FT                   GGYGVMSEYPVSRAFGDAKVLEIVEGTSEIQRMIISRNLLA"
FT                   /protein_id="YP_003609166.1"
FT   misc_feature    complement(193190..194329)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BC1002_5761"
FT   misc_feature    complement(193187..194311)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BC1002_5761"
FT   misc_feature    complement(order(193223..193225,193229..193231,
FT                   193235..193243,193859..193861,193865..193867,
FT                   193958..193960,193964..193966,194054..194056))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5761"
FT   gene            complement(194376..194801)
FT                   /db_xref="GeneID:9091140"
FT                   /locus_tag="BC1002_5762"
FT   CDS_pept        complement(194376..194801)
FT                   /locus_tag="BC1002_5762"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   swo:Swol_1356 (de)hydratase"
FT                   /db_xref="GI:295680593"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9091140"
FT                   /translation="MAKRPHMDCYALGDTADFAKTVTEFDIYGFAGIVGDFYAVHLNEE
FT                   FAKTTRFEKRIAQGCLSVGFLSTVMGYMAQKAPSPGAVSYRYDITFNAPVFIGDTVTAR
FT                   LTLREKDDDRNVCVFRAEVTRQDGTVVASGDTYLKVL"
FT                   /protein_id="YP_003609167.1"
FT   misc_feature    complement(194382..194765)
FT                   /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase]
FT                   catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway. (R)-hydratase
FT                   contains a hot-dog fold similar to those of...; Region:
FT                   R_hydratase; cd03449"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   misc_feature    complement(order(194529..194531,194535..194537,
FT                   194541..194549,194553..194558,194598..194603,
FT                   194610..194612,194691..194699,194703..194708,
FT                   194712..194714,194736..194738,194742..194744))
FT                   /note="dimer interaction site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   misc_feature    complement(order(194388..194390,194406..194408,
FT                   194439..194441,194445..194447,194487..194489,
FT                   194529..194531,194535..194537,194541..194543,
FT                   194550..194552,194592..194594,194604..194606,
FT                   194613..194615,194622..194624,194628..194630,
FT                   194679..194681,194688..194690,194694..194696,
FT                   194712..194714))
FT                   /note="substrate-binding tunnel; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   misc_feature    complement(order(194622..194627,194634..194636,
FT                   194679..194681,194688..194690,194694..194696,
FT                   194709..194711))
FT                   /note="active site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   misc_feature    complement(order(194625..194627,194679..194681,
FT                   194688..194690,194694..194696))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   misc_feature    complement(order(194550..194552,194556..194558,
FT                   194592..194594,194601..194603))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48044"
FT                   /locus_tag="BC1002_5762"
FT   gene            195225..196256
FT                   /db_xref="GeneID:9091141"
FT                   /locus_tag="BC1002_5763"
FT   CDS_pept        195225..196256
FT                   /locus_tag="BC1002_5763"
FT                   /gene_family="HOG000251307" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /codon_start="1"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB1745 hypothetical protein; TIGRFAM: TRAP
FT                   dicarboxylate transporter, DctP subunit; PFAM:
FT                   Extracellular solute-binding protein, family 7"
FT                   /db_xref="GI:295680594"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="GeneID:9091141"
FT                   /translation="MKAFLSARRAGRAIMVGTLLAAGVVVAGVARADDPIVMKLGHTLA
FT                   PNNHYQLTAQVFAKEVAQRTHGKVKIEIFPQSQLGGEVQMAQALRTGTQELMISAQAPI
FT                   GNTIRQWQIFDTPYLFSSIDDANRVLQGPVGRKFLDMMPAVNMIGLTWLSVGERNLFTA
FT                   KKSVGSLGDMKDLKVRVMQSPGYIAGYKALGANPTPLPYNQLFLALSQDLVDGGDTSPE
FT                   QFIQDKFSDVAKHYYLTHVNYLPVVLAMSKSAWTRLSPDEQKAFQAAAAIAADYDMKEY
FT                   KREYDDALTTMKKNGTQVTEINTAPWAAATEKARDGLLSGIPDGKALYREIEAADKSAV
FT                   ASK"
FT                   /protein_id="YP_003609168.1"
FT   sig_peptide     195225..195323
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.961 at
FT                   residue 33"
FT                   /locus_tag="BC1002_5763"
FT   misc_feature    195318..196238
FT                   /note="Bacterial extracellular solute-binding protein,
FT                   family 7; Region: SBP_bac_7; cl00710"
FT                   /db_xref="CDD:153950"
FT                   /locus_tag="BC1002_5763"
FT   gene            196269..196802
FT                   /db_xref="GeneID:9091142"
FT                   /locus_tag="BC1002_5764"
FT   CDS_pept        196269..196802
FT                   /locus_tag="BC1002_5764"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /codon_start="1"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /transl_table="11"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: kra:Krad_0195 tripartite
FT                   ATP-independent periplasmic transporter DctQ component"
FT                   /db_xref="GI:295680595"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="GeneID:9091142"
FT                   /translation="MEKLARNLMFIDDLVLKITLFLCGGLLLTMVCVAGLGVVFRFILQ
FT                   DSLSWSDELAAYLFVWLTCLGAAAGAKLRVHPEVRVLADRCPPIFAQTLADLTDCVVLA
FT                   LGAVFVMYGGEMLELMGTETATSLPVSMVYPYLSIPVCGALLVFHSAVRIAVSHLAPGA
FT                   QTRPSLLQGVSEHI"
FT                   /protein_id="YP_003609169.1"
FT   misc_feature    196299..196730
FT                   /note="Tripartite ATP-independent periplasmic transporters,
FT                   DctQ component; Region: DctQ; cl01181"
FT                   /db_xref="CDD:174571"
FT                   /locus_tag="BC1002_5764"
FT   gene            196814..198085
FT                   /db_xref="GeneID:9091143"
FT                   /locus_tag="BC1002_5765"
FT   CDS_pept        196814..198085
FT                   /locus_tag="BC1002_5765"
FT                   /gene_family="HOG000266922" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /codon_start="1"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: dba:Dbac_2445 TRAP dicarboxylate transporter,
FT                   DctM subunit; TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="GI:295680596"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="GeneID:9091143"
FT                   /translation="MWALALGAGLLGFGVPVAICIGIAATIALTLNGTPLLVIPQQLFA
FT                   NLNNVGLLAIPFFMLTGAIMDAGGVSRRIIDFSQALVGFMRGGIGQVTIVASMFFADLS
FT                   GSATADTAAIGSVMIPGMVKQGYSRAFAVALQSAAGSLGLLSPVSMSMLVYAYTANVSV
FT                   GTMFVAGIVPMLLVVISFMLVNYVTAVRQNYTAVEAFSAARLWTTFRQAILALLTPVII
FT                   LGGILGGIFTPVEAGVIAAVYVTLVSAFVFKSLKLSHFREILTRTAINTTRVSFLLGLA
FT                   FVLGRYLIEAQIPLHVANSFLAVTTSAFVLLILINLFLLAAHTVLETISSIAVVIPVFL
FT                   PLVAQMHIDPVVFGVIVLINSAIGINLPPIGFCLFTAASIGGVSVEKATRAILPFIFAL
FT                   TVDLLLIIVFPHIPRFLPNLLAIK"
FT                   /protein_id="YP_003609170.1"
FT   misc_feature    196850..198049
FT                   /note="DctM-like transporters; Region: DctM; pfam06808"
FT                   /db_xref="CDD:148424"
FT                   /locus_tag="BC1002_5765"
FT   misc_feature    196853..198064
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="BC1002_5765"
FT   gene            198194..199027
FT                   /db_xref="GeneID:9091144"
FT                   /locus_tag="BC1002_5766"
FT   CDS_pept        198194..199027
FT                   /locus_tag="BC1002_5766"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mlo:mll1009 enoyl-CoA hydratase"
FT                   /db_xref="GI:295680597"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="GeneID:9091144"
FT                   /translation="MNTAHIERSGAAPVPLAAGEDLRYLKLEQPAEFVWLITLNHHDKR
FT                   NALSVPLLEELARVLAAAEASDDVRAVVLTGGERFFSAGADIADMAARGVAAYADPVRL
FT                   ASWKTIETFPKPLIAAVNGFAIGGGHELVMLADIVVAADDATFSQREIVIGALPGDGAT
FT                   QRLPRVLGKTLAMKLVLTGEPLTAAEAERHGLVTEVVAPARSIARAVEIASLIAARAPL
FT                   AVRLAKRAVLDSFETDLQRGLELEHQANLDVFKTEDRAEGHRAFVEKRPPHFKGR"
FT                   /protein_id="YP_003609171.1"
FT   misc_feature    198293..198841
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5766"
FT   misc_feature    198299..199015
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK05980"
FT                   /db_xref="CDD:168327"
FT                   /locus_tag="BC1002_5766"
FT   misc_feature    order(198326..198328,198332..198334,198428..198430,
FT                   198440..198454,198563..198565,198569..198577,
FT                   198641..198646,198653..198655)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5766"
FT   misc_feature    order(198446..198448,198575..198577)
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5766"
FT   misc_feature    order(198515..198517,198539..198541,198602..198613,
FT                   198647..198658,198674..198676,198680..198688,
FT                   198692..198697,198710..198715,198719..198724,
FT                   198728..198733,198740..198742,198773..198775,
FT                   198782..198784,198827..198829,198836..198841)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="BC1002_5766"
FT   gene            199181..200416
FT                   /db_xref="GeneID:9091145"
FT                   /locus_tag="BC1002_5767"
FT   CDS_pept        199181..200416
FT                   /locus_tag="BC1002_5767"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bja:blr3303 putative racemase"
FT                   /db_xref="GI:295680598"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:9091145"
FT                   /translation="MNGLNGIRILSFNHFLMGPLGVQHLADCGAEVISVEPVDGAFQRK
FT                   WGGANRAIDGQTMLLLMGNRNKRSLALNLKDARAIDIVMSLLPQVDVVAENYRPGVMEQ
FT                   LGLGYDALRAVKPDIIYASGSGFGPDGPYASRPGQDLIIQAMSGIATVTGTRQDGPRAV
FT                   GVSVVDHHGAALYANGILTALLNRERTGEGCRVDVSLLAAALDLQQESLTCFLNGEGHD
FT                   DVRQAGRVSGWYFPAPYGIYATADGFIALSLSPLDIIYQILEMPAKERIPAKRAFDEQQ
FT                   EISDRLARRLAQHTTAHWLPLFERQHVWHTRVNDYEQVVADPQVRHLKSFETVEGATGS
FT                   PVTLVNHPVRYNGSAPAIRTPPPRLGAHTIDILSGLGTSRPTIDSLLADGVIGVAEEAA
FT                   AVAADAAKDGVA"
FT                   /protein_id="YP_003609172.1"
FT   misc_feature    199190..200338
FT                   /note="CoA-transferase family III; Region: CoA_transf_3;
FT                   cl00778"
FT                   /db_xref="CDD:174385"
FT                   /locus_tag="BC1002_5767"
FT   gene            200482..202206
FT                   /db_xref="GeneID:9091146"
FT                   /locus_tag="BC1002_5768"
FT   CDS_pept        200482..202206
FT                   /locus_tag="BC1002_5768"
FT                   /gene_family="HOG000268242" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.4.3.16"
FT                   /codon_start="1"
FT                   /EC_number="1.4.3.16"
FT                   /transl_table="11"
FT                   /note="KEGG: rsq:Rsph17025_1547 L-aspartate oxidase; PFAM:
FT                   fumarate reductase/succinate dehydrogenase flavoprotein
FT                   domain protein"
FT                   /db_xref="GI:295680599"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR004112"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="GeneID:9091146"
FT                   /translation="MSDKYREVMTDVLVVGSGGAALRAALEADSSGADVLVVIKGQFGK
FT                   SGATFHSVAEVGAFNVPDGAGDPSDSPDVFLADILHAAQGMADPRLSSILANEAQDSLR
FT                   YLERYGVKFEREDDHYLVFRACFSSRARSHVIHEHFKPIVKSLGTEASRRGIKVMDRLM
FT                   LVDLLSQDGECLGAYAIDSDGNPVLIHAKSTILTTGGASQLFAQNLYPSDITGDGYAMA
FT                   YRAGARLVNMEFMQAGVSVLTPFTNLFGNYLWDAQPNLTDRDGRAFVPDYLPAGLAQVD
FT                   VIRQKERHFPFSSSDISRYVEISIQKALNDGRSTVEGGVFLDFVGCDLEAILADKSRSI
FT                   ARMWPLTCQWYKEHGVDLHRDRVQITCSAHAINGGLYIDENAQSNLKGLFAAGEVAAGP
FT                   HGADRLGGNMALTCQVFGRRAGLAAAERARMTTHRATAAALDDSRTVATRFRRSGGHTV
FT                   EELRARIQQSANRYLLIVREEAGLQTFRRICRETRDQLFQDMMIRTPAEFIRSIELANL
FT                   IQVGELMACASLARRESRGGHYREDFPERNPDFASNIFLERNVPEGLWFGRLADLPS"
FT                   /product="L-aspartate oxidase"
FT                   /protein_id="YP_003609173.1"
FT   misc_feature    200500..202188
FT                   /note="succinate dehydrogenase flavoprotein subunit;
FT                   Reviewed; Region: sdhA; PRK06263"
FT                   /db_xref="CDD:168491"
FT                   /locus_tag="BC1002_5768"
FT   misc_feature    200509..201729
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5768"
FT   misc_feature    201865..>202122
FT                   /note="domain; Region: Succ_DH_flav_C; pfam02910"
FT                   /db_xref="CDD:145850"
FT                   /locus_tag="BC1002_5768"
FT   gene            202406..202789
FT                   /db_xref="GeneID:9091147"
FT                   /locus_tag="BC1002_5769"
FT                   /pseudo
FT   gene            202975..204000
FT                   /db_xref="GeneID:9091148"
FT                   /locus_tag="BC1002_5770"
FT   CDS_pept        202975..204000
FT                   /locus_tag="BC1002_5770"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: har:HEAR0660
FT                   transposase"
FT                   /db_xref="GI:295680600"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:9091148"
FT                   /translation="MEIDVLGIDLAKQIFQLHGADRRGRVVHRSKVSRSSFFEAVRALN
FT                   PKLVVMEACSTAHHWGRRFQSVGIEVRLISPQYVAPFVKTNKNDRNDAEAIVEAASRPT
FT                   MRFVTIKSVEQQDIQAAHRMRAILLRHRTALINQIRGLLGERGLAIARSPEAFRRAIPE
FT                   LLRTSADELTSFCQTLLTELLQHMRAIEERVHLIEASIQTFMKKSALCRKIAEIPGIGP
FT                   ITATAVVAAVGDARQFRNGRHLSAWLGLVPRQYSSGGKPRLHGISRRGDTYLRTLLIHG
FT                   ARAVLRYAPKKTDPQSIWLQELMARRGHNCAAVALANRNARIIQALLSSEATYMTRSAA
FT                   T"
FT                   /protein_id="YP_003609174.1"
FT   misc_feature    202987..203958
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="BC1002_5770"
FT   misc_feature    203164..203433
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="BC1002_5770"
FT   misc_feature    203605..203844
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="BC1002_5770"
FT   gene            complement(204381..206351)
FT                   /db_xref="GeneID:9091149"
FT                   /locus_tag="BC1002_5771"
FT   CDS_pept        complement(204381..206351)
FT                   /locus_tag="BC1002_5771"
FT                   /gene_family="HOG000265691" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /codon_start="1"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bxe:Bxe_A0198 transglycosylase"
FT                   /db_xref="GI:295680601"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR016026"
FT                   /db_xref="GeneID:9091149"
FT                   /translation="MSTRRHRASRAIGFALAAATFVVSGTAVARHPTRLSSLSADDQIF
FT                   IRLRDAARDNDPERAAQLASLIRNYPAPAYLSYFQIKPRLFIGAGHANLDAPDVPVLSF
FT                   LQRYDGQAIADRLRNDYLRVLGARHDWKDFDSQYSLFVLNDDTQVNCYALESRAARGEN
FT                   VADAARALLVEPKWYGDGCVDLITALDGNHQFTSEDVWQKIREAYEQGATRTGGGLVDA
FT                   LGTARPDPLRLDQARNQPRVLLAKGVPMDSASHQLALLAITQVAASDPAAAAAIFTAIA
FT                   SALTLAERAIGWGTIAYQAATRQLPGAVDWYRLSANAPLSSQAYEWRTRSALLAGDWMM
FT                   VRWSIEQMPAALRAQPPWVYWYARALKQAGEVTAANQEFGKIAGTYTFYGQLASEALGQ
FT                   QIVIPPQIKVTDEEVKKASQTPGFELAKRFYALNLRTEGNREWNWQLRGMTDRQLLAVA
FT                   EYARRIELYDRTVSTADRTQTEHDFSLRYLAPFRAIVERDAQSNGSHIEWAYGLIRQES
FT                   RFNISARSEVGAGGLMQVMPETAEMVARKIGLGPLSRARMNELDTNIQLGTYYLSMIYN
FT                   QLDRSAVLATAGYNAGPGRPRKWQANLPRPVEGAIFAETIPFNETRDYVKNVLSNTVYY
FT                   AALFDGRPHSLMELLGHIEPR"
FT                   /protein_id="YP_003609175.1"
FT   sig_peptide     complement(206262..206351)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.907 at
FT                   residue 30"
FT                   /locus_tag="BC1002_5771"
FT   misc_feature    complement(204411..206309)
FT                   /note="lytic murein transglycosylase; Provisional; Region:
FT                   PRK11619"
FT                   /db_xref="CDD:171206"
FT                   /locus_tag="BC1002_5771"
FT   misc_feature    complement(204459..204833)
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="BC1002_5771"
FT   misc_feature    complement(order(204585..204587,204642..204644,
FT                   204744..204746,204804..204806))
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="BC1002_5771"
FT   misc_feature    complement(204804..204806)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="BC1002_5771"
FT   gene            206916..207833
FT                   /db_xref="GeneID:9091150"
FT                   /locus_tag="BC1002_5772"
FT   CDS_pept        206916..207833
FT                   /locus_tag="BC1002_5772"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /codon_start="1"
FT                   /product="basic membrane lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: rde:RD1_1647
FT                   putative sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="GI:295680602"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="GeneID:9091150"
FT                   /translation="MKPAPVNERRRVACSLLALSAFAPTALRGGTHASVAGTVSRWPVL
FT                   LFIPFAGSDLGFSEAAYRGYLQVRHNGYRMTIVRDADSLGAARILTVIGRHYTAGVRGF
FT                   ILAGAELSAVTATAAAQYPQAYFATLSGKASGPNVVNYCLDCKSLGGALAGAVAASVSK
FT                   TKTVGFVGGVESVDGTEAQSFRQAVLAKAPDATVLIDWVGDWGDRRRTQQLTVQQIDAG
FT                   ADVLVADANDAVIVAAVRHPRVRVIGWMADASRRYGNVAASVIIDTSIIFRRFVDGVVA
FT                   GRFEGGDYPVVDTDNVWKIVWPHG"
FT                   /protein_id="YP_003609176.1"
FT   sig_peptide     206916..207017
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.699 at
FT                   residue 34"
FT                   /locus_tag="BC1002_5772"
FT   misc_feature    <207306..207782
FT                   /note="Type 1 periplasmic binding fold superfamily; Region:
FT                   Periplasmic_Binding_Protein_Type_1; cl10011"
FT                   /db_xref="CDD:175057"
FT                   /locus_tag="BC1002_5772"
FT   gene            207861..209186
FT                   /db_xref="GeneID:9091151"
FT                   /locus_tag="BC1002_5773"
FT   CDS_pept        207861..209186
FT                   /locus_tag="BC1002_5773"
FT                   /gene_family="HOG000223178" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3111 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="GI:295680603"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:9091151"
FT                   /translation="MSSLKNQITVTLIVLVTAVGLIDAYTSYWLSRKHIGELLDVHLQG
FT                   AAIWLSAGNVGAIGSHGPPQHSVDGFVGQIWRSGDAAPTDNTDPELLFDRNAPDGYSIE
FT                   RIGGHAYRIYTLRKADGQYTYQVGQPVAFREETARHAALESLIPTLILIPLVWLAIPFV
FT                   VNAAFASLSRAAAQSELVGIRHLEPLDISGVPDEVRPFAASVNRMIARLQVGIDAEKRF
FT                   VADAAHELRTPIAAMQLRVDNLVNAPDEAARSERLRELREAIARASTMIRQLLSLARAD
FT                   AQLDLTAIETVDLSQLVQKLVADFLPVADARSIDLGVGKFESAQVEAREGELRMAVRNL
FT                   LENALRYTPAGGTVDIDLFRSADDLVVRVTDNGPGIPEASLDRVFDRFFRLRAEDSEGS
FT                   GLGLSIVKSVVAKYRGSISLANRSDGHSGLIATIVLPARGTR"
FT                   /protein_id="YP_003609177.1"
FT   misc_feature    208113..209114
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="BC1002_5773"
FT   misc_feature    208512..208709
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cl00080"
FT                   /db_xref="CDD:153499"
FT                   /locus_tag="BC1002_5773"
FT   misc_feature    208857..209165
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_5773"
FT   misc_feature    order(208875..208877,208887..208889,208896..208898,
FT                   208965..208967,208971..208973,208977..208979,
FT                   208983..208988,209058..209069,209115..209117,
FT                   209121..209123,209142..209147,209151..209153)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_5773"
FT   misc_feature    208887..208889
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_5773"
FT   misc_feature    order(208977..208979,208983..208985,209058..209060,
FT                   209064..209066)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="BC1002_5773"
FT   gene            209831..209998
FT                   /db_xref="GeneID:9091152"
FT                   /locus_tag="BC1002_5774"
FT   CDS_pept        209831..209998
FT                   /locus_tag="BC1002_5774"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:295680604"
FT                   /db_xref="GeneID:9091152"
FT                   /translation="MLNVYLLPVDSEDSECSATCGNPGRYSFINSGILEWFRKVFPRRA
FT                   NLPDAKLPNC"
FT                   /protein_id="YP_003609178.1"
FT   gene            210117..210791
FT                   /db_xref="GeneID:9091153"
FT                   /locus_tag="BC1002_5775"
FT   CDS_pept        210117..210791
FT                   /locus_tag="BC1002_5775"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3110 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="GI:295680605"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:9091153"
FT                   /translation="MRVLIVEDDLQIGQSLLRALQDAEYSVDWVRDGNAGSAAIAAVEY
FT                   TLVLLDLGLPGMGGIELLKAAREKGSKVPILILTARDDLDARVQGLDFGADDYVLKPFH
FT                   LPELLARIRAVLRRRAGFASSRLGNDTLNLDLDKRTLCCNGVSSVLSAREFALMFAFLE
FT                   RPGTILSRDQLEGKLYGWGKEVESNAVDVLIHGVRKKFGQSVIRNVRGLGWTVTLGESP
FT                   EV"
FT                   /protein_id="YP_003609179.1"
FT   misc_feature    210117..210776
FT                   /note="DNA-binding transcriptional regulator QseB;
FT                   Provisional; Region: PRK10336"
FT                   /db_xref="CDD:170373"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    210126..210437
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    order(210135..210140,210267..210269,210291..210293,
FT                   210351..210353,210408..210410,210417..210422)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    210267..210269
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    order(210276..210281,210285..210293)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    210417..210425
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    210510..210758
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_5775"
FT   misc_feature    order(210567..210569,210624..210629,210681..210683,
FT                   210690..210692,210714..210719,210738..210740,
FT                   210753..210755)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="BC1002_5775"
FT   gene            211613..217945
FT                   /db_xref="GeneID:9091154"
FT                   /locus_tag="BC1002_5776"
FT   CDS_pept        211613..217945
FT                   /locus_tag="BC1002_5776"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /codon_start="1"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3980 autotransporter; TIGRFAM: outer
FT                   membrane autotransporter barrel domain protein; PFAM:
FT                   Autotransporter beta- domain protein"
FT                   /db_xref="GI:295680606"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="GeneID:9091154"
FT                   /translation="MYIFKHSSHCESARTLTSAPCFEDCCGRKRRTVVALASAVTSLAA
FT                   LFVPVAVRAQCNSSANPALPAAPAQTNFSNQSFGAAPLPQYYLNAAGQAGCKGADDGSW
FT                   NGVGQDGFAGQSGGSFNSVNNGITVKGGFAPTFISPTMGAGWSVDGGDGGGGGQGGYDA
FT                   NGSAHTGNGGAAGNGGAVSVQFSGTVGPDPKGVLPEVALDVQANGGTGGVGAVSNAQGT
FT                   EPLYGGNGGAGGRGGQAALSASGSIQFYGVGLRASALGGTGGVGGNSPTPGDLVVEGHG
FT                   GKGGNGGAGGTATLAFQNGSLTASTSAGQIFPMQADADGGTGGSAGGAYGGSGSFGGTG
FT                   GNGGNGGTASAELGSGGQIVFSDQMQPANSRYQPGSGVTAKANGGAGGGGGTAIDGSFR
FT                   NEGGVGGNGGIAGSASATVLGSIDYTANVPGGQSAAGLIGGEGVLVQANGGAGGIGDGA
FT                   QSTVVGEGGDGGKAGAGGKASLTLGDAANTATIKTNGPYTHGALVQSVGGGGGNGGSVS
FT                   FALAGTGGAGAAGGDGGAVTVNSDHAFVTVGSQSGVGSIPLIAQSIGGGGGSGGDASGV
FT                   TAGAGFEIGGNGGQGGNGGAVKLTLGQNSVFGSLDQSGGAGILAQSIGGSGGNAGNATS
FT                   SGGGLITMVIGGDAHGGGAGGQVTVDNGALVTTYGDHAAGIKAQSIGGGGGNGGNATAF
FT                   TVGGPLSSSVAIGGQGGGGGAAGAVSLTNTGQVVTYGSDAEGVVLQSIGGGGGSGGSAT
FT                   ARAVAASASPNIPSISVSAAIGGAGGTGNTGGNVTLDNSGLITTAGDSATGVLAQSVGG
FT                   GGGTGGDATAASYSASPAKGASLSVSVALGGSGGSGGRGGAVNLENSGLVATLGQDAHG
FT                   VFAQSIGGGGGNGGTGDASATAANAKASFSASIAVGGTGGTGGTGGTVGLTNDGSIATR
FT                   GDGADAVFAQSVGGGGGAGGGGTAAASGGKDAIAVGVGGKGGVGGDGNTVTTINNGNIV
FT                   TRGAASTGIFAQSVGGGGGKGGKGAAAAGGSGGLDTISNAQTLFGILGQGLGLNQNVQN
FT                   LGNNILQVGVLGEKIKATYGDLEKLLTQPDGVSKVLGTVNQISVGVAVGGSGGAGGQGG
FT                   AVNASNTGAIGTYGAQSHGIFAQSVGGGGGSGGAASSTGKSNNDSKVQAAVAVGGSGGA
FT                   AGSGGAVSVVQKANGAVETQGVEAFGVYAQSVGGGGGNGAMSGAVSGSLKSLSIAVGGN
FT                   GGGAGNGGDVSVSNGGTVTTLGKHSVGILAQSIGGGGGVVTTASSDETFDPSKAVQNPQ
FT                   GRIADIYGVTLSFGGQNGSSGNGGGVTVNTQGNVTTSGLDAHGIVAQSIGGGGGFVAGG
FT                   QINTNTNALVGAGGASGNGGNVLVVDTNNTVSTTGDGAYGIVAQSIGGGGGFAGDPSAP
FT                   NYYADNTGGVVFANSGNGGTVNVIVVNGGKVVTTGRYAPAIFAQSIGGGGGLVASNYNS
FT                   SPLGPLHDVARGRAGGAGVGGLVAVNVRDNDTVMATGVGSAGILAQSDGQKGGQISIHL
FT                   APGSKVIGGTTDPNFRTSSMGGLDPEFRDAAAVRLIGGNNNIITNQGTIQTLGKYAILV
FT                   DPTLYGEASATTTVNNSGTITGDIHVLGGPGNSVVNNLPGGVIDTPATLNVGGGTVNNA
FT                   GTLKVGGAKSIGNTILTGNLVQSSTGTLNVQIDPANKRSDLLNITGTAALAGKVQADPV
FT                   SYLKSTSTVLSAAGGIRPDTALAGSSTPVYRFTPLVQGNTVAIKTDADFVGASKGASAT
FT                   QQSVAANLDRLWNSADPTFAPIFGAFGSAGSTAGYAQTLTAVSGQELLGVAAARYQSSQ
FT                   AFSRSVFSCPEFGDDDTTVRKQGSCVWFRATGMWENRSADASFPGFGWQGTTMKVGGQV
FT                   QLQPGWFLGGAIGYETDRFTGNDNLTSANGNALLGVVALKHEVGRWTFSGAVDASYGWL
FT                   NSSRVIPSANAVATASPNSFNLGMHMRAAYQIPFGRFYLEPALDGDLNYINLPGYTESG
FT                   AGALNLKVNSANSIIATGTPNLRIGTRAQIGSATVDAYVGAGVSFIAGNSYTTNASFAA
FT                   APGFGSFTNTLTNAHVAGKFSAGVEVYTTKRLDVRLEYDGVVAAHEVENGGQIRFKYRF
FT                   "
FT                   /protein_id="YP_003609180.1"
FT   misc_feature    217121..217885
FT                   /note="Autotransporter beta-domain; Region:
FT                   Autotransporter; cl02365"
FT                   /db_xref="CDD:154874"
FT                   /locus_tag="BC1002_5776"
FT   gene            complement(217929..218138)
FT                   /db_xref="GeneID:9091155"
FT                   /locus_tag="BC1002_5777"
FT                   /pseudo
FT   gene            complement(218169..219350)
FT                   /db_xref="GeneID:9091156"
FT                   /locus_tag="BC1002_5778"
FT   CDS_pept        complement(218169..219350)
FT                   /locus_tag="BC1002_5778"
FT                   /gene_family="HOG000042037" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bph:Bphy_7056 FAD dependent oxidoreductase"
FT                   /db_xref="GI:295680607"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:9091156"
FT                   /translation="MNDATRSSSGAVREADVLVIGGGLHGSSSAFHLAARGANVIVLEA
FT                   DYVGRHSSGVNAGGVRTLGRPLPEIPLALMSRKIWHSLRETIGDDGGFVPSGQLKIAET
FT                   EAELDECRARVAQLEAHGFTHEKLIDRASVLELEPSLARHVTGGIWVERDGYALPFKTT
FT                   TAFRLAAQRHGAAFFEGTPVTRIEQRGTRWFAQTPRGEFSADKLVVTAGAWAGQLAEQV
FT                   GERVPVHPEGLMLMVTHRVAPFCRATLGATGRPLSFKQFDNGTVVIGGRLIGIADLHGR
FT                   HGEVDFARLVRSANTVVDLFPHLRHLGVNRAWAGVEAFTDDALPVLSPSRRASNLVYSF
FT                   GYCGSGFQLGPACGRLVSELVLDGKASLPLDDFAIDRFTRQSVPQPTASTAAY"
FT                   /protein_id="YP_003609181.1"
FT   misc_feature    complement(218211..219305)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5778"
FT   misc_feature    complement(218424..219305)
FT                   /note="FAD dependent oxidoreductase; Region: DAO;
FT                   pfam01266"
FT                   /db_xref="CDD:144747"
FT                   /locus_tag="BC1002_5778"
FT   gene            complement(219343..220773)
FT                   /db_xref="GeneID:9091157"
FT                   /locus_tag="BC1002_5779"
FT   CDS_pept        complement(219343..220773)
FT                   /locus_tag="BC1002_5779"
FT                   /gene_family="HOG000141836" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /codon_start="1"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bph:Bphy_7055 BFD/(2Fe-2S)-binding
FT                   domain-containing protein"
FT                   /db_xref="GI:295680608"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="GeneID:9091157"
FT                   /translation="MPADHAVETVSSFPSEAVDVVVVGAGPAGMSAATRAASAGLSVVL
FT                   LDEQDAVGGQIYRAIGRADARRKEILGPDYAAGASLADAFSRSGARHVAHASVWQVTRE
FT                   HAVHYLRDGKVGSFDARRVILATGALERPFPIPGWTLPGVLTAGAAQILLKSAGEVPAE
FT                   PPVLAGCGPLLYLLGWQYVRAGVPIRALVDTTRHEDRWRAKKHLLSALRAWPFLSKGLQ
FT                   LIRTLRAAGVPIYEAADDLRVESKQDAQGVERAAALSFSTQGRAQRIDANVILLHQGVV
FT                   PNTQFTLSLRAHHHWDAAQLCFAPTTDAWGELDVPGIFVAGDGGGIGGALAAAEQGALA
FT                   ALRVASQLGAIDAAACEREAEPHRRALESVMRIRPFLDSLYRPRDANRIPRDDVVVCRC
FT                   EEVTAGDVRGFVELGCLGPNQAKSFGRCGMGPCQGRMCGLTVTEIIADARKVPPGEVGY
FT                   YRIRPPIKPLTLGELAGE"
FT                   /protein_id="YP_003609182.1"
FT   misc_feature    complement(<219346..220647)
FT                   /note="sarcosine oxidase, alpha subunit family,
FT                   heterotetrameric form; Region: soxA; TIGR01372"
FT                   /db_xref="CDD:162324"
FT                   /locus_tag="BC1002_5779"
FT   gene            complement(220763..221104)
FT                   /db_xref="GeneID:9091158"
FT                   /locus_tag="BC1002_5780"
FT   CDS_pept        complement(220763..221104)
FT                   /locus_tag="BC1002_5780"
FT                   /gene_family="HOG000141947" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_7054"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7054 hypothetical protein"
FT                   /db_xref="GI:295680609"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="GeneID:9091158"
FT                   /translation="MTPTPLFKALPGADAPVDIWFNDQPLRVPGGRSVAAALLAAGIAR
FT                   FRATPVSGAPRAPYCMMGACFECLVEIDGVPSRQSCMVTVRAGMRIRSQEGARDLPPVD
FT                   VSLEDAHAR"
FT                   /protein_id="YP_003609183.1"
FT   misc_feature    complement(<220823..220918)
FT                   /note="NADH dehydrogenase subunit G; Validated; Region:
FT                   PRK07860"
FT                   /db_xref="CDD:169133"
FT                   /locus_tag="BC1002_5780"
FT   gene            complement(221112..222248)
FT                   /db_xref="GeneID:9091159"
FT                   /locus_tag="BC1002_5781"
FT   CDS_pept        complement(221112..222248)
FT                   /locus_tag="BC1002_5781"
FT                   /gene_family="HOG000267070" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bph:Bphy_7053 FAD dependent oxidoreductase"
FT                   /db_xref="GI:295680610"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:9091159"
FT                   /translation="MIRHASDNPDVLVLGGGLVGSAVAWGLAREGANVTVLDQDDGAFR
FT                   ASRGNFGLVWIQGKGYGLSPYARWSRSSASRWPSLAAALLDETGIDVALRQPGGFHFFF
FT                   SEDEIAERAKRLGALQRELGDYPYQLLDAREVRERIPEIGPDVIGASYTPMDGHVNPLK
FT                   LLRALHAGMQRHGVKLVNNEEALRITPEHGGFTVQGKRGTYRAARVVLAAGLGNRALAP
FT                   HVGLRAPVAPNRGQVLISERVAPFLRYPTLNVRQTDEGTLQFGDSMEEVGFDDFTTTPV
FT                   LSDIARRGVRAFPLLKNVRLVRTWAALRVYSPDGFPIYDESARHPGAFAVTCHSGVTLA
FT                   AAHALRIAPWIAGGAMPDEIPALSGTRFLESPALTPAH"
FT                   /protein_id="YP_003609184.1"
FT   misc_feature    complement(221187..222164)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5781"
FT   misc_feature    complement(221337..222164)
FT                   /note="FAD dependent oxidoreductase; Region: DAO;
FT                   pfam01266"
FT                   /db_xref="CDD:144747"
FT                   /locus_tag="BC1002_5781"
FT   gene            complement(222245..223042)
FT                   /db_xref="GeneID:9091160"
FT                   /locus_tag="BC1002_5782"
FT   CDS_pept        complement(222245..223042)
FT                   /locus_tag="BC1002_5782"
FT                   /gene_family="HOG000263700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_7052
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680611"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091160"
FT                   /translation="MKQNGLWGLLFNALFLTFILAPLVAVMLVAFTDKGFISMPFDGAS
FT                   LRWFRAILENDDIVSAFWLSVRLAFVAATIGVALAVPAALAIARYRFAGRGALMSFFLS
FT                   PMMIPAVVLGIAFLRFLSLLHLSGSFWALAATHVIVVLPYGLRLALSSAVGLDRDAERA
FT                   ALSCGASRFTAFRRVVLPMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYN
FT                   QIAQTIDPLVASVSAVLIVGTVLLMVLLDRMVGLDRILIGEAR"
FT                   /protein_id="YP_003609185.1"
FT   sig_peptide     complement(222950..223042)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.389 at
FT                   residue 31"
FT                   /locus_tag="BC1002_5782"
FT   misc_feature    complement(222308..222859)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5782"
FT   misc_feature    complement(order(222314..222319,222326..222331,
FT                   222335..222340,222347..222352,222380..222385,
FT                   222422..222427,222434..222445,222464..222466,
FT                   222473..222478,222518..222520,222569..222571,
FT                   222578..222583,222593..222595,222599..222604,
FT                   222611..222613,222617..222619,222623..222628,
FT                   222695..222700,222707..222736,222740..222751,
FT                   222779..222781,222794..222799,222806..222811))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5782"
FT   misc_feature    complement(order(222428..222445,222695..222733))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5782"
FT   misc_feature    complement(order(222350..222352,222380..222382,
FT                   222389..222391,222425..222427,222641..222643))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5782"
FT   misc_feature    complement(order(222497..222499,222509..222514,
FT                   222530..222568))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5782"
FT   gene            complement(223047..223919)
FT                   /db_xref="GeneID:9091161"
FT                   /locus_tag="BC1002_5783"
FT   CDS_pept        complement(223047..223919)
FT                   /locus_tag="BC1002_5783"
FT                   /gene_family="HOG000263581" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_7051
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680612"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091161"
FT                   /translation="MATLDESRAGAAPWLLSSPALLLFGALLLVPLVLTLLLSFRVFSD
FT                   VAGVQAAYTLKNYVEVLSDPYYGEIFLRTVGLALAVTLLSVLLGVPETIVLARMKRPWQ
FT                   SLCLLIVLGPLLISVVVRTLGWQILLGNNGVLNNALQAFHITSEPIRLVFTMTGMIIAL
FT                   THVLVPFMVISVWATLQKLDPHVEWAGMSMGGSPLRVFRRVVLPQIMPGVLSGSIIVFA
FT                   LSASAFATPALIGGRRLKVVATAAYDEFLGTLNWPLGASIAVLLLIANVAIVMGCSRLA
FT                   ERRFKHIFE"
FT                   /protein_id="YP_003609186.1"
FT   misc_feature    complement(223101..>223475)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5783"
FT   misc_feature    complement(order(223149..223151,223179..223181,
FT                   223188..223190,223224..223226,223443..223445))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5783"
FT   misc_feature    complement(order(223101..223106,223113..223118,
FT                   223125..223130,223134..223139,223146..223151,
FT                   223179..223184,223221..223226,223233..223244,
FT                   223263..223265,223272..223277,223317..223319,
FT                   223368..223370,223377..223382,223392..223394,
FT                   223398..223403,223410..223412,223419..223421,
FT                   223425..223430))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5783"
FT   misc_feature    complement(order(223296..223298,223308..223313,
FT                   223329..223367))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5783"
FT   gene            complement(223906..224976)
FT                   /db_xref="GeneID:9091162"
FT                   /locus_tag="BC1002_5784"
FT   CDS_pept        complement(223906..224976)
FT                   /locus_tag="BC1002_5784"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7050 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:295680613"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091162"
FT                   /translation="MTFLTLQGISKRYGHFTAVEQLDLSVERGEFLSLLGPSGCGKTTT
FT                   LQMIAGFVTPSAGRITLGGRDITHERPEKRGMGVVFQSYALFPHMTVACNVGFGLEMRN
FT                   MKRDERAVRITEALDLVRLNGLDARYPKELSGGQRQRVAIARALAMRPNLLLLDEPMSN
FT                   LDAKLREEMHIELRAIQKRLGITTILVTHDQVEAMTMSDRIAVLHKGRIAQLSTPFDAY
FT                   ERPATPFASTFLGRTNTLPGEVRERNPRCAVVDVAGTTLHVPHEGRDVEGAVHVYIRPE
FT                   KVRLANGDARMHGRIANRVFIGNQWLLEVDTALGKLHIAQPNFGAPPPDEGHEVGLSFT
FT                   DDDLRVLTRERAHGNA"
FT                   /protein_id="YP_003609187.1"
FT   misc_feature    complement(223930..224976)
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224272..224967)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224848..224871)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(order(224401..224403,224500..224505,
FT                   224731..224733,224845..224853,224857..224862))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224731..224742)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224548..224577)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224500..224517)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224482..224493)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(224395..224415)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="BC1002_5784"
FT   misc_feature    complement(223936..224145)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="BC1002_5784"
FT   gene            complement(225042..226106)
FT                   /db_xref="GeneID:9091163"
FT                   /locus_tag="BC1002_5785"
FT   CDS_pept        complement(225042..226106)
FT                   /locus_tag="BC1002_5785"
FT                   /gene_family="HOG000141614" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bph:Bphy_7049 extracellular solute-binding protein"
FT                   /db_xref="GI:295680614"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9091163"
FT                   /translation="MQESPRRRCRSTLRALVSALSVVCLTAPFHVHAETTLYVANVGGS
FT                   NEQLYRQKVIPPFEKAHDVKIVYVAGNSSDTLAKLQAQKGHQQINVAVMDDGPMYQAMQ
FT                   LGLCAKVEDAPVMKDLYPLARLGPTAVGVGMVATGIGYNEEAFRKLGLPAPDSWQALTD
FT                   KRLKGKLGVPPMTNTYGLHTLVMLARLNGGGEKNIDPGFNAMTKQVAPNVLSWAPTPGE
FT                   MDGLMQSGDVIMAPYGSGRAVALQNTGFPLKFVYPKEGGVALQVAACALAENAQPKLSQ
FT                   EFIQYLLSPEVQAMQAQAIGLGPVNKTVKLTPEFAARVPYGPEQVRKLTAMDWATINQH
FT                   RTEWTERWNRSVER"
FT                   /protein_id="YP_003609188.1"
FT   sig_peptide     complement(226005..226106)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 34"
FT                   /locus_tag="BC1002_5785"
FT   misc_feature    complement(225057..226091)
FT                   /note="Spermidine/putrescine-binding periplasmic protein
FT                   [Amino acid transport and metabolism]; Region: PotD;
FT                   COG0687"
FT                   /db_xref="CDD:31031"
FT                   /locus_tag="BC1002_5785"
FT   misc_feature    complement(225051..225947)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5785"
FT   gene            226242..227195
FT                   /db_xref="GeneID:9091164"
FT                   /locus_tag="BC1002_5786"
FT   CDS_pept        226242..227195
FT                   /locus_tag="BC1002_5786"
FT                   /gene_family="HOG000233527" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bph:Bphy_7048 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680615"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091164"
FT                   /translation="MNLKHVEAFRAVMVAGSMTAAAKALFTSQPNVSRLISQLERETGL
FT                   LLFQRSGVRLIPTSEGTAFFREVERAYVGLQGLTNAAAQIRNLGSGRLRIAAMPSAGLT
FT                   LVPHAIKRFQALHPGVTVSLHVNTSGTVNHWTASQFCDLGVAVYISEASNCEVEMLSKV
FT                   AAVCVMPAVHRLASKAVIRPADLEGESFISLCHGDGTRAQMDEVFVRAGVERKLAIEAQ
FT                   YTAICCELVRCGMGVTLAHPGVALDFVGPDIAIRPFSPAVMFPMYLLFPPHRPRERLAS
FT                   AFIEVLRDEHDELMEKMARIVPDSTPKKTRKRSVKR"
FT                   /protein_id="YP_003609189.1"
FT   misc_feature    226245..227147
FT                   /note="DNA-binding transcriptional regulator LysR;
FT                   Provisional; Region: PRK11013"
FT                   /db_xref="CDD:170885"
FT                   /locus_tag="BC1002_5786"
FT   misc_feature    226248..226424
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5786"
FT   misc_feature    226515..227102
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5786"
FT   misc_feature    order(226560..226565,226569..226574,226581..226583,
FT                   226593..226595,226599..226619,226893..226910,
FT                   226926..226931,226935..226940)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5786"
FT   gene            complement(227231..228100)
FT                   /db_xref="GeneID:9091165"
FT                   /locus_tag="BC1002_5787"
FT   CDS_pept        complement(227231..228100)
FT                   /locus_tag="BC1002_5787"
FT                   /gene_family="HOG000162429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sen:SACE_2761 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680616"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091165"
FT                   /translation="MLFSEEINTFLAVVRSGSLLQAAEIVSTTQSTVSYRIQSLERRLG
FT                   HPLLRRSRGARGISLTAEGERFLDIAERWKMLEIEAEQLQANQVRHLAVGSVDAVAINV
FT                   LPPFVAALSDETPPVRLHMESSRYFQLANRVVSGHLDVAFTLTPSEHVDLVSRKIRDYA
FT                   MFVVYAASGSAPLPEVLDMTDLDPSREIHLPWSPQFDLWRARRGFSRHVNWVEKAHMLA
FT                   PMLRNGAWAIVPAFLTTPLAKETGCTIHRIALNPPDPLSLFMILRKQSGDPNARLQQLI
FT                   EMALTALK"
FT                   /protein_id="YP_003609190.1"
FT   misc_feature    complement(227234..228088)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5787"
FT   misc_feature    complement(227906..228076)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5787"
FT   misc_feature    complement(227249..227830)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5787"
FT   misc_feature    complement(order(227420..227425,227429..227434,
FT                   227462..227464,227726..227746,227750..227752,
FT                   227762..227764,227771..227776,227780..227785))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5787"
FT   gene            228223..229614
FT                   /db_xref="GeneID:9091166"
FT                   /locus_tag="BC1002_5788"
FT   CDS_pept        228223..229614
FT                   /locus_tag="BC1002_5788"
FT                   /gene_family="HOG000077075" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sen:SACE_4733 major facilitator superfamily sugar
FT                   transporter"
FT                   /db_xref="GI:295680617"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091166"
FT                   /translation="MGKALVGIEDLPPSRFHKRIALVAAGGPFCDGYLLGIIVVALPFI
FT                   AKDLALNALQIGLIGASSLIGMFAGGLVFGPMTDRFGRQKMYVLNLAVFVICSLAHLFV
FT                   HDVTTLFILRFVMGVALGADYPIATALAAEFLPRKLRGPVLASLVLLLWVGYTISLATG
FT                   LIVSGSESGVWCYILASAAIPSAIFLLLRLNIPESPRWLIAAGRVDAARGIVAQHLGPQ
FT                   VDFEALVAETRVSTSGRGLGLSKIREVLSRGYGRMLVFCSIFWMCQIAPSFAIKTFQPM
FT                   LLKSLGVTQPLAGSLVIISFAIVGTAIGMFVVNRVGRRTLCLVSFVLATLALFLLATPM
FT                   SNIATVAIGLFVLFTVAEAAGSGLQFIYPNEIFPTDLRATGMGLAMSASRIGAASGTFL
FT                   LPTVLVHFGSATGLLIAGGISLIGLLVSVRMAPETRDVSLGAANAPSMAASASEHSLQR
FT                   REARS"
FT                   /protein_id="YP_003609191.1"
FT   misc_feature    228283..229434
FT                   /note="Sugar (and other) transporter; Region: Sugar_tr;
FT                   pfam00083"
FT                   /db_xref="CDD:143864"
FT                   /locus_tag="BC1002_5788"
FT   misc_feature    228286..>228801
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5788"
FT   misc_feature    order(228325..228327,228334..228342,228346..228351,
FT                   228400..228402,228409..228414,228421..228423,
FT                   228433..228438,228442..228447,228583..228588,
FT                   228595..228600,228607..228612,228619..228621,
FT                   228655..228660,228667..228672,228688..228690)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5788"
FT   misc_feature    <228988..229446
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5788"
FT   gene            229721..230836
FT                   /db_xref="GeneID:9091167"
FT                   /locus_tag="BC1002_5789"
FT   CDS_pept        229721..230836
FT                   /locus_tag="BC1002_5789"
FT                   /gene_family="HOG000162430" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   swi:Swit_3583 FAD dependent oxidoreductase"
FT                   /db_xref="GI:295680618"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:9091167"
FT                   /translation="MNSAPKVIIIGAGIIGTTLAYDFAKRGARVTVLDKSEVARGATSG
FT                   SFAWITNQTKFRNADSLGEVGAQHYFNLHRLSHLRWRYLQSEIDGLPIRWSGCFQSAEP
FT                   GTEEARELAAELDRRLRWGSPTYRVTAAEAREIEPGFEPGAETDIFYTPDEGMMSPVQL
FT                   TSRMLDAAVGHGAQYSPHDAYLGFAKTAGGYEIQSGSGKREADILIFAGGIANPELVEG
FT                   TGLKAPLIHSTGSVVHLAPLPRIFDSVILGAHVHAIQRIDGRVVIARHFSGSPVGDPGT
FT                   PDPEELVRVAARVLPGLKDAVVEKVTETRRVIPADGLPVVSRSEDLPGVLSITTNAGIS
FT                   LAAGLSQFITTELLDGVMVNLMDPYRSQRFA"
FT                   /protein_id="YP_003609192.1"
FT   misc_feature    229772..230644
FT                   /note="FAD dependent oxidoreductase; Region: DAO;
FT                   pfam01266"
FT                   /db_xref="CDD:144747"
FT                   /locus_tag="BC1002_5789"
FT   misc_feature    229790..230788
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5789"
FT   gene            complement(231250..232455)
FT                   /db_xref="GeneID:9091168"
FT                   /locus_tag="BC1002_5790"
FT   CDS_pept        complement(231250..232455)
FT                   /locus_tag="BC1002_5790"
FT                   /gene_family="HOG000129597" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:HCH_01946"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hch:HCH_01946 hypothetical protein"
FT                   /db_xref="GI:295680619"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9091168"
FT                   /translation="MKLLPKQLNTRLQLRKQLRRASGFQIAIAHRLRQLNVEDWRTVTA
FT                   AQSFYFSPEYLQMIEVAGPANLEPRYALISDDDGPRAAVCMQIVQVSLEHFGEPGKRKL
FT                   KVPLTERILVCGNLLSYGQHGVCFAPGSTPAELWPAVADALYRTRRCEKLDGQTNLIVV
FT                   KDILEADKEPSACLGKLSYSAVETEPNMVLTLPEGVHTHADYLANLASKYRNAVKSQIY
FT                   KPFDAAGFRMERLDDVASVTGHLQDLYLQTHTNARLRPFMLDQEYWPALAAAAGARIVF
FT                   HVAVKGSHIYGFVVTLKDADTAVVWHIGFDREAATNGVPLYLRLLHASLTQSIDFGCRR
FT                   VSFGRTALAPKARIGCRPEPMQVWVRHRQPLLNRAISPLLRLIQHEDAPEYSPFKKDNQ
FT                   PL"
FT                   /protein_id="YP_003609193.1"
FT   misc_feature    complement(231265..>231867)
FT                   /note="FemAB family; Region: FemAB; cl11444"
FT                   /db_xref="CDD:159456"
FT                   /locus_tag="BC1002_5790"
FT   gene            232973..233197
FT                   /db_xref="GeneID:9091169"
FT                   /locus_tag="BC1002_5791"
FT   CDS_pept        232973..233197
FT                   /locus_tag="BC1002_5791"
FT                   /gene_family="HOG000162431" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0119 hypothetical protein"
FT                   /db_xref="GI:295680620"
FT                   /db_xref="GeneID:9091169"
FT                   /translation="MSMSLASFCRLAVLHPFEFVRQRAQARPVPSIPEHTWKDDPERLE
FT                   RIARYARAGYFNITVTSDSCQIIGEIAPD"
FT                   /protein_id="YP_003609194.1"
FT   gene            233230..234351
FT                   /db_xref="GeneID:9091170"
FT                   /locus_tag="BC1002_5792"
FT   CDS_pept        233230..234351
FT                   /locus_tag="BC1002_5792"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0126 hypothetical protein"
FT                   /db_xref="GI:295680621"
FT                   /db_xref="InterPro:IPR018245"
FT                   /db_xref="GeneID:9091170"
FT                   /translation="MSDVVIEQPAVVEAALNHLVATGEKPATYAYDPPAGVPQRSGVYR
FT                   TQRLNIVNARVSPPPGGLSLDRNGFELRQHASVLSDFKDPAAIERIYYPESEALLRGWT
FT                   GAKRAVIPITRFATAMRRVPAPCASRSSSFTTTRPSCRVRAACAIPCRRMKRKTAQGEG
FT                   GDRQPVASHRIDGRIVAAGVERCAQYCADRSGAVGSDLSGQSRRDLCVRAVDSRNRRHY
FT                   SQSSRVRGRTRCAIRGRAQLRSFDRTGGPTTQHRRTKCSVRNQQARRQASTPLARARCP
FT                   CGYPACRAAHGQARCVDPVNADPTARQCGGLCGSQQARADRLGGADQTRGLRCRASGAR
FT                   ELIHPSSTHRQRAPQGQKSDISNEPGSDITKKS"
FT                   /protein_id="YP_003609195.1"
FT   gene            complement(234580..235293)
FT                   /db_xref="GeneID:9091171"
FT                   /locus_tag="BC1002_5793"
FT   CDS_pept        complement(234580..235293)
FT                   /locus_tag="BC1002_5793"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bph:Bphy_7685 integrase catalytic region"
FT                   /db_xref="GI:295680622"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:9091171"
FT                   /translation="MWIDIDRLFNGRHFDREVIILCVRWYLRYKLSFRDLVEIMAERGL
FT                   SLAHTTIMRWVKRFTPEFVKRWDRFAKSAGRSWRVDETYVKVRGKWGYLCRAVDRAGKT
FT                   VDFRLSAKRDVAAAKAFFAKAIRAQGFAPKTITLDGYAASHRAVREMKADQFLPADTTL
FT                   RSSKYLNNLIEQDHRNIKSRVNAMLGFKLFGNAAVTISGVELMHRIRKGQFNLARLRLK
FT                   DTTAPAVWNAVLFAR"
FT                   /protein_id="YP_003609196.1"
FT   misc_feature    complement(234646..235272)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="BC1002_5793"
FT   gene            complement(235441..237399)
FT                   /db_xref="GeneID:9091172"
FT                   /locus_tag="BC1002_5794"
FT   CDS_pept        complement(235441..237399)
FT                   /locus_tag="BC1002_5794"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1960 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:295680623"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="GeneID:9091172"
FT                   /translation="MKSLISFIDRLPIARKLLLLGILILPTIGVPTYLQLKSSLNAVSA
FT                   ASTEQAGLESARALLSLIQLTLQHRAQAATLLGGNNTVAASREATRAAVDQAIARIDQD
FT                   QKARMRRTDMMRAWESAVENWREIAAAVDARKLSDKESTMRHTEIIEQYFSILDLLLDD
FT                   TGLALDSEVGTHYLVRAALVSLPKATATLSLTRSRGAGILARGEASPTERAMLASLANA
FT                   GSNQADDLGKAFDKAFHAEPELSAALADELDRANTSIRAALDLATREIVSADAIHYAAI
FT                   DYIKTFTGALDPLFALEARALDSLKAQLDLRSNRVHRAMLVQVGLLGMMLLIAIVLSSI
FT                   VVRRITGPLRNALALANRVADGDLTSHIEVATTDETGQLMQALKAMNSSLASMVARIRT
FT                   GAETISTGSAQIAAGNTDLSSRTEEQAASLEESAANMIQLTSTVRHNTESARQGNTLAA
FT                   HASEIAARGGEVVGRVVHTMRDISNSSTKVANITATIESIAFQTNILALNAAVEAARAG
FT                   EQGRGFAVVASEVRNLAQRAATAAKEIKDLINESVDHVTAGTEHVDEAGRTINEVVSAV
FT                   RRVADLMGEIAAASDEQHKGIEQVNSAVVQMDQVTQQNAALVEQATAAAQSMSEQAVLL
FT                   KRAVDVFKVSDEYLVAS"
FT                   /protein_id="YP_003609197.1"
FT   misc_feature    complement(236242..236403)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="BC1002_5794"
FT   misc_feature    complement(235471..236211)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="BC1002_5794"
FT   misc_feature    complement(235468..235971)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="BC1002_5794"
FT   gene            complement(237396..237638)
FT                   /db_xref="GeneID:9091173"
FT                   /locus_tag="BC1002_5795"
FT   CDS_pept        complement(237396..237638)
FT                   /locus_tag="BC1002_5795"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4706 type II and III secretion system
FT                   protein"
FT                   /db_xref="GI:295680624"
FT                   /db_xref="GeneID:9091173"
FT                   /translation="MHVPHEKAFDLLAQVKAGRTTRVTDIRPGQGGRIKGPLPPASGDA
FT                   HAGKDKALPAPGIRTTRFGAPLRADRFRNACSRKS"
FT                   /protein_id="YP_003609198.1"
FT   gene            complement(237687..237917)
FT                   /db_xref="GeneID:9091174"
FT                   /locus_tag="BC1002_5796"
FT   CDS_pept        complement(237687..237917)
FT                   /locus_tag="BC1002_5796"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GH12095 gene product from transcript
FT                   GH12095-RA ; K04514  Rho-associated, coiled-coil containing
FT                   protein kinase"
FT                   /db_xref="GI:295680625"
FT                   /db_xref="GeneID:9091174"
FT                   /translation="MSSQLLTGVRVSQALAQPQVAHRELTMTLLIDDPERDSITVTRSG
FT                   FQVDGAHSRSRTGGRRSGSTTTKSCLKPGSR"
FT                   /protein_id="YP_003609199.1"
FT   gene            complement(238061..239215)
FT                   /db_xref="GeneID:9091175"
FT                   /locus_tag="BC1002_5797"
FT   CDS_pept        complement(238061..239215)
FT                   /locus_tag="BC1002_5797"
FT                   /gene_family="HOG000114656" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /codon_start="1"
FT                   /product="porin Gram-negative type"
FT                   /transl_table="11"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_C1012
FT                   OmpC family outer membrane porin"
FT                   /db_xref="GI:295680626"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="GeneID:9091175"
FT                   /translation="MNLKSPNAVLRRSAALASLAALLFGAQAAHAQSSITLYGIISTGV
FT                   GWVSNVGGSSSVQMIAGTMQNNRWGLRGVEDLGGGLNAIFVLENGFDITNGKFQQGGRM
FT                   FGRQAYVGLSDKSWGTVTLGRQYDIPFDYLDRFEAPVAALGLAAHIGDNDNLFGSYRYN
FT                   NSIKYQSPTVNGLRGSVMYAMSNAAGQWAVNRSVSAGVAYDNGPLKLALVGLNTNYPGP
FT                   TLNPNGAVTDDYIGPPFLLFHTSPINRNAGVSRQREFGGGAQYTFSKLRLTGLVTDVRY
FT                   DYLDHTSLHLDNFDVNATYDITPFLVLGAAYVYTKGQYGGGIDAAPHWNMGQISINYLL
FT                   SKRTNVYVFTNYQRATDAKAVTYLLAPSSNGSQTVVVAGIRHLF"
FT                   /protein_id="YP_003609200.1"
FT   sig_peptide     complement(239120..239215)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT                   /locus_tag="BC1002_5797"
FT   misc_feature    complement(238064..239119)
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_5797"
FT   misc_feature    complement(order(238064..238066,238070..238072,
FT                   238076..238078,238184..238186,238193..238198,
FT                   238724..238729,238733..238735,238841..238849,
FT                   238877..238891,238895..238900,238934..238945,
FT                   238949..238951,238955..238963,238967..238969,
FT                   238985..238999,239081..239089,239093..239095,
FT                   239111..239113,239117..239119))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_5797"
FT   misc_feature    complement(order(238733..238735,238802..238804,
FT                   238895..238897,239012..239014,239096..239098))
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="BC1002_5797"
FT   gene            complement(239341..240966)
FT                   /db_xref="GeneID:9091176"
FT                   /locus_tag="BC1002_5798"
FT   CDS_pept        complement(239341..240966)
FT                   /locus_tag="BC1002_5798"
FT                   /gene_family="HOG000221401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: mjl:Mjls_3790
FT                   3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="GI:295680627"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:9091176"
FT                   /translation="MSKTADVLIIGAGPVGLMLANLLGQQGVNVLLVEKSETLIDYPRA
FT                   VGIDDEALRAMQTAGLVDEVLPHTIPDQKIYMVNGDRQILSEVNPTTREFGWPRRNGFV
FT                   QPLVDRVLLDGLKRFPNTAVRFSTEVVDLLEDGEGVVATTERGEKLRARYVVAAEGGSS
FT                   RTRTQLGISFDGETRPSAGIVIDVANDPIGTPHAVFGGDPKRSYASIALPHGIRRWEFT
FT                   LFESEDPSLVENDDYIHALLAPHVPDPTKLEIIRRRVYRHHARVAGQFRVGSIFLAGDA
FT                   AHVMPVVGGQGWNSGIRDAFNLAWKLGAVINGACGDALLETYEMERMGHVKQMVAVSLG
FT                   MAKEMTDHDPAKAAERDRIAANRTPEEREAQKRQAFKPQPKFDKGVVVHTPLPSFKTLP
FT                   ARDVPRMAGAIFPQPRVTNAEGVEMLLDDATGQGWRVLMWNNNPMAFISAERCAALAHL
FT                   RVRLVQVVPKAQLPWARRHAPVGVTVIGDLGGEPSLQAWFDARPVGAVVVRPDHVVAAE
FT                   CLAQELDDVLARVLDVTHFCLPQQ"
FT                   /protein_id="YP_003609201.1"
FT   misc_feature    complement(239347..240957)
FT                   /note="3-(3-hydroxyphenyl)propionate hydroxylase;
FT                   Validated; Region: mhpA; PRK06183"
FT                   /db_xref="CDD:168446"
FT                   /locus_tag="BC1002_5798"
FT   misc_feature    complement(<240454..>240648)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5798"
FT   misc_feature    complement(239977..>240138)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5798"
FT   gene            complement(240963..241733)
FT                   /db_xref="GeneID:9091177"
FT                   /locus_tag="BC1002_5799"
FT   CDS_pept        complement(240963..241733)
FT                   /locus_tag="BC1002_5799"
FT                   /gene_family="HOG000179751" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /codon_start="1"
FT                   /product="HpcH/HpaI aldolase"
FT                   /transl_table="11"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: dsh:Dshi_3145
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="GI:295680628"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="GeneID:9091177"
FT                   /translation="MKTAALASGPKILVHQTLPSFSIPEWAKVAGYDGVILDLQHGELG
FT                   LDAACGILRSIPRDNAYAWARVGSTDPGQILRLLDSGARGIVAPTIESREQAQALVAAT
FT                   KYLPIGNRSMGPSRPGLYIGDSYAEAGNLAVSTIAQIETRIGVERAEEIISTPGLDSIY
FT                   IGPADLAVSYGLPGRGDWDDGPVRDAIVHLRELTQAHGVTLGIYSGKSAYTSALLADGL
FT                   VDYVAFGIDLVLLNRAFGENINELKTALSTRNRP"
FT                   /protein_id="YP_003609202.1"
FT   misc_feature    complement(240993..241733)
FT                   /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
FT                   [Carbohydrate transport and metabolism]; Region: HpcH;
FT                   COG3836"
FT                   /db_xref="CDD:33628"
FT                   /locus_tag="BC1002_5799"
FT   misc_feature    complement(241020..241730)
FT                   /note="Malate synthase catalyzes the Claisen condensation
FT                   of glyoxylate and acetyl-CoA to malyl-CoA , which
FT                   hydrolyzes to malate and CoA. This reaction is part of the
FT                   glyoxylate cycle, which allows certain organisms, like
FT                   plants and fungi, to derive their...; Region: malate_synt;
FT                   cl09155"
FT                   /db_xref="CDD:175021"
FT                   /locus_tag="BC1002_5799"
FT   gene            complement(241730..242191)
FT                   /db_xref="GeneID:9091178"
FT                   /locus_tag="BC1002_5800"
FT   CDS_pept        complement(241730..242191)
FT                   /locus_tag="BC1002_5800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swi:Swit_4128 hypothetical protein"
FT                   /db_xref="GI:295680629"
FT                   /db_xref="GeneID:9091178"
FT                   /translation="MSNYCPVDAVTRVEIEQLISEMLYRLDHNQADTTWELYTEDGVSV
FT                   GPLGTMNREQSKIWGAKRVKQADIVSRHFIGGVRLVWDGDEVAGTVQYLTFRDTNEPQT
FT                   QPASVGEFRERYRKVDGQWRFARREIVPVFGGNAAAAHAARLTESGSKP"
FT                   /protein_id="YP_003609203.1"
FT   misc_feature    complement(241799..242161)
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="BC1002_5800"
FT   gene            complement(242213..243016)
FT                   /db_xref="GeneID:9091179"
FT                   /locus_tag="BC1002_5801"
FT   CDS_pept        complement(242213..243016)
FT                   /locus_tag="BC1002_5801"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /codon_start="1"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /transl_table="11"
FT                   /note="KEGG: rer:RER_57560 2-hydroxypenta-2,4-dienoate
FT                   hydratase; manually curated; PFAM: fumarylacetoacetate
FT                   (FAA) hydrolase"
FT                   /db_xref="GI:295680630"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9091179"
FT                   /translation="MTTMTIPSETIQSIARELYDARVGVYTVPYVSPRLPERDLDTAYA
FT                   ISAEFAALRERNLGVRRVGRKVGLTNPNVQKRVGISEPDYGVIHDDMVFQSGAVLPKSR
FT                   YNRLLIEAEVAFVLKSDIFDATLERVAAAIDYVTPAFEVVDFRYGGSVGQIVDTIADNA
FT                   GCSGIVVGEEKHPYGSVDLKAVEMVITGGGKEITRGVGSNVLGDPINAVLWLADTAIRT
FT                   GQPLRAGEVLLSGSIGYIEPWPADVECVATITGLGRVVASVDSNA"
FT                   /protein_id="YP_003609204.1"
FT   misc_feature    complement(242231..242995)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="BC1002_5801"
FT   gene            complement(243024..243899)
FT                   /db_xref="GeneID:9091180"
FT                   /locus_tag="BC1002_5802"
FT   CDS_pept        complement(243024..243899)
FT                   /locus_tag="BC1002_5802"
FT                   /gene_family="HOG000028063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pay:PAU_02359
FT                   hypothetical protein"
FT                   /db_xref="GI:295680631"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:9091180"
FT                   /translation="MNRLVTFWEAVSDLPHRLHYVDVGPWRTRVLDLGEGDRVVVLANG
FT                   TSGHIEAWTQNVRALVQAGYRVIGYDYPGHGYTTLTDHDLEIPEYESHLLGLLDVLNLK
FT                   RVHLAGESLGGWVAVKFAAHHSNRLLSVILSAPGGRVVGEQKVDKAQSVSKQAVTEPTF
FT                   ENVKKRLQVVIHDPQKITEELVRVRQAIYSRDPSGTNMAHISVLRQPEQRWRNRVTDQD
FT                   FAAIPVPALFVWTDHEPTGDASEGRRLAALIPQGEFLLVEGSAHWPQWEGAEVFNAAAI
FT                   SFLDKQHRQS"
FT                   /protein_id="YP_003609205.1"
FT   misc_feature    complement(243048..243851)
FT                   /note="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase;
FT                   Region: biphenyl_bphD; TIGR03343"
FT                   /db_xref="CDD:132386"
FT                   /locus_tag="BC1002_5802"
FT   misc_feature    complement(<243666..>243788)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5802"
FT   misc_feature    complement(243057..243707)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5802"
FT   gene            complement(243896..244831)
FT                   /db_xref="GeneID:9091181"
FT                   /locus_tag="BC1002_5803"
FT   CDS_pept        complement(243896..244831)
FT                   /locus_tag="BC1002_5803"
FT                   /gene_family="HOG000069851" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.13.11.16"
FT                   /codon_start="1"
FT                   /EC_number="1.13.11.16"
FT                   /transl_table="11"
FT                   /note="KEGG: rha:RHA1_ro00518
FT                   3-(2,3-dihydroxyphenyl)propionate dioxygenase; PFAM:
FT                   Extradiol ring-cleavage dioxygenase class III protein
FT                   subunit B"
FT                   /db_xref="GI:295680632"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="GeneID:9091181"
FT                   /translation="MSLAVAALSHAPSFGNVDPGGTTLAEIMAGIQEVRAFVERFAPEV
FT                   VVVFGPDHFNGQLYSSIAPWVIGAQAEGIGDYGTTEGFINVDGETARQLHAAVLDQGID
FT                   IARSERMTVDHGVMQPVDFLLGKSHARPIVPVFVNAIAFPLTPMKRVREMGEAFGKAAL
FT                   QLGKRVLFIASGGISHSPPIPRWEGAPPELKARLVSYAPTREERRTREQAIVDAIQRIA
FT                   DGKGSSAPLNEAWDTLLLDTFRSGDLSPVDTWDNDQFVIDGGSAAHEMRSWIAAYAALS
FT                   TAGKYKLPVDRYWAVKSWGAGFAVQAGCAA"
FT                   /product="3-carboxyethylcatechol 2,3-dioxygenase"
FT                   /protein_id="YP_003609206.1"
FT   misc_feature    complement(243908..244831)
FT                   /note="Subunit B of Class III Extradiol ring-cleavage
FT                   dioxygenases; Region: Extradiol_Dioxygenase_3B_like;
FT                   cl00599"
FT                   /db_xref="CDD:174303"
FT                   /locus_tag="BC1002_5803"
FT   misc_feature    complement(243920..244822)
FT                   /note="Catalytic LigB subunit of aromatic ring-opening
FT                   dioxygenase; Region: LigB; pfam02900"
FT                   /db_xref="CDD:111754"
FT                   /locus_tag="BC1002_5803"
FT   misc_feature    complement(order(243929..243934,244025..244027,
FT                   244295..244297,244487..244489,244796..244804))
FT                   /note="active site"
FT                   /db_xref="CDD:153371"
FT                   /locus_tag="BC1002_5803"
FT   misc_feature    complement(order(244025..244027,244802..244804))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:153371"
FT                   /locus_tag="BC1002_5803"
FT   gene            complement(244873..246258)
FT                   /db_xref="GeneID:9091182"
FT                   /locus_tag="BC1002_5804"
FT   CDS_pept        complement(244873..246258)
FT                   /locus_tag="BC1002_5804"
FT                   /gene_family="HOG000114541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cgt:cgR_2956 hypothetical protein"
FT                   /db_xref="GI:295680633"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091182"
FT                   /translation="MKISDHIADSPMTSLQLRVVFVSIVLVVLDGYDLTLAAFAAPFIE
FT                   RGFGVSKTQLGMVLSGALIGMLVGSIVVAPIADRMGRRLTGVLATCVIGIGMLIGPFAS
FT                   AERGTMLLVISRIITGVGIGALVAVVGVILSEYTAKRVYPVVMAIYAAAINIGGLLGAM
FT                   LVGPMLATHGWQFGWWVGFVLSVVAAIGTYFLLPESLAWLAEGRRRDSLLQLNRILAKM
FT                   RQPTLTALPESSNPDVKVAGALRTIASTPLLWQTVLMILSYVAYMVSFYFLTTWAPTTV
FT                   ASMNHKPLLAPQLVVAFSVGGIAGNLVFGFIGNRINLRILTPIFLVMAAAAMSYFGIAG
FT                   PAMPGAMWTVFIASFFVCAGTAGFYGIVPLLYPTLARSTGYGVVIGMGRFGGIAAPILG
FT                   GMSFDGGMDMGTAFTLFSLPMLIAAIGLLVLHVGLKRSASRERATLAASSGGKQADRSQ
FT                   QAC"
FT                   /protein_id="YP_003609207.1"
FT   misc_feature    complement(245065..246252)
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="BC1002_5804"
FT   misc_feature    complement(<245668..246171)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5804"
FT   misc_feature    complement(order(245785..245787,245803..245808,
FT                   245815..245820,245854..245856,245863..245868,
FT                   245875..245880,245887..245892,246037..246042,
FT                   246046..246051,246061..246063,246070..246075,
FT                   246082..246084,246133..246138,246142..246150,
FT                   246157..246159))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5804"
FT   misc_feature    complement(244969..>245520)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5804"
FT   gene            246386..247126
FT                   /db_xref="GeneID:9091183"
FT                   /locus_tag="BC1002_5805"
FT   CDS_pept        246386..247126
FT                   /locus_tag="BC1002_5805"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rhi:NGR_b22480 putative short-chain
FT                   dehydrogenase/reductase"
FT                   /db_xref="GI:295680634"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091183"
FT                   /translation="MAEIGDSPRGTEKQKVGIVVAGGSGIGAACVRELAACGWRVVALS
FT                   PSGRGRMLAESLGGAGVDGSNTNIADLRATVDLAIEKFGRIDAVINNSGHAARGTLLDI
FT                   SDDDWLHGVDLYLLSVVRMARIATPHLLASGGGAIVNISTAGAFEPNRMFPISTTLRAA
FT                   LGSFTKLYADEYGPQGIRMNNVLPGFTKDDPAAVPPEWTSKIPLRRAQSTAELARVVRF
FT                   LASDESAYITGQNLRADGGETRSV"
FT                   /protein_id="YP_003609208.1"
FT   misc_feature    246476..247108
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="BC1002_5805"
FT   misc_feature    246479..247114
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5805"
FT   gene            complement(247248..248714)
FT                   /db_xref="GeneID:9091184"
FT                   /locus_tag="BC1002_5806"
FT   CDS_pept        complement(247248..248714)
FT                   /locus_tag="BC1002_5806"
FT                   /gene_family="HOG000221401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bxe:Bxe_C0990
FT                   3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="GI:295680635"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:9091184"
FT                   /translation="MHDVAIIGLGPTGVTLATLLAQQGLRVLAIDREAGIYPLPRAVHF
FT                   DGECMRVFQSIGVADALKSQVRPSPGMKFIDSDGRLLIDWSRDLEIGPMGWYASYRCHQ
FT                   PWLEQTLRQKLAEHAGADIRVKHEMLDCTVASDGVDLRIKDLSTGKALQEKARYVVGCD
FT                   GARSITRGLIEARMDDLQQHEQWIVVDVVLNHERPDLGDYSIQYCDPSRPGTYVRGVGM
FT                   RRRWELMLVPGDDPAIITQPESIWKLLSRWVTPQEATLERPALYTFRAVVARGWRKGRL
FT                   LLAGDAAHLTPPFMGQGMCAGIRDASNLAWKLAAVIRGEAGEDLLNTYESEREPHVREF
FT                   ISTAVRLGHIIQTTDPDVVRRRDKEFAQPELFSTPQPSLGPGAHVGGSLGGRMIPQAVR
FT                   ADGSRTDDDTGYAYSLFVSPVALGAAKALIKDRVPIVAVTEPSLTNWMEASGIVAALVR
FT                   PDRYVAGVAATDRELEQLLQARGADSPICA"
FT                   /protein_id="YP_003609209.1"
FT   misc_feature    complement(247251..248714)
FT                   /note="3-(3-hydroxyphenyl)propionate hydroxylase;
FT                   Validated; Region: mhpA; PRK06183"
FT                   /db_xref="CDD:168446"
FT                   /locus_tag="BC1002_5806"
FT   misc_feature    complement(247743..248714)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5806"
FT   gene            complement(248990..249841)
FT                   /db_xref="GeneID:9091185"
FT                   /locus_tag="BC1002_5807"
FT   CDS_pept        complement(248990..249841)
FT                   /locus_tag="BC1002_5807"
FT                   /gene_family="HOG000063754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /codon_start="1"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_C0991 putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:295680636"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9091185"
FT                   /translation="MKLVSFERQGRVGFGAVIDAGIVDLGQAFNGRYVSLKDLLAADAV
FT                   GEAAELVSGRQADFQMSDVTLLPVIPDPGKIWCCGLNYHEHVQETNREVTEQPTFFLRV
FT                   ASSQVGHEQAIVRPRESTQLDFEAEIAVVIGKGGRRIAPADAAQHIAGYACYNDGSVRD
FT                   WQRHTSQWIPGKNFWRTGGFGPWMVTADEIPFDTRLKMVTRLNGQEMQNTTTDMMIHSI
FT                   AKQIAYVSTIAPLEAGDVIVTGTPGGVGARRHPPVWMKAGDVVEIEVERIGVLRNPIAD
FT                   EQ"
FT                   /protein_id="YP_003609210.1"
FT   misc_feature    complement(248993..249730)
FT                   /note="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway) [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]; Region: MhpD; COG0179"
FT                   /db_xref="CDD:30528"
FT                   /locus_tag="BC1002_5807"
FT   misc_feature    complement(249002..249619)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="BC1002_5807"
FT   gene            complement(250535..251347)
FT                   /db_xref="GeneID:9091186"
FT                   /locus_tag="BC1002_5808"
FT   CDS_pept        complement(250535..251347)
FT                   /locus_tag="BC1002_5808"
FT                   /gene_family="HOG000269037" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0993 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:295680637"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9091186"
FT                   /translation="MSSITRLLSILELFSEAKPFLSAEDVAAELECSAPTAYRYVRELV
FT                   DAGLLVRFTGGEYGLGPRIIRLDYRLRASDPLLAIGQPIMHELSEHSGFDVVMSRWYGN
FT                   ELVDTHRETYDAALDLRYGRGRPRPLFLGAAPKAILSTFPKAKLAILFEQYPEDIAQSG
FT                   LGTTLEEFRASLLKIRRAGFYLSRDELEHGVSALASPLFTDDSSEAVGSLALIIPTQRL
FT                   EFANLERLVESLREAAARTSQRTRAAIESRGTATASLSHTVSPTRRST"
FT                   /protein_id="YP_003609211.1"
FT   misc_feature    complement(251078..251347)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5808"
FT   misc_feature    complement(250646..251344)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="BC1002_5808"
FT   misc_feature    complement(250682..250975)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_5808"
FT   gene            complement(251511..252008)
FT                   /db_xref="GeneID:9091187"
FT                   /locus_tag="BC1002_5809"
FT   CDS_pept        complement(251511..252008)
FT                   /locus_tag="BC1002_5809"
FT                   /gene_family="HOG000288426" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_C0992 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680638"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9091187"
FT                   /translation="MARGEDFYSRVLEFTVTDRGTLQTPHGEVRLAFLSRDPAVHQIVL
FT                   ASGRPEHLAFNPINQISLEADSLDTLRQFHASFVSEGLEEINPVTHGNAISIYARDPEG
FT                   NRLELFIDTPWYVDQPMRVPADFDLPDAQLIAAVERHASGLPGFRPRSDWQAEMAVRMG
FT                   LA"
FT                   /protein_id="YP_003609212.1"
FT   misc_feature    complement(251631..252008)
FT                   /note="The single-domain 2,3-dihydroxybiphenyl
FT                   1,2-dioxygenases (BphC, EC 1.13.11.39) from Rhodococcus
FT                   globerulus P6, BphC2-RGP6 and BphC3-RGP6,  and similar
FT                   proteins; Region: BphC2-C3-RGP6_C_like; cd08348"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5809"
FT   misc_feature    complement(order(251685..251687,251715..251717,
FT                   251736..251738,251823..251825,251829..251831,
FT                   251886..251888,251910..251912))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5809"
FT   misc_feature    complement(order(251685..251687,251829..251831))
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5809"
FT   gene            252223..253074
FT                   /db_xref="GeneID:9091188"
FT                   /locus_tag="BC1002_5810"
FT   CDS_pept        252223..253074
FT                   /locus_tag="BC1002_5810"
FT                   /gene_family="HOG000063754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /codon_start="1"
FT                   /EC_number="5.3.3.10"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0991 putative fumarylacetoacetate
FT                   (FAA) hydrolase; PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:295680639"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9091188"
FT                   /translation="MKLVSFTTHQGSSFGVVRDDSVVDLVKRLDNRYADLKALIAANAL
FT                   GEAAQAAQAGKGDYPLSEVTLLPVIPNPEQIFCVGLNYAEHVKETNRETTEQPVIFMRL
FT                   PASQVGHGQPMLRPPESRQFDYEGEIAVIIGRGGRRIAEADAWNHIAGYACYNDGSVRD
FT                   WQRHTTQWGPGKNFYRTGAFGPWMVTSDEIEPNALMMLVTRLNGQEVQRATTQMLIHGI
FT                   AKQIAYLSTFTPLAPGDVIVTGTPGGVGAKRNPPLFMKPGDRVEVEVDRIGVLSNPIAD
FT                   EA"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /protein_id="YP_003609213.1"
FT   misc_feature    252445..253062
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="BC1002_5810"
FT   gene            253131..254654
FT                   /db_xref="GeneID:9091189"
FT                   /locus_tag="BC1002_5811"
FT   CDS_pept        253131..254654
FT                   /locus_tag="BC1002_5811"
FT                   /gene_family="HOG000221401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bxe:Bxe_C0990
FT                   3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="GI:295680640"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:9091189"
FT                   /translation="MSDKTISMHACDYDVAIIGLGPTGATLANLLAIEGLRVLVLERDK
FT                   DIFALPRAVHFDGECMRVFQSIGLADTLLPKLFVGPGMKFVNAAGQLLIDWSRPTCIGP
FT                   HGWCASYKFHQPDLENALRDRLAGQANIDVRLRHEVFALDETSDGVQLRFEDTSCGKLG
FT                   RATARYVVGCDGARSIARRFMDTELTDLKSHERWVVVDVLLDTPRPDLGDFSIQYCDPA
FT                   RPTTYTRGPGNRRRWEIMVMPGDDATQLGSPEWLWDKLARWISPADARLERSAIYTFHS
FT                   VVANGWRRGRLLLAGDAAHQTPPFMGQGMAAGIRDASNLAWKLAAVIRGTSPDTVLDTY
FT                   ESERSPHVREFIETAVRLGSVIQTTHPEAATSRDIEMSAAIRHFVTPQPKLGPGAYLDA
FT                   SSSAVVGHVAPQPRLADGRLMDDVVGYRFALVALPELLAGCDDIAERAERAGVQIVCDA
FT                   DAVNTWLASTGAAAVLIRPDRYVYGIAHDTASLYSLLEHAFPALQTATA"
FT                   /protein_id="YP_003609214.1"
FT   misc_feature    253155..254651
FT                   /note="3-(3-hydroxyphenyl)propionate hydroxylase;
FT                   Validated; Region: mhpA; PRK06183"
FT                   /db_xref="CDD:168446"
FT                   /locus_tag="BC1002_5811"
FT   misc_feature    253173..>254090
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5811"
FT   gene            254750..256093
FT                   /db_xref="GeneID:9091190"
FT                   /locus_tag="BC1002_5812"
FT   CDS_pept        254750..256093
FT                   /locus_tag="BC1002_5812"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_C0989 major facilitator superfamily metabolite/H(+)
FT                   symporter"
FT                   /db_xref="GI:295680641"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091190"
FT                   /translation="MELSHHPVGAADHSHAAGLSRAQWKMILIASLGGSLEFYDFIVYG
FT                   FFAHHIAAQFFPNASSLISMLAAFSVLAIGYVIRPLGGIVLSSWGDRYGRRPIFLGSII
FT                   VVTTATICLGLLPNFQSWGITASILLILLRMLQGFCVGGEMPGAITYAVEAAPHRAGLA
FT                   AGIIICAVNVGVLLATFVNLGIQSYLSSADAAAYGWRIAFLFGGFCGLLSYWMRRNLDE
FT                   SPEFKEMHGAVARQPFRETLRHHGKAVVAGALTIAVMAGVNGILYGHMPAYLVQQLHYA
FT                   PQTAAIAQNAYLVVSSFGLLAAGWLGDKIARRYLLRTSAALLIVLSYPFYWALANHTVD
FT                   PVVLFVLAAVVFSLASGTWPSVLADQFPVQVRFSGIALAYNISVVVFSGFAPFLATMLV
FT                   RETGSLAAPAYYVVGACAVALLASFALPKASLLPGLWARIESVLPGKE"
FT                   /protein_id="YP_003609215.1"
FT   misc_feature    254828..256030
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5812"
FT   misc_feature    254846..256009
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="BC1002_5812"
FT   misc_feature    order(254870..254872,254879..254887,254891..254896,
FT                   254945..254947,254954..254959,254966..254968,
FT                   254996..255001,255005..255010,255170..255175,
FT                   255182..255187,255194..255199,255206..255208,
FT                   255239..255244,255251..255256,255272..255274,
FT                   255527..255529,255536..255541,255548..255553,
FT                   255560..255562,255602..255604,255614..255616,
FT                   255626..255628,255635..255637,255647..255649,
FT                   255794..255796,255803..255808,255815..255817,
FT                   255827..255832,255839..255841,255872..255877,
FT                   255887..255892,255899..255904,255911..255913)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5812"
FT   gene            256094..256782
FT                   /db_xref="GeneID:9091191"
FT                   /locus_tag="BC1002_5813"
FT                   /pseudo
FT   gene            256945..257505
FT                   /db_xref="GeneID:9091192"
FT                   /locus_tag="BC1002_5814"
FT   CDS_pept        256945..257505
FT                   /locus_tag="BC1002_5814"
FT                   /gene_family="HOG000169129" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BTH_II2352"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: bte:BTH_II2352 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680642"
FT                   /db_xref="GeneID:9091192"
FT                   /translation="MKETNRLPAFDRSIATSEQVAVLDEILSGPRGNLDGPFLSWIHSP
FT                   EFAQRAQRLGAFCRYDTGLPLRLSELAILVTAAHWRSQAEWHIHHPIALKAGLPAEVAE
FT                   SIRCNETPTFDDQDDRLIYDFATQLNETRRVSNETYAQALNRFGHVVIINLTGLLGYYT
FT                   LVAMTLNVFETRTASQIDLPFPE"
FT                   /protein_id="YP_003609216.1"
FT   misc_feature    257077..>257265
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_5814"
FT   gene            257575..257961
FT                   /db_xref="GeneID:9091193"
FT                   /locus_tag="BC1002_5815"
FT   CDS_pept        257575..257961
FT                   /locus_tag="BC1002_5815"
FT                   /gene_family="HOG000161324" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swi:Swit_2309 hypothetical protein"
FT                   /db_xref="GI:295680643"
FT                   /db_xref="GeneID:9091193"
FT                   /translation="MNHASVKSAVDALEQQRCDATVSEDLLTLASLLDDDLTFVHSSGY
FT                   VHDKPEYLTFLSDKIKTHKIVRAQSLAYQFLPELVITTGQLEQWLQRRSDGSEINIRAL
FT                   VTQVWIKRETGWKLLYLHSGRLSD"
FT                   /protein_id="YP_003609217.1"
FT   gene            258171..259523
FT                   /db_xref="GeneID:9091194"
FT                   /locus_tag="BC1002_5816"
FT   CDS_pept        258171..259523
FT                   /locus_tag="BC1002_5816"
FT                   /gene_family="HOG000135240" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_4048 major facilitator transporter"
FT                   /db_xref="GI:295680644"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091194"
FT                   /translation="MNTPTTPSTQLERPTPLLRLVTLRIIPFLLLCWLMAFIDRVNIGF
FT                   AQLQIKQDLGFGDAIYGLGAGIFFIGYVLFEVPSNIYLEKIGARKTFSRIMICWGATSS
FT                   LTMLIRTPEHFYIMRFLLGACEAGFFPGLVFYLSCWFPESYRARVISWFFVTSAFSGIV
FT                   GGMMSGTILHYLDGANGLRGWQWMFMMEGIPSIILGIVAIFYLDDSIDEARWLDAGQKV
FT                   ELKELLRPEVSRKPEKIRFRDLFGDPYVYILAIAYFSLNSGNFGLGFWLPTILKDFGIR
FT                   DPFMIGMWSAVPYAIGSIGIAIISGSSDRRQERRWHLLACTVFGGLALASLTLHVQAFW
FT                   LVILQLTVAIAFMYGGMPLFWAVPFKELNTKALAGKIALVSSLGQLGGFAAPYALGLIK
FT                   AATGRLDTGLIALGALFAAGGVLVWITARSHRQASATFPAQSLASAENPET"
FT                   /protein_id="YP_003609218.1"
FT   misc_feature    258252..259391
FT                   /note="4-hydroxyphenylacetate permease; Region: HpaX;
FT                   TIGR02332"
FT                   /db_xref="CDD:131385"
FT                   /locus_tag="BC1002_5816"
FT   misc_feature    258252..259379
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5816"
FT   misc_feature    order(258288..258290,258297..258305,258309..258314,
FT                   258363..258365,258372..258377,258384..258386,
FT                   258396..258401,258405..258410,258546..258551,
FT                   258558..258563,258570..258575,258582..258584,
FT                   258618..258623,258630..258635,258651..258653,
FT                   258951..258953,258960..258965,258972..258977,
FT                   258984..258986,259026..259028,259038..259040,
FT                   259050..259052,259059..259061,259071..259073,
FT                   259215..259217,259224..259229,259239..259241,
FT                   259251..259256,259263..259265,259296..259301,
FT                   259308..259313,259320..259325,259332..259334)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5816"
FT   gene            complement(259745..260761)
FT                   /db_xref="GeneID:9091195"
FT                   /locus_tag="BC1002_5817"
FT   CDS_pept        complement(259745..260761)
FT                   /locus_tag="BC1002_5817"
FT                   /gene_family="HOG000219756" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /codon_start="1"
FT                   /product="pyruvate carboxyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ajs:Ajs_2871 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="GI:295680645"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:9091195"
FT                   /translation="MSGQQQGGGESVWINDVVMRDGLQMEPVFVPTSEKVALIDEIGHC
FT                   GLNRIEATSFTSAKAIPALSDAEAVMHEIERVPGVRYAALVLNRRGAERALECGVDELN
FT                   LGVSASETHNLANTRMTRAQAVRALLDITAFCRDRLAIGVSIATAFGCPMEGAIDIDSV
FT                   LDIGNQFVAAGVRGITLCDTTGMANPRQVKAVCGALAARWRGIELTLHLHNTRGMGLAN
FT                   VVAGLDAGIRHFDASLGGLGGCPFAPGASGNICTEDLVHMLDAMGYATGVDLERLIACA
FT                   RRMPGLVGHGVPGQVQHAGAWDHRFPPPADLEATRERALARELSGDAYRAMRPVVER"
FT                   /protein_id="YP_003609219.1"
FT   misc_feature    complement(259904..260722)
FT                   /note="3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM
FT                   barrel domain; Region: DRE_TIM_HMGL; cd07938"
FT                   /db_xref="CDD:163676"
FT                   /locus_tag="BC1002_5817"
FT   misc_feature    complement(order(260003..260005,260123..260125,
FT                   260129..260131,260444..260446,260594..260596,
FT                   260600..260602,260690..260692,260699..260704))
FT                   /note="active site"
FT                   /db_xref="CDD:163676"
FT                   /locus_tag="BC1002_5817"
FT   misc_feature    complement(order(260609..260611,260699..260704))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:163676"
FT                   /locus_tag="BC1002_5817"
FT   misc_feature    complement(order(260003..260005,260123..260125,
FT                   260129..260131,260699..260701))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163676"
FT                   /locus_tag="BC1002_5817"
FT   gene            complement(260758..261146)
FT                   /db_xref="GeneID:9091196"
FT                   /locus_tag="BC1002_5818"
FT                   /pseudo
FT   gene            complement(261724..262638)
FT                   /db_xref="GeneID:9091197"
FT                   /locus_tag="BC1002_5819"
FT   CDS_pept        complement(261724..262638)
FT                   /locus_tag="BC1002_5819"
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /codon_start="1"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nar:Saro_3653 alpha/beta hydrolase
FT                   domain-containing protein; manually curated; PFAM:
FT                   Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="GI:295680646"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="GeneID:9091197"
FT                   /translation="MLRSWAAAAGANATPLWKLDAAQARAAARRRAVPHDPGPEMARAE
FT                   DVAIPVRDGSSIAARLLVPIPRPRGLLVYVHGGGWVLGELPGFEAIGRKLAARTGAAVL
FT                   LVGYRLAPEHPFPIPLQDTWDALKWASKHKVEIAGDDVPLVIAGDSAGGNLAAVVARWA
FT                   RERNSPKLAAQVLVYPVTDADFTRASYQEPENQTFLPTPSMTWFWDQYVADSSVRMHPD
FT                   ASPLRAKDLSGLPAAFVVTGQHDILRDEGQAYAAAMADAGVEVEQHEMAGQMHGFFTMT
FT                   GILPASDQVLERIGAFLDRKLLA"
FT                   /protein_id="YP_003609220.1"
FT   misc_feature    complement(261733..262527)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5819"
FT   misc_feature    complement(261805..262425)
FT                   /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
FT                   pfam07859"
FT                   /db_xref="CDD:149109"
FT                   /locus_tag="BC1002_5819"
FT   gene            complement(262696..264675)
FT                   /db_xref="GeneID:9091198"
FT                   /locus_tag="BC1002_5820"
FT   CDS_pept        complement(262696..264675)
FT                   /locus_tag="BC1002_5820"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PHZ_c1807"
FT                   /codon_start="1"
FT                   /product="4-hydroxyacetophenone monooxygenase"
FT                   /transl_table="11"
FT                   /note="KEGG: pzu:PHZ_c1807 4-hydroxyacetophenone
FT                   monooxygenase"
FT                   /db_xref="GI:295680647"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="GeneID:9091198"
FT                   /translation="MPLTTTTIETPGVDDVYWREEYAQIGEDDAFLAEIVAQADLPSLL
FT                   TALAAVTGDLSMLRPHLRAPFPLVDTVAPAHGGMSEAAQIEARALALVALKRVRDESLT
FT                   RPRPLDDAETRILIDFLTNGAGDADAEILTHEMDLAPKKLGAPGWKFDNVAGDRQFAVA
FT                   VIGTGMSGIAAMYRLKQAGVPFTAFEKNPDVGGVWWANTYPGVRLDTPTFGYSFSFAQR
FT                   TDWPHAFATGGEIEDYAREVVARAGLREHIRFGTEVLSATWDEASGTWDVVSRTGNDEP
FT                   EHRRFNAVISAVGQLERPNIPQIDGQNEFRGVRMHSARWNHNVDLHGKRVAVIGTGASA
FT                   YQIVPNIVDRVKHLTVFQRSGPWMVPAPNYYADTPKALRWLSDHVPCYGQWFRLSGFFQ
FT                   AATGRLHTAVTDPDWTREDSVSAKNLEVRETLTEIIREQWKSRPELIDKIVPTYPPGGK
FT                   RMLRDNGVWAAALQRPNSALVTSPIVRFTETGVVTEDGMEHPVDVVVYATGFTAAEFLD
FT                   PMEIRGVSGRTIKEQWQGDAKAWAGIAVPDFPNFYMVMGPNTNYVVHGSQHFMMECAAE
FT                   FAVEAIHQTLARGINGFEVKPEVLDSFVERVDAENKRRAWGRPQIRTWYKNRFGRVSQV
FT                   WPFSHREYWQLTHDVDFDHDFISH"
FT                   /protein_id="YP_003609221.1"
FT   misc_feature    complement(262999..264216)
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="BC1002_5820"
FT   misc_feature    complement(<263590..264192)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5820"
FT   gene            complement(264923..265111)
FT                   /db_xref="GeneID:9091199"
FT                   /locus_tag="BC1002_5821"
FT   CDS_pept        complement(264923..265111)
FT                   /locus_tag="BC1002_5821"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_4267 PAS/PAC sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="GI:295680648"
FT                   /db_xref="GeneID:9091199"
FT                   /translation="MNQASFEWRNMCPVPFAASIAIDGYGCGPYPIAFAGVFPGLFFPK
FT                   GRASGLATGLAQFFGSP"
FT                   /protein_id="YP_003609222.1"
FT   gene            265201..265764
FT                   /db_xref="GeneID:9091200"
FT                   /locus_tag="BC1002_5822"
FT   CDS_pept        265201..265764
FT                   /locus_tag="BC1002_5822"
FT                   /gene_family="HOG000288426" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_C0992 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680649"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9091200"
FT                   /translation="MSLETSKQSGFKFSHFGMFVTDIAKVTDFYTRLLDFTVTDRGQLP
FT                   GPNGMTDLVFLSRDPDEHHQIVLLTGRPNDMPFNPINQISLKTDSLDTLCEMHETLLAE
FT                   KLPNITPVTHGNALSIYVPDPEGNRLELYFDLPWYVSQPMRVAIDLKDRSTLMQRLELH
FT                   ARTLPGFRPRSVWRAEMAQRMGVK"
FT                   /protein_id="YP_003609223.1"
FT   misc_feature    265234..265647
FT                   /note="The single-domain 2,3-dihydroxybiphenyl
FT                   1,2-dioxygenases (BphC, EC 1.13.11.39) from Rhodococcus
FT                   globerulus P6, BphC2-RGP6 and BphC3-RGP6,  and similar
FT                   proteins; Region: BphC2-C3-RGP6_C_like; cd08348"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5822"
FT   misc_feature    order(265243..265245,265249..265251,265363..265365,
FT                   265390..265392,265447..265449,265453..265455,
FT                   265540..265542,265561..265563,265591..265593)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5822"
FT   misc_feature    order(265243..265245,265447..265449,265591..265593)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:176696"
FT                   /locus_tag="BC1002_5822"
FT   gene            265979..267361
FT                   /db_xref="GeneID:9091201"
FT                   /locus_tag="BC1002_5823"
FT                   /pseudo
FT   gene            267435..268175
FT                   /db_xref="GeneID:9091202"
FT                   /locus_tag="BC1002_5824"
FT   CDS_pept        267435..268175
FT                   /locus_tag="BC1002_5824"
FT                   /gene_family="HOG000269037" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0993 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:295680650"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9091202"
FT                   /translation="MSSPGRVLAILDLFTEENPIWQPDKINDVLGYSRPTGYRYVKELV
FT                   EAGLLQKVAAGRYSLGGRIIALDYLLRQTDPVLFAADPVMRKLAASTKFDAALSVMFAG
FT                   PQVIDVHRVSAEENLHLSYGRGRPRPLFLAASPKVLLAHLPRNSLKKIYATHAKEIGLN
FT                   GMGDTWQEFLSVLTKIRKDGFYRSQGELESGLGAVAVPIFNAEGDCVAALALVGSVQRF
FT                   DTGLNARLLSSLQEASAVIRLSLG"
FT                   /protein_id="YP_003609224.1"
FT   misc_feature    267435..267701
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5824"
FT   misc_feature    267450..268172
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="BC1002_5824"
FT   misc_feature    267810..268160
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_5824"
FT   gene            268303..269016
FT                   /db_xref="GeneID:9091203"
FT                   /locus_tag="BC1002_5825"
FT   CDS_pept        268303..269016
FT                   /locus_tag="BC1002_5825"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bph:Bphy_7685 integrase catalytic region"
FT                   /db_xref="GI:295680651"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:9091203"
FT                   /translation="MWIDIDRLFNGRHFDREVIILCVRWYLRYKLSFRDLVEIMAERGL
FT                   SLAHTTIMRWVKRFTPEFVKRWDRFAKSAGRSWRVDETYVKVRGKWGYLCRAVDRAGKT
FT                   VDFRLSAKRDVVAAKAFFAKAIRAQGFAPKTITLDGYAASHRAVREMKADQFLPADTTL
FT                   RSSKYLNNLIEQDHRNIKSRVNAMLGFKLFGNAAVTISGVELMHRIRKGQFNLARLRLK
FT                   DTTAPAVWNAVLLAR"
FT                   /protein_id="YP_003609225.1"
FT   misc_feature    268324..268950
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="BC1002_5825"
FT   gene            complement(268964..269197)
FT                   /db_xref="GeneID:9091204"
FT                   /locus_tag="BC1002_5826"
FT   CDS_pept        complement(268964..269197)
FT                   /locus_tag="BC1002_5826"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GF10690 gene product from transcript
FT                   GF10690-RA"
FT                   /db_xref="GI:295680652"
FT                   /db_xref="GeneID:9091204"
FT                   /translation="MCEQPDYEAGHFIHLEQSPSIWWPRNWARAKFIVEEGSLTRRQVV
FT                   VQISRTSEEPWIQHCIIVLKGLHSKQQAQWYL"
FT                   /protein_id="YP_003609226.1"
FT   gene            complement(269620..270321)
FT                   /db_xref="GeneID:9091205"
FT                   /locus_tag="BC1002_5827"
FT   CDS_pept        complement(269620..270321)
FT                   /locus_tag="BC1002_5827"
FT                   /gene_family="HOG000133694" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B5768 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:295680653"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091205"
FT                   /translation="MNTMTVPGRVTSGKLLELVGGDFPAQVAAETRKLINRGVLAPGFQ
FT                   LRQSDLAERFGISRVPVREALKLLAAEGIIEHDPNRGFFVAQLSTDEARQLYRMRQLLE
FT                   AELLMTIEWPTSAQIKQLKAMLTELEHSLKMGNREGWIEQHRAFHDTIFDLSPNKVLKR
FT                   EVLRLMRLTDRYRALAADISANPEHRSANIEARLVKALQSKDKDLLLATYEKGRPIVLN
FT                   GLMAVLAAREA"
FT                   /protein_id="YP_003609227.1"
FT   misc_feature    complement(270064..270246)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5827"
FT   misc_feature    complement(order(270073..270084,270088..270093,
FT                   270121..270123,270130..270135,270139..270153,
FT                   270175..270180,270181..270183))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="BC1002_5827"
FT   misc_feature    complement(269698..270039)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_5827"
FT   gene            complement(270666..271691)
FT                   /db_xref="GeneID:9091206"
FT                   /locus_tag="BC1002_5828"
FT   CDS_pept        complement(270666..271691)
FT                   /locus_tag="BC1002_5828"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: har:HEAR0660
FT                   transposase"
FT                   /db_xref="GI:295680654"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:9091206"
FT                   /translation="MEIDVLGIDLAKQIFQLHGADRRGRVVHRSKVSRSSFFEAVRALK
FT                   PKLVVMEACSTAHHWGRRFQSVGIEVRLISPQYVAPFVKTNKNDRNDAEAIVEAASRPT
FT                   MRFVTIKSVEQQDIQAAHRMRAILLRHRTALINQIRGLLGERGLAIARSPEAFRRAIPE
FT                   LLRTSADELTSFCQTLLTELLQHMRAIEERVHLIEASIQTFMKKSALCRKIAEIPGIGP
FT                   ITATAVVAAVGDARQFRNGRHLSAWLGLVPRQYSSGGKPRLHGISRRGDTYLRTLLIHG
FT                   ARAVLCYAPKKTDPQSIWLQELMARRGHNCAAVALANRNARIIQALLSSEATYMTRSAA
FT                   T"
FT                   /protein_id="YP_003609228.1"
FT   misc_feature    complement(270708..271679)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="BC1002_5828"
FT   misc_feature    complement(271233..271502)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="BC1002_5828"
FT   misc_feature    complement(270822..271061)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="BC1002_5828"
FT   gene            271900..273561
FT                   /db_xref="GeneID:9091207"
FT                   /locus_tag="BC1002_5829"
FT                   /pseudo
FT   gene            273537..273716
FT                   /db_xref="GeneID:9091208"
FT                   /locus_tag="BC1002_5830"
FT   CDS_pept        273537..273716
FT                   /locus_tag="BC1002_5830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mchl_3898"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mch:Mchl_3898 hypothetical protein"
FT                   /db_xref="GI:295680655"
FT                   /db_xref="GeneID:9091208"
FT                   /translation="MAAHGWIVNRFCMHTDRRTAARGAIVLAALNHALAGQALGRMKPP
FT                   DFTEMDPAPPTGGH"
FT                   /protein_id="YP_003609229.1"
FT   gene            273747..274772
FT                   /db_xref="GeneID:9091209"
FT                   /locus_tag="BC1002_5831"
FT   CDS_pept        273747..274772
FT                   /locus_tag="BC1002_5831"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: har:HEAR0660
FT                   transposase"
FT                   /db_xref="GI:295680656"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:9091209"
FT                   /translation="MEIDVLGIDLAKQIFQLHGADRRGRVVHRSKVSRSSFFEAVRALN
FT                   PKLVVMEACSTAHHWGRRFQSVGIEVRLISPQYVAPFVKTNKNDRNDAEAIVEAASRPT
FT                   MRFVTIKSVEQQDIQAAHRMRAILLRHRTALINQIRGLLGERGLAIARSPEAFRRAIPE
FT                   LLRTSADELTSFCQTLLTELLQHMRAIEERVHLIEASIQTFMKKSALCRKIAEIPGIGP
FT                   ITATAVVAAVGDARQFRNGRHLSAWLGLVPRQYSSGGKPRLHGISRRGDTYLRTLLIHG
FT                   ARAVLRYAPKKTDPQSIWLQELMARRGHNCAAVALANRNARIIQALLSSEATYMTRSAA
FT                   T"
FT                   /protein_id="YP_003609230.1"
FT   misc_feature    273759..274730
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="BC1002_5831"
FT   misc_feature    273936..274205
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="BC1002_5831"
FT   misc_feature    274377..274616
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="BC1002_5831"
FT   gene            complement(275407..275775)
FT                   /db_xref="GeneID:9091210"
FT                   /locus_tag="BC1002_5832"
FT                   /pseudo
FT   gene            complement(275865..276436)
FT                   /db_xref="GeneID:9091211"
FT                   /locus_tag="BC1002_5833"
FT                   /pseudo
FT   gene            complement(276525..277919)
FT                   /db_xref="GeneID:9091212"
FT                   /locus_tag="BC1002_5834"
FT   CDS_pept        complement(276525..277919)
FT                   /locus_tag="BC1002_5834"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1543"
FT                   /codon_start="1"
FT                   /product="DszA family monooxygenase"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1543 DszA family monooxygenase"
FT                   /db_xref="GI:295680657"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091212"
FT                   /translation="MAKKQILLNAFNMNCVGHINHGLWTHPRDRSADYRTLPYWIDLAR
FT                   TLERGLFDGLFLADIVGVYDVYQHNVDVTLRESIQLPVNDPTLLISAMAAVTRHLGFGV
FT                   TVNLTYEQPYLLARRFSTLDHLTQGRVGWNIVTGYLDSAARAMGLEEQLPHDERYDRAD
FT                   EYLDVLYKLWEGSWEADAVLRDKSARVYADPAKVHKIRHAGRYYNVDGYHLAEPSPQRT
FT                   PVLFQAGSSGRGQRFAARHAECVFISPPSRAVARETVKTLREQLVEAGRRPDDVKVFAG
FT                   AAVVTGATEREAREKYADYLRYASRDAGLAHFAASTGIDYAQYDLDAPVDYAPTNAIES
FT                   ATRTAKQHGWTRRKLLEMFELGGRYPAIVGSAAQVADELQGWIEETGIDGFNLSRTVVP
FT                   ESYEDFIDHIVPELQSRGLYKTAYADGTLRGKLFGRGDHLPELHTASDFRVGSKERREI
FT                   EQNVHR"
FT                   /protein_id="YP_003609231.1"
FT   misc_feature    complement(276627..277898)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5834"
FT   misc_feature    complement(276663..277898)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5834"
FT   misc_feature    complement(order(277221..277226,277446..277448,
FT                   277512..277514,277698..277700,277875..277877,
FT                   277887..277889))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5834"
FT   misc_feature    complement(277602..277607)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5834"
FT   gene            complement(277919..279166)
FT                   /db_xref="GeneID:9091213"
FT                   /locus_tag="BC1002_5835"
FT   CDS_pept        complement(277919..279166)
FT                   /locus_tag="BC1002_5835"
FT                   /gene_family="HOG000219184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: bxe:Bxe_B1544
FT                   hypothetical protein"
FT                   /db_xref="GI:295680658"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091213"
FT                   /translation="MATDIHDSTLERTTPAESTRARPARIADDAHALLVARQLAAAFAP
FT                   EAAARDRDRRLPWAELDAFAASGLWAITVPREYGGAGVSSKTLAEVTAIIAAADGSLGQ
FT                   IPQNHFYALEVLRVGGRPEQQRFFYDRVLAGDRFGNALAETGHKDFKRRTRLTRGAAGW
FT                   QVEGRKFYCTGALFAHWIPTLAVSEEDGRDVTYLVFIPRDAPGVEVIDDWDGFGQRITG
FT                   SGSVQFDQVRVEPEWIVPFQTSFERPTTIGPVAQIMHAAIDLGQARGAFQAALQFVREH
FT                   SRPWIDARVEHASQDPLTITAFGDLAVRLSAAEALLRRAGRFVDAAQAEPAERSVAEAS
FT                   IAVAEARALTTTVSLEAGSRLFELAGTAATLDGLGLDRFWRNARTHTLHDPVRWKYHAV
FT                   GNFYLNDKHPPRHGAL"
FT                   /protein_id="YP_003609232.1"
FT   misc_feature    complement(277940..278989)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BC1002_5835"
FT   misc_feature    complement(order(277973..277975,277979..277981,
FT                   277985..277993,278648..278650,278654..278656,
FT                   278741..278743,278747..278749,278834..278836))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5835"
FT   gene            complement(279170..280417)
FT                   /db_xref="GeneID:9091214"
FT                   /locus_tag="BC1002_5836"
FT   CDS_pept        complement(279170..280417)
FT                   /locus_tag="BC1002_5836"
FT                   /gene_family="HOG000219184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: bxe:Bxe_B1545
FT                   hypothetical protein"
FT                   /db_xref="GI:295680659"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091214"
FT                   /translation="MSTFQSDAVAQLPRLPDPARVKRIKDDSEALDAARTLAADFAAGA
FT                   AERDRDRILPWAELDRWSESGLGGITVPAEYGGADVSLATLAEVFVILCAADPALGQIP
FT                   QNHFGVLGVLREIGTPAQKARLYGEVLAGQRLGNAGPERRSASSATILQGTTRLRATQD
FT                   GLRLDGKRFYSTGALFAHRVPARATDDEGRAVQVWVPRDAAGLSVIDDWNSFGQRTTAS
FT                   GTVIFDQLSVDADDVLPIWQLGDRPGLFGPTSQLIQAAIDQGIAEAAVADAIHFVRERS
FT                   RPWIDSGLERAVDDPYIIADVGRLQIDLHAAHEVLIEAGHTLGAIASQPVDAAASARAS
FT                   VAVAQAKVLTTRIALEASEKLFELAGSASTRAAHSLDRHWRNARTHTLHDPVRWKLHLV
FT                   GNYFLNDVLPVRHSWN"
FT                   /protein_id="YP_003609233.1"
FT   misc_feature    complement(279191..280258)
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5836"
FT   misc_feature    complement(order(279893..279895,279899..279901))
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5836"
FT   gene            complement(280734..281390)
FT                   /db_xref="GeneID:9091215"
FT                   /locus_tag="BC1002_5837"
FT   CDS_pept        complement(280734..281390)
FT                   /locus_tag="BC1002_5837"
FT                   /gene_family="HOG000222815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_4540
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:295680660"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091215"
FT                   /translation="MSELWLSELTGAIRDTLLMVGISACIALIVGIPLALVLVTTTRGG
FT                   IYERRTVNSTLGGLVNALRSTPFIILLVALLPLTRVLVGTTIGVWAATVPLSIAAIPFF
FT                   ARVAEVSLREVDRGLIEAAQAMGAQRRHIIWHVLLPEALPGILGGFTITIVAMIGSSAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTTVMVTVIVLLIAIVTAVQVAGDRLVRRLARRA"
FT                   /protein_id="YP_003609234.1"
FT   misc_feature    complement(<280929..281354)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5837"
FT   misc_feature    complement(order(280935..280937,280944..280949,
FT                   280989..280991,281040..281042,281049..281054,
FT                   281064..281066,281070..281075,281082..281084,
FT                   281088..281090,281094..281099,281163..281165,
FT                   281169..281174,281181..281210,281214..281225,
FT                   281274..281276,281289..281294,281301..281306))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5837"
FT   misc_feature    complement(281163..281207)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5837"
FT   misc_feature    complement(order(280968..280970,280980..280985,
FT                   281001..281039))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5837"
FT   gene            complement(281383..282549)
FT                   /db_xref="GeneID:9091216"
FT                   /locus_tag="BC1002_5838"
FT   CDS_pept        complement(281383..282549)
FT                   /locus_tag="BC1002_5838"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B0853 ABC methionine transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; NIL domain;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:295680661"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="GeneID:9091216"
FT                   /translation="MTHLLDAARFIEEESAFAVGAPEHGTAPAVVFDAAGKVFKPARGQ
FT                   PAVALTNVRLNVRRGEIFGIIGRSGAGKSTLLRLVNGLEKPSSGAVLVNGVSVGELGES
FT                   GLVTLRRRIGMVFQHFNLLSAKTVYDNIALPLRIAGVSRAAIEEKVSALLDLVGLSAKR
FT                   NAFPASLSGGQKQRVGIARALVHDPDILLCDEATSALDPETTQSILALLRDINRRLGLT
FT                   IILITHEMGVIREACDTVAVIEQGAVVETGPVWRVFGKPQHDATRALLRTLVHALPDDL
FT                   AARLKPASNPALLGEAANVLLDVRYTGASGNDPDLAALSSALTVDGGAVSFVHGGIDRI
FT                   QGHAQGRLVLAARLSAHERSEGAFASRIDVLLERARRHADHVEVLGYV"
FT                   /protein_id="YP_003609235.1"
FT   misc_feature    complement(281389..282462)
FT                   /note="ABC-type metal ion transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   AbcC; COG1135"
FT                   /db_xref="CDD:31330"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(281764..282462)
FT                   /note="MetN (also known as YusC) is an ABC-type transporter
FT                   encoded by metN of the metNPQ operon in Bacillus subtilis
FT                   that is involved in methionine transport.  Other members of
FT                   this system include the MetP permease and  the MetQ
FT                   substrate binding protein...; Region:
FT                   ABC_MetN_methionine_transporter; cd03258"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(282328..282351)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(order(281866..281868,281965..281970,
FT                   282196..282198,282325..282333,282337..282342))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(282196..282207)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(282013..282042)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(281965..281982)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(281947..281958)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(281860..281880)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="BC1002_5838"
FT   misc_feature    complement(281395..281652)
FT                   /note="NIL domain; Region: NIL; pfam09383"
FT                   /db_xref="CDD:150152"
FT                   /locus_tag="BC1002_5838"
FT   gene            complement(282575..283414)
FT                   /db_xref="GeneID:9091217"
FT                   /locus_tag="BC1002_5839"
FT   CDS_pept        complement(282575..283414)
FT                   /locus_tag="BC1002_5839"
FT                   /gene_family="HOG000222926" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /codon_start="1"
FT                   /product="NLPA lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bxe:Bxe_B0852 ABC
FT                   methionine transporter, periplasmic ligand binding protein"
FT                   /db_xref="GI:295680662"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="GeneID:9091217"
FT                   /translation="MSQALSTLRRFFFARNASAVHAILFVLAFSTSSAFAGDAQTLKIG
FT                   TSTSPQIEALKTAAQEAKQQGLDVKIIEFTDWNTPNAALANKDIDVNYFQHIPFLENAK
FT                   KQGGYDFVAIAPGTIMKIGLYSKKVKRFEDLKDGATVAIANDPVNGGRGLLLLQRAGLI
FT                   KLKPGVDYRATTLDIVDNPKHLKIVALEASQLARSLDDVDLAQGYPSFIKLAGTADPNS
FT                   ALLFDGLENKNFAIQWVVRPESVNDPRILKFISIYQHSHAVRVALDKAFGNLYAVAW"
FT                   /protein_id="YP_003609236.1"
FT   sig_peptide     complement(283304..283414)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 37"
FT                   /locus_tag="BC1002_5839"
FT   misc_feature    complement(282578..283291)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5839"
FT   gene            283817..284893
FT                   /db_xref="GeneID:9091218"
FT                   /locus_tag="BC1002_5840"
FT   CDS_pept        283817..284893
FT                   /locus_tag="BC1002_5840"
FT                   /gene_family="HOG000134570" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /codon_start="1"
FT                   /EC_number="1.14.14.5"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5235 alkanesulfonate monooxygenase;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="GI:295680663"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="GeneID:9091218"
FT                   /translation="MSVEFIGMIQQRKVSETHLPQGPAIDTDYVRAFAQAHENAGFDRI
FT                   LVPHSSTSPDATITIAYAASATSKVHFMLAHRPGFVAPTLAARQIATLDHFSGGRLGVH
FT                   FISGGSDEDQRRDGDFLSHDDRYARTDEYLQILRRVWTEDQPFDHEGPFYRVEKAFSEV
FT                   KPKQSPHVPIYFGGASEPALAVAGKHADVYALWGESKQQVHEQVTRVRAEAAKHGRRVR
FT                   FSVSFRPILAATESAAWERAEHILEETRRLRVEQGFSRGGPQQSEGARRLLAASGDGVR
FT                   ADERLWTAVAKEIGGRSNSTALVGTPAQVAQTLAEYHELGVTTFLIRGFDPLEDAIDYG
FT                   RELIPATRELTSRARRAA"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /protein_id="YP_003609237.1"
FT   misc_feature    283865..284548
FT                   /note="Alkanesulfonate monoxygenase is the monoxygenase of
FT                   a two-component system that catalyzes the conversion of
FT                   alkanesulfonates to the corresponding aldehyde and sulfite.
FT                   Alkanesulfonate monoxygenase (SsuD) has an absolute
FT                   requirement for reduced flavin...; Region:
FT                   Alkanesulfonate_monoxygenase; cd01094"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5840"
FT   misc_feature    283883..284866
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="BC1002_5840"
FT   misc_feature    order(283964..283981,283988..283990,283997..284002,
FT                   284009..284011,284060..284062,284066..284071,
FT                   284078..284083,284090..284092,284099..284101,
FT                   284150..284152,284159..284164,284279..284281,
FT                   284285..284296,284300..284305)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5840"
FT   misc_feature    order(283973..283975,284132..284134,284192..284194,
FT                   284351..284356,284396..284398,284492..284494,
FT                   284498..284500)
FT                   /note="active site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5840"
FT   misc_feature    284039..284044
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5840"
FT   misc_feature    order(284138..284164,284183..284191,284279..284320,
FT                   284501..284512,284531..284548)
FT                   /note="insertion regions; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5840"
FT   gene            284905..285417
FT                   /db_xref="GeneID:9091219"
FT                   /locus_tag="BC1002_5841"
FT   CDS_pept        284905..285417
FT                   /locus_tag="BC1002_5841"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /codon_start="1"
FT                   /product="class II aldolase/adducin family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bph:Bphy_5234 hypothetical protein"
FT                   /db_xref="GI:295680664"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="GeneID:9091219"
FT                   /translation="MSTLLAADQPSLVRHDTPVRKFWFDEELEPQRTLAEERLHRQQRL
FT                   AGVFRLFAQYGFAQGLAGHITARDPESTDHFWVNPLGRHFGRMRVSDLLLVNRHGEIVV
FT                   GDGPVNQAAFAIHAAIHEARPDLTPQPIPHDMADLTHQQVGRANGARHAFDSMYEGLIE
FT                   SERELLD"
FT                   /protein_id="YP_003609238.1"
FT   misc_feature    285031..>285228
FT                   /note="Class II Aldolase and Adducin head (N-terminal)
FT                   domain. Aldolases are ubiquitous enzymes catalyzing central
FT                   steps of carbohydrate metabolism. Based on enzymatic
FT                   mechanisms, this superfamily has been divided into two
FT                   distinct classes (Class I and II)...; Region: Aldolase_II;
FT                   cl00214"
FT                   /db_xref="CDD:174038"
FT                   /locus_tag="BC1002_5841"
FT   misc_feature    <285286..285414
FT                   /note="Class II Aldolase and Adducin head (N-terminal)
FT                   domain. Aldolases are ubiquitous enzymes catalyzing central
FT                   steps of carbohydrate metabolism. Based on enzymatic
FT                   mechanisms, this superfamily has been divided into two
FT                   distinct classes (Class I and II)...; Region: Aldolase_II;
FT                   cl00214"
FT                   /db_xref="CDD:174038"
FT                   /locus_tag="BC1002_5841"
FT   gene            285417..286013
FT                   /db_xref="GeneID:9091220"
FT                   /locus_tag="BC1002_5842"
FT   CDS_pept        285417..286013
FT                   /locus_tag="BC1002_5842"
FT                   /gene_family="HOG000180757" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05995"
FT                   /codon_start="1"
FT                   /product="cysteine dioxygenase type I"
FT                   /transl_table="11"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   bph:Bphy_5233 cysteine dioxygenase type I"
FT                   /db_xref="GI:295680665"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="GeneID:9091220"
FT                   /translation="MAIHKLRHFVCEIAELVDSGVDEAGLLHQGVLALRELVRVDDWLP
FT                   DAYAQPSVDRYQQFLLYADARQRFSVVSFVWGPGQQTPIHDHTVWGLIGVLRGAELAAP
FT                   YARNDDGTLRVAGAEVRLEAGDVEAVSPVIGDIHRVRNAYDDRTSVSIHVYGANIGAVR
FT                   RSTYPPNERPKPFISGYSNDTLPNLWDLSKEIPLS"
FT                   /protein_id="YP_003609239.1"
FT   misc_feature    285417..285989
FT                   /note="Cysteine dioxygenase type I; Region: CDO_I; cl02350"
FT                   /db_xref="CDD:154868"
FT                   /locus_tag="BC1002_5842"
FT   gene            286010..287617
FT                   /db_xref="GeneID:9091221"
FT                   /locus_tag="BC1002_5843"
FT   CDS_pept        286010..287617
FT                   /locus_tag="BC1002_5843"
FT                   /gene_family="HOG000180868" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5232 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="GI:295680666"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9091221"
FT                   /translation="MKSYSVRTYEDVREALLARREIALLDVREEDPHAQAHPLFAANFP
FT                   LSKIELDAYTRLPRRDVPIVLFDAGEGLATRAADKLTSLGYTRIALLAGGLDGWIRAGG
FT                   EVFRDVNVPSKAFGEFVEAQRHTPSLSAEAVGILLENGDDVVVLDARRFDEYQTMNIPG
FT                   SISVPGAELVLRARALAPDPKTHVIVNCAGRTRSIIGTQSLVNAGLPNPVAALRNGTIG
FT                   WTLAGQALEHGSSRRFDAEAGLDQTNLAASRTAARALADRAGVQRTTLDEAARWASDPS
FT                   RTTYRFDVRTPAEYERAHAPGFQGAPGGQLVQETDMFASVRGARVVLFDDDGVRANMTA
FT                   SWLAQMNIDVYVIDDAAGQQLTASGPWRSTKPEPAHTSALSAEELAALLADPSSRTVVI
FT                   DVTSSANHVKAHIPGAHWIVRSRLSNDVDDLRALPDAKRYVVTCATNALAPFAAPEVAS
FT                   LTGKPVHVLEGGTSAWIRAGFPTESGDSRLASPRIDRYRRPYEGTDNAREAMNAYLEWE
FT                   YGLVAQLDRDGTHGFFVI"
FT                   /protein_id="YP_003609240.1"
FT   misc_feature    286085..286309
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   repeat 1. This CD includes putative rhodanese-related
FT                   sulfurtransferases which contain 4 copies of the Rhodanese
FT                   Homology Domain. This CD aligns the 1st repeat which does
FT                   not contain the putative...; Region: 4RHOD_Repeat_1;
FT                   cd01532"
FT                   /db_xref="CDD:29095"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    286211..286213
FT                   /note="active site residue"
FT                   /db_xref="CDD:29095"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    286364..286690
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   repeat 2. This CD includes putative rhodanese-related
FT                   sulfurtransferases which contain 4 copies of the Rhodanese
FT                   Homology Domain. This CD aligns the 2nd repeat which does
FT                   contain the putative...; Region: 4RHOD_Repeat_2; cd01533"
FT                   /db_xref="CDD:29096"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    286580..286582
FT                   /note="active site residue"
FT                   /db_xref="CDD:29096"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    286811..287071
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   repeat 3. This CD includes putative rhodanese-related
FT                   sulfurtransferases which contain 4 copies of the Rhodanese
FT                   Homology Domain. This CD aligns the 3rd repeat which does
FT                   not contain the putative...; Region: 4RHOD_Repeat_3;
FT                   cd01534"
FT                   /db_xref="CDD:29097"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    286997..286999
FT                   /note="active site residue"
FT                   /db_xref="CDD:29097"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    287195..287605
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   repeat 4. This CD includes putative rhodanese-related
FT                   sulfurtransferases which contain 4 copies of the Rhodanese
FT                   Homology Domain. This CD aligns the 4th repeat which, in
FT                   general, contains the...; Region: 4RHOD_Repeat_4; cd01535"
FT                   /db_xref="CDD:29098"
FT                   /locus_tag="BC1002_5843"
FT   misc_feature    287336..287338
FT                   /note="active site residue"
FT                   /db_xref="CDD:29098"
FT                   /locus_tag="BC1002_5843"
FT   gene            complement(287626..288537)
FT                   /db_xref="GeneID:9091222"
FT                   /locus_tag="BC1002_5844"
FT   CDS_pept        complement(287626..288537)
FT                   /locus_tag="BC1002_5844"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_1550 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295680667"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091222"
FT                   /translation="MKLDEIEAFVAVVRSQSLSQAADSLALTQPAVTRRIQNFEEALGV
FT                   ELLDRNTKPLKTTPMGRVVYEQCRAIVREVDALRHLVADDAPLAGVLRLGVAQTVADVA
FT                   MLKALHALRCAHPELRARVTTGWGNPLLQKVEEAELDAVIVLLPTNRALQETLAGETLG
FT                   ELKLAVVAQKGSLKKRAYTLAECQSYGWVLNPDGCGFRAGLQQALAAKGYTLKLNLETL
FT                   GTELQLGLVADGVGLGLVPLPLLRSSVHAAHLDVVPITDFKPEIAVWIVRSRALGKMQS
FT                   ALAVLAESVEQSFKAARLSRAA"
FT                   /protein_id="YP_003609241.1"
FT   misc_feature    complement(287689..288537)
FT                   /note="putative DNA-binding transcriptional regulator;
FT                   Provisional; Region: PRK09791"
FT                   /db_xref="CDD:170097"
FT                   /locus_tag="BC1002_5844"
FT   misc_feature    complement(288352..288531)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5844"
FT   misc_feature    complement(<287890..288264)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5844"
FT   misc_feature    complement(order(288163..288183,288187..288189,
FT                   288199..288201,288208..288213,288217..288222))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5844"
FT   gene            288714..289685
FT                   /db_xref="GeneID:9091223"
FT                   /locus_tag="BC1002_5845"
FT   CDS_pept        288714..289685
FT                   /locus_tag="BC1002_5845"
FT                   /gene_family="HOG000164731" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /codon_start="1"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   NMT1/THI5 like domain protein; KEGG: bph:Bphy_5229
FT                   aliphatic sulfonate ABC transporter periplasmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="GI:295680668"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="GeneID:9091223"
FT                   /translation="MLRSLMPFLLNRFLQRLSGLLICAIIASASPAALAETTLKVGDQQ
FT                   LQTRGILEASGQLKDVPYKIEWFNFPAAQPLGEALNAGAIDVGGLGDAPLIFAYAAGAR
FT                   VRAVAATRSTPTDLAIIVPDASPIRTAADLKGKRIATTRGSIGHYLAIATLERAGIKLS
FT                   DVSLRFMQPADAKAALTSGNVDAWSTWDPYVALAEQRDHDRSIANGVNLSSGLSFQAAT
FT                   ETSIKDKHAEIADFLKRVAAGQRWALSHPDEVAAMQSKVTGLPPEVLKTVYQRAQLHPV
FT                   VIDDGLIAEQQKTADLYHRADVIKTPLDVTKSFDRQFPLAAQ"
FT                   /protein_id="YP_003609242.1"
FT   sig_peptide     288714..288821
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 36"
FT                   /locus_tag="BC1002_5845"
FT   misc_feature    288888..>289313
FT                   /note="Bacterial periplasmic transport systems use
FT                   membrane-bound complexes and substrate-bound,
FT                   membrane-associated, periplasmic binding proteins (PBPs) to
FT                   transport a wide variety of  substrates, such as, amino
FT                   acids, peptides, sugars, vitamins and...; Region: PBPb;
FT                   cd00134"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_5845"
FT   misc_feature    order(288927..288929,289011..289013,289149..289151,
FT                   289281..289283)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_5845"
FT   misc_feature    order(289230..289232,289242..289244,289260..289262)
FT                   /note="membrane-bound complex binding site; other site"
FT                   /db_xref="CDD:29040"
FT                   /locus_tag="BC1002_5845"
FT   gene            289697..290923
FT                   /db_xref="GeneID:9091224"
FT                   /locus_tag="BC1002_5846"
FT   CDS_pept        289697..290923
FT                   /locus_tag="BC1002_5846"
FT                   /gene_family="HOG000131663" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   pfl:PFL_1379 acyl-CoA dehydrogenase family protein"
FT                   /db_xref="GI:295680669"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091224"
FT                   /translation="MTSRQPEGALADVERDADALQALADLDSPQADAWLAALTAEFGAG
FT                   AAALDAGPIFPHENLARLRRAGLLSLTVPRALGGREATLAQALKVIRAVARGEPSTALI
FT                   LVMQCLYHLRLQANPNWPAALKERIARDAVERGALINSLRVEPELGSPSRGGLPATVGR
FT                   SEGNHWILSGRKLYSTGSPGLTWFAVWGRTDEAAPRVGTWLVHRDTPGIRFGEPWNHLG
FT                   MRATGSHEVIFDNVRVPFDQAVDLQPPGPTNGMDPLTSLWMNVLLPSIYDGIARAARDW
FT                   FVQWAAQRVPSGLNAPLSTLDSFQQTVGRIDALLFNNRVLLDAGAAGQIGTVEAPTIKY
FT                   LVSQHAIDAVELALEASSNPGLSRNNALERHYRDVLCARIHTPQNDTVLGNLGRAAFTT
FT                   TSPTRSEPR"
FT                   /protein_id="YP_003609243.1"
FT   misc_feature    290015..290836
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5846"
FT   misc_feature    order(290018..290020,290120..290122,290126..290128,
FT                   290225..290227,290231..290233,290834..290836)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5846"
FT   gene            290920..292008
FT                   /db_xref="GeneID:9091225"
FT                   /locus_tag="BC1002_5847"
FT   CDS_pept        290920..292008
FT                   /locus_tag="BC1002_5847"
FT                   /gene_family="HOG000134570" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /codon_start="1"
FT                   /EC_number="1.14.14.5"
FT                   /transl_table="11"
FT                   /note="KEGG: bbt:BBta_1980 putative FMNH2-dependent
FT                   aliphatic sulphonate monooxygenase; PFAM: Luciferase-like,
FT                   subgroup"
FT                   /db_xref="GI:295680670"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="GeneID:9091225"
FT                   /translation="MSVEFIGYVSHQESSEIHLPKGPAVNPPYIAAVAQAHEYGGFDRV
FT                   LIAHSSASPDGFQIASFVAQQTKRLGILLAHRPGFVAPTLAARQLATLDHFSAGRAAVH
FT                   IISGGDDAEQQRDGDYLSHADRYRRTDEYLDVVKRSWTSDQPFDHEGAFYRVTGHKSQI
FT                   RPLQRSHLPVYFGGSSEAAIEVAGKHADVYALWGESLAAVEETIAKVRKAAARYGREQH
FT                   VRFSLSLRPIIAPTEDAAWARAESILERAKDIVATSPNFTRRPKNPQNVGSQRLLAEAD
FT                   KGNVVDTRLWTGITALTRAAGNSTSLVGTPQQVADALLEYHKLGVSTFLIRGFDPLEDA
FT                   LAYGRDLLPVVRAAVARETAPA"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /protein_id="YP_003609244.1"
FT   misc_feature    290971..291657
FT                   /note="Alkanesulfonate monoxygenase is the monoxygenase of
FT                   a two-component system that catalyzes the conversion of
FT                   alkanesulfonates to the corresponding aldehyde and sulfite.
FT                   Alkanesulfonate monoxygenase (SsuD) has an absolute
FT                   requirement for reduced flavin...; Region:
FT                   Alkanesulfonate_monoxygenase; cd01094"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5847"
FT   misc_feature    290977..291990
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="BC1002_5847"
FT   misc_feature    order(291067..291084,291091..291093,291100..291105,
FT                   291112..291114,291163..291165,291169..291174,
FT                   291181..291186,291193..291195,291202..291204,
FT                   291253..291255,291262..291267,291382..291384,
FT                   291388..291399,291403..291408)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5847"
FT   misc_feature    order(291076..291078,291235..291237,291295..291297,
FT                   291454..291459,291499..291501,291601..291603,
FT                   291607..291609)
FT                   /note="active site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5847"
FT   misc_feature    291142..291147
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5847"
FT   misc_feature    order(291241..291267,291286..291294,291382..291423,
FT                   291610..291621,291640..291657)
FT                   /note="insertion regions; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5847"
FT   gene            complement(292072..293106)
FT                   /db_xref="GeneID:9091226"
FT                   /locus_tag="BC1002_5848"
FT   CDS_pept        complement(292072..293106)
FT                   /locus_tag="BC1002_5848"
FT                   /gene_family="HOG000180424" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /codon_start="1"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bxe:Bxe_C0117 nitrate/sulfonate/bicarbonate ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680671"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091226"
FT                   /translation="MNHTDDNQPSNAARRVWLRNTAWAAGAAALGGAAFGLPGVRASAD
FT                   EALKPLKLSWNASAICTAPVPVAEKQGFFRKHGLQVELVNFAGSTDQLLEAIATGKSDA
FT                   GVGMALRWIKPLEQGFDVKLTAGIHGGCMRLLATKASGIVDLQGLKGRTVGVSDMASPA
FT                   KNFFAVTLKKIGVDPDNDVHWRQYPAPLLGEALKKGEVQAIADGDPTIWTLREGDHLQE
FT                   VSNNLCGEYANRVCCVLGVRGSLIRKDRATAQALTQALLEATEWTANNPAQAAAIFAPN
FT                   APGANVEQLTEMLKSHTDHHHPVGDAFKKEIALYADDLKSVGVLNNGTNSDRFAARVFS
FT                   DVLA"
FT                   /protein_id="YP_003609245.1"
FT   misc_feature    complement(<292486..292920)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5848"
FT   gene            complement(293161..293997)
FT                   /db_xref="GeneID:9091227"
FT                   /locus_tag="BC1002_5849"
FT   CDS_pept        complement(293161..293997)
FT                   /locus_tag="BC1002_5849"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0116 nitrate/sulfonate/bicarbonate
FT                   ABC transporter ATPase; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:295680672"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091227"
FT                   /translation="MVAASLSQSFSGSFRQASSARARRGTRVDVREVSHQFTLRGEALP
FT                   VLDNISLTVEPGEFVALLGASGCGKSTLLRLVAGLDAPARGEIHADGEAVAGPDPSRVV
FT                   VFQDPTLFPWRTVRDNVGLGPQAQRKTRGDQAKRETAERIDAALQTVGLSAFANAFPHQ
FT                   LSGGMAQRAALARALVNNPRLLVLDEPFGKLDSLTRIRMQAELVRLWQAEGFSVLLVTH
FT                   DVEEALYVANRVIVLSERPARIVSEVRNDAPYPRHRDDPALVSLRRDVLGLLGLET"
FT                   /protein_id="YP_003609246.1"
FT   misc_feature    complement(293164..293922)
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293245..293916)
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293785..293808)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(order(293332..293334,293431..293436,
FT                   293677..293679,293782..293790,293794..293799))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293677..293688)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293479..293508)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293431..293448)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293413..293424)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   misc_feature    complement(293326..293346)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="BC1002_5849"
FT   gene            complement(293991..295034)
FT                   /db_xref="GeneID:9091228"
FT                   /locus_tag="BC1002_5850"
FT   CDS_pept        complement(293991..295034)
FT                   /locus_tag="BC1002_5850"
FT                   /gene_family="HOG000180423" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0115
FT                   nitrate/sulfonate/bicarbonate ABC transporter inner
FT                   membrane protein"
FT                   /db_xref="GI:295680673"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091228"
FT                   /translation="MSTQTQTFPRANLAADAASTARHDPRLIVSGLAALGWLGSAAITH
FT                   WWPALDDWPYTRELLILKLLLAVLSAGIGVAGWRVNASTPAASAKRLRVQAWLNATPWL
FT                   LALSIGLTAWEVVTAQLEWLPRPFFAPPQALLAVYADDLPRLASSVGHSFVLLAYGYVC
FT                   GALTGFVIGVSIGWSKAVGYWLHPVLRLVGPLPATAWLPLAFFFFPSSFSASVFLIALA
FT                   AAFPVAVLTWSGVASVSSAYYDVARTLGARPSFLILRVAIPAALPSVFVGLFMGLGASF
FT                   AVLIVAEMMGVKAGLGWYLQWAQGWAAYSNMYAALLVMALMCSGLVTLLFRVRDRLLTW
FT                   QKGLLKW"
FT                   /protein_id="YP_003609247.1"
FT   misc_feature    complement(294006..294764)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="BC1002_5850"
FT   gene            complement(295056..296069)
FT                   /db_xref="GeneID:9091229"
FT                   /locus_tag="BC1002_5851"
FT   CDS_pept        complement(295056..296069)
FT                   /locus_tag="BC1002_5851"
FT                   /gene_family="HOG000164731" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /codon_start="1"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /transl_table="11"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bph:Bphy_5227
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="GI:295680674"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091229"
FT                   /translation="MTPSVPTSFSARRRVLRALTAAPLASVAAAARGQSVSAANPNAST
FT                   ASNGVTLVLGDQAGGTRALIEASKVLDGAPYAYRWANFQGAAPLFEAQRAGAVDLAPAG
FT                   DLPVLAAAVGDPSLKIVATRVGSGAQLGILVSPNSTIRTVADLKGRTVFVSSARGSISQ
FT                   FQLYGALAEAGLSKDDVNVRLILPVDAFAAFASGSIEVWATFDPYYGIAVQRGGRVLRD
FT                   GSGINSGLGFITASGNSLTDPRKRAAIADVLKRYQRTGDWALANPDAYAQIYATLTRSP
FT                   LDAAKQITQRASLKQHFVTNADIEALQKVADSANRDAILSRRIDVRAISETHLASA"
FT                   /protein_id="YP_003609248.1"
FT   sig_peptide     complement(295953..296069)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.539 at
FT                   residue 39"
FT                   /locus_tag="BC1002_5851"
FT   misc_feature    complement(295089..295916)
FT                   /note="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
FT                   /db_xref="CDD:130789"
FT                   /locus_tag="BC1002_5851"
FT   misc_feature    complement(295086..295832)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5851"
FT   gene            296259..296399
FT                   /db_xref="GeneID:9091230"
FT                   /locus_tag="BC1002_5852"
FT                   /pseudo
FT   gene            296955..297551
FT                   /db_xref="GeneID:9091231"
FT                   /locus_tag="BC1002_5853"
FT   CDS_pept        296955..297551
FT                   /locus_tag="BC1002_5853"
FT                   /gene_family="HOG000146737" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /codon_start="1"
FT                   /product="nitroreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: nitroreductase; KEGG: bxe:Bxe_C0111 putative
FT                   nitroreductase"
FT                   /db_xref="GI:295680675"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="GeneID:9091231"
FT                   /translation="MTTSNSRTAEYPIDRQFLERWSPRAFTKDTIPESTLLTFLEAARW
FT                   APSSYNSQPWRFVYARRDTEHWTRFLGFLNEFNRGWAQYAAAILIVLSKRTFTPPGAAT
FT                   EVPLASHSFDTGAAWGYFALQASLSGWKAHGLAGIEREHIRAELAIPEDYAIEAAVAIG
FT                   RAGDKASLPEALQKRETPSPRNPLPTFVAEGRFAL"
FT                   /protein_id="YP_003609249.1"
FT   misc_feature    296979..297527
FT                   /note="Nitroreductase-like family 2. A subfamily of the
FT                   nitroreductase family containing uncharacterized proteins
FT                   that are similar to nitroreductase. Nitroreductase
FT                   catalyzes the reduction of nitroaromatic compounds such as
FT                   nitrotoluenes, nitrofurans and...; Region:
FT                   Nitroreductase_2; cd02138"
FT                   /db_xref="CDD:48385"
FT                   /locus_tag="BC1002_5853"
FT   misc_feature    order(297012..297014,297018..297020,297024..297026,
FT                   297102..297104,297363..297368)
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:48385"
FT                   /locus_tag="BC1002_5853"
FT   gene            complement(297639..297782)
FT                   /db_xref="GeneID:9091232"
FT                   /locus_tag="BC1002_5854"
FT                   /pseudo
FT   gene            complement(297840..298373)
FT                   /db_xref="GeneID:9091233"
FT                   /locus_tag="BC1002_5855"
FT   CDS_pept        complement(297840..298373)
FT                   /locus_tag="BC1002_5855"
FT                   /gene_family="HOG000268715" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /codon_start="1"
FT                   /product="OsmC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OsmC family protein; KEGG: bcm:Bcenmc03_6182
FT                   OsmC family protein"
FT                   /db_xref="GI:295680676"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="GeneID:9091233"
FT                   /translation="MTTLNEYLQQKRIAWLAKREAARTDPNVKANQLKANVRALGRSGV
FT                   REIRIRDFQVISDSPADFAGYNLGPASPELQLGVLGSCLTHITLIQAAERQLRIDSIDV
FT                   EVTGEQHPLAQQPGFEHVPIFPHNIRYTLDIVSPEPPEAIRALHEAVEAVCPIYNLLKN
FT                   PQSIVGELRHVSAA"
FT                   /protein_id="YP_003609250.1"
FT   misc_feature    complement(297873..298181)
FT                   /note="OsmC-like protein; Region: OsmC; cl00767"
FT                   /db_xref="CDD:174381"
FT                   /locus_tag="BC1002_5855"
FT   gene            298750..298962
FT                   /db_xref="GeneID:9091234"
FT                   /locus_tag="BC1002_5856"
FT   CDS_pept        298750..298962
FT                   /locus_tag="BC1002_5856"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_5494 hypothetical protein"
FT                   /db_xref="GI:295680677"
FT                   /db_xref="GeneID:9091234"
FT                   /translation="MKRCCSRSVIVHVLASGRISLDIPIMLGTGDGLADSVVVTSEEAA
FT                   PHFPFESHPALRLSPVPEWTARSRR"
FT                   /protein_id="YP_003609251.1"
FT   gene            298959..300200
FT                   /db_xref="GeneID:9091235"
FT                   /locus_tag="BC1002_5857"
FT   CDS_pept        298959..300200
FT                   /locus_tag="BC1002_5857"
FT                   /gene_family="HOG000219184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: aav:Aave_0877 acyl-CoA
FT                   dehydrogenase type 2"
FT                   /db_xref="GI:295680678"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013764"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091235"
FT                   /translation="MTARTSVVAFEESARATPRAYSPARILKSDDEALRTARALAERFP
FT                   LDASRRDSERILPFAELDACSGAGLWAMTVPREYGGAQVSYSTVARVFAILAEADPSIA
FT                   QIQQNHNSAVFWIWKTGNAQQRSFFLGEILGGARFGNANVDVGARQPSGCAMTITPEQD
FT                   GFRLSGNKLYSTGALFADYVSTIGQNQEGRRTVAVVPAGHPGMKIIDDWQSFGQKTTAS
FT                   GTVIFDDVWVPALNVLPIHQSYAHWPQNAVTQISHVGIDAGIARAAIDATIAFIRERDA
FT                   ASSSSAISPLGADPYVIHQLGELTTRLHAAEAMMERAGREIDRCLADIGPDSIAAASIA
FT                   VAQAKALTTEIAIEASSKLFELAGTRSTHPSFNLDRHWRNARVHTVHDPVRWKYAAVGN
FT                   FYLNGVRPSPNGQT"
FT                   /protein_id="YP_003609252.1"
FT   misc_feature    299097..300179
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="BC1002_5857"
FT   misc_feature    299106..300185
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BC1002_5857"
FT   misc_feature    order(299292..299294,299379..299381,299385..299387,
FT                   299475..299477,299481..299483,300126..300134,
FT                   300138..300140,300144..300146)
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="BC1002_5857"
FT   gene            300249..301469
FT                   /db_xref="GeneID:9091236"
FT                   /locus_tag="BC1002_5858"
FT   CDS_pept        300249..301469
FT                   /locus_tag="BC1002_5858"
FT                   /gene_family="HOG000268769" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /codon_start="1"
FT                   /product="Luciferase-like, subgroup"
FT                   /transl_table="11"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bxe:Bxe_C0148
FT                   putative luciferase-like monooxygenase"
FT                   /db_xref="GI:295680679"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="GeneID:9091236"
FT                   /translation="MTQSILAPQPQASAQSSDSTRDATAFVPVRSPVEFNDSPVARALE
FT                   QPLLLGLFLPIQAGGWSASTLPRTTDWNFDYNLALVQKAESLGFDLVFALSQWLPKGGY
FT                   GGVFNGQALDSFMSLAAMTARTERIILVATSHVLYGPWHPLHFAKFSATLDHISKGRWG
FT                   INVVTGHRAVEHEMFGWQRIEHDRRYELAGEFLDAVQQLWSQPENFSFVPELSSWKLDK
FT                   AFVTPKPQYGRPLLVNATGSDAGIDFAARYSDVVFITSPAGSEIEAALAALPAHTARVK
FT                   ATAAKYGREVRTLINPMVICRETEAEALAYRDAIVAHGDEGSFHRFDSDAHAWRGNAEQ
FT                   RNQAAARAVGGNISIVGAPQQIAEYIVRLHQAGIDGVQLSFFDFQPDLEFFGARVLPLL
FT                   REAGLRL"
FT                   /protein_id="YP_003609253.1"
FT   misc_feature    300411..301190
FT                   /note="Alkanesulfonate monoxygenase is the monoxygenase of
FT                   a two-component system that catalyzes the conversion of
FT                   alkanesulfonates to the corresponding aldehyde and sulfite.
FT                   Alkanesulfonate monoxygenase (SsuD) has an absolute
FT                   requirement for reduced flavin...; Region:
FT                   Alkanesulfonate_monoxygenase; cd01094"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5858"
FT   misc_feature    order(300417..300419,300561..300563,300747..300749,
FT                   300810..300812,300972..300977,301017..301019,
FT                   301134..301136,301140..301142)
FT                   /note="active site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5858"
FT   misc_feature    300438..301202
FT                   /note="Luciferase-like monooxygenase; Region:
FT                   Bac_luciferase; pfam00296"
FT                   /db_xref="CDD:144035"
FT                   /locus_tag="BC1002_5858"
FT   misc_feature    order(300552..300566,300588..300590,300597..300599,
FT                   300606..300611,300618..300620,300675..300677,
FT                   300681..300686,300693..300698,300705..300707,
FT                   300714..300716,300765..300767,300774..300779,
FT                   300903..300905,300909..300920,300924..300929)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5858"
FT   misc_feature    300648..300653
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5858"
FT   misc_feature    order(300753..300779,300801..300809,300903..300944,
FT                   301143..301154,301173..301190)
FT                   /note="insertion regions; other site"
FT                   /db_xref="CDD:29426"
FT                   /locus_tag="BC1002_5858"
FT   gene            301502..302563
FT                   /db_xref="GeneID:9091237"
FT                   /locus_tag="BC1002_5859"
FT   CDS_pept        301502..302563
FT                   /locus_tag="BC1002_5859"
FT                   /gene_family="HOG000134456" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0147"
FT                   /codon_start="1"
FT                   /product="putative desulfurizing enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0147 putative desulfurizing enzyme"
FT                   /db_xref="GI:295680680"
FT                   /db_xref="GeneID:9091237"
FT                   /translation="MSRLWYTRCPAPTPFGITVQKGWLEQEFAPDGIDVKALQDADDAT
FT                   VRRSHFTHTQPWSFRQGGNIPALWARSQGSDTRLIGLSWVDEFQALITLDRQLDASAEA
FT                   LAGRHFGFPLNARASVVDFHRATALRGFTSLLGALGLQLEDVDLVDLPHTPRGLEDAKP
FT                   AADAPLADWLDAQRSHEFAREGEALLRGEADVVFVKGATGLDIANLLNAKILIDISAQP
FT                   NRLLHANNGTPRPLTVDAQLLRERPDLVERVLARTLDTGDWAQRHAGDIAHYVARETRS
FT                   AEHWVERAYPGGLHRQLSIGLDPQALAALADFKQFLFKWGFIPTDFDFDAWVEPAPLRA
FT                   ALARRDATMRATA"
FT                   /protein_id="YP_003609254.1"
FT   misc_feature    301511..302503
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components [Inorganic ion transport
FT                   and metabolism]; Region: TauA; COG0715"
FT                   /db_xref="CDD:31059"
FT                   /locus_tag="BC1002_5859"
FT   gene            302610..304229
FT                   /db_xref="GeneID:9091238"
FT                   /locus_tag="BC1002_5860"
FT   CDS_pept        302610..304229
FT                   /locus_tag="BC1002_5860"
FT                   /gene_family="HOG000164957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_C0146 peptide/opine/nickel ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680681"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="GeneID:9091238"
FT                   /translation="MAYVTSQAAPRRGGARLVNGALGFAAALLVALSVSHAHAQTRGGT
FT                   LNFVVTPEPTALVDLATTATNVLKVSPKVVEGLLEYDFRLQPKASLATSWEVSDDRRKY
FT                   VFHLRHDVKWHDGQPFTSADVAYSIQTLRQVHPRAKTTFANVTAVTTPDPYTVVVTLSK
FT                   SAPYLIKAFSSSETPIVPKHIYEGTDPLTNPANNAPIGTGPFRFVKWVRGSYVEYARND
FT                   DYWDKGKPLLDRIVVKVITDPAARTVALEDGSVDLSGDTPVPLSDIERLKSNPKLALDQ
FT                   RGYEFQAGVTRIEFNLDNPVLKNLAVRQAIASALDRDVIRKVIFYGYATPLASPIIPTS
FT                   PYYDPAPTPYPFNVERANALLDEAGYPRKADGTRFALTVDPLPIGDLPTRTAAYVKSAL
FT                   ARVGIAVTVRSQDLPAYLKRIYTDRDFDFSINGMSNLFDPVVGVARLYTSNNFRRGVPF
FT                   TNGSHYSNPLIDLLFTQVAEETDEGRRKQLFSQIQRILEHDLPDINLVSPQYLTVYSRA
FT                   VHNHTTGPDGVSASFADVWLQR"
FT                   /protein_id="YP_003609255.1"
FT   misc_feature    302727..304223
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="BC1002_5860"
FT   misc_feature    302736..304172
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_13; cd08517"
FT                   /db_xref="CDD:173882"
FT                   /locus_tag="BC1002_5860"
FT   gene            304268..305317
FT                   /db_xref="GeneID:9091239"
FT                   /locus_tag="BC1002_5861"
FT   CDS_pept        304268..305317
FT                   /locus_tag="BC1002_5861"
FT                   /gene_family="HOG000250270" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /codon_start="1"
FT                   /product="aldo/keto reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldo/keto reductase; KEGG: avi:Avi_7188
FT                   aldo/keto reductase"
FT                   /db_xref="GI:295680682"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="GeneID:9091239"
FT                   /translation="MEYRQLGRSGIKVSTLTLGTMMFGGPTDEATAARIIEQALEQGVN
FT                   SIDTADVYVKGESERVVGRAISAQRERWVLATKFANPLDERDVNARGASRKHIVRAVDA
FT                   SLQRLGTDYIDLLYIHREDHQTPVEETVRALNELIRAGKLRYYGLSNHRAWKIAEFSHT
FT                   AQALGLDAPVASQPLYNVANRQAEAEQLTAAHRYGLGVISYSPLARGVLTGKYEPGATP
FT                   GADTRAGRSDRRLQQTEWRPESLELARRVREHAQARGLSAGQFALAWVLNSRYISSTIA
FT                   GPRTEAQWQDYLPALAYRLNAEDEAFVDSLVTSGHPSTPGFNDPGHPFFGRRVRHGAVQ
FT                   PVQTPLQQG"
FT                   /protein_id="YP_003609256.1"
FT   misc_feature    304274..305200
FT                   /note="Aldo-keto reductases (AKRs) are a superfamily of
FT                   soluble NAD(P)(H) oxidoreductases whose chief purpose is to
FT                   reduce aldehydes and ketones to primary and secondary
FT                   alcohols. AKRs are present in all phyla and are of
FT                   importance to both health and...; Region: Aldo_ket_red;
FT                   cd06660"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_5861"
FT   misc_feature    order(304322..304330,304409..304411,304424..304426,
FT                   304499..304501,304625..304630,304715..304720,
FT                   304793..304795,304877..304894,305054..305056,
FT                   305105..305116,305129..305131,305138..305143)
FT                   /note="active site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_5861"
FT   misc_feature    order(304409..304411,304424..304426,304499..304501,
FT                   304625..304627)
FT                   /note="catalytic tetrad; other site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="BC1002_5861"
FT   gene            305320..306963
FT                   /db_xref="GeneID:9091240"
FT                   /locus_tag="BC1002_5862"
FT   CDS_pept        305320..306963
FT                   /locus_tag="BC1002_5862"
FT                   /gene_family="HOG000164957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bbt:BBta_4877 putative ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="GI:295680683"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091240"
FT                   /translation="MRLDRRHFIQSSLALLCAGALDSSVRLAHAGSAAASSSALAGTNA
FT                   APVQGGTLTYAVQQEPPSLVSLLDTNTVIRNISAKITEGLLRYDAQFRPQPLLAIAWST
FT                   SADGLYYTFRLRPGVRWHDGENFTSADVRYSILTQKRLGPRGRITLANVERVDTPDPLT
FT                   AVIVLGKPTPYLIKALSSAELPIVPQHRYGDGDPLTSPNLSAPIGTGPFVFDEWVRGSH
FT                   ISLRRNANYWRAGAPHLDRVVYRIVPDQASISAALETGEVDAAANVGLADLGRLAKVPY
FT                   LKIDDSYDAYLNNAAFLEFNLENPVLAQLPVRKAIAHAIDRNFIKDHVFYRRASVVDSP
FT                   VPAVLAAYYDDSTFHYPFDIDAANRQLDAAGYPKQADGQRFALKINYISGADFRHAAEY
FT                   LRAALARIGIKATILDGDLPTYLRRAYTAREFDLNLNGLGRLYDPTVGVQRIYWSDGVR
FT                   HPLIWINASHYQNPQVDELFRAAAIETDETRRAAAFREVQQIVGRDLPVLPLVTVPSAL
FT                   QVYHARVHNLNNSIDLTAGDFSDTWIEPKT"
FT                   /protein_id="YP_003609257.1"
FT   sig_peptide     305320..305412
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.351 at
FT                   residue 31"
FT                   /locus_tag="BC1002_5862"
FT   misc_feature    305467..306951
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="BC1002_5862"
FT   misc_feature    305467..306900
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_13; cd08517"
FT                   /db_xref="CDD:173882"
FT                   /locus_tag="BC1002_5862"
FT   gene            306987..308484
FT                   /db_xref="GeneID:9091241"
FT                   /locus_tag="BC1002_5863"
FT                   /pseudo
FT   gene            complement(308512..310248)
FT                   /db_xref="GeneID:9091242"
FT                   /locus_tag="BC1002_5864"
FT   CDS_pept        complement(308512..310248)
FT                   /locus_tag="BC1002_5864"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B1562 ABC peptide transporter,
FT                   duplicated ATPase subunits; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:295680684"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091242"
FT                   /translation="MANLLEVRDLRVSFGMHEAVRGLSFDIAQGETLALVGESGCGKSA
FT                   TALSLMRLVAAPGRVTGSLRFDGHELLDLSPREIRQVRGQQISMIFQEPMTSLNPVLSI
FT                   GAQIVEALRQHEDLSKAAASKRAVELLELVQIPEPQRRVFDYPHELSGGQRQRVMIAMA
FT                   VACRPRLLIADEPTTALDVTIQAHILELLDGLRRELSMSLLLITHDLGVVAKHADRVAV
FT                   MLAGEKVEEAPVARLFTQPQHPYTRGLLGASLNLADDLHYRGWKLPEIRHGIAEDGGPS
FT                   FTVLPRSPRPGLHVADVKADAHSNASSEGNAVSATPLLELQDLRVDYPQRRGQPALHAV
FT                   DGVSLTIARGETVGLVGESGCGKSTLSKAILRLVPTAAGAIRLRGTDLAPLGERELRPL
FT                   RRHVQMVFQDPYSSINPRRTVAEILDTVLVVNRIGNAQQRRTRIAAMLDRVGLPSSALG
FT                   RYPHEFSGGQRQRIGIARALVLEPDLLICDEPVSALDVSIQAQILNLLVDLKRDLGLAY
FT                   LFISHDLSVVRYIADRVHVMQAGRIVESGDHRDIWRAPQHPYTRTLLDAIPGKTFDDAR
FT                   AA"
FT                   /protein_id="YP_003609258.1"
FT   misc_feature    complement(308542..310248)
FT                   /note="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase [General function
FT                   prediction only]; Region: COG1123"
FT                   /db_xref="CDD:31320"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309553..310239)
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(310117..310140)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(order(309625..309627,309724..309729,
FT                   309973..309975,310114..310122,310126..310131))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309973..309984)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309772..309801)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309724..309741)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309706..309717)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309619..309639)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(<309493..309564)
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(308611..309297)
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309157..309180)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(order(308683..308685,308782..308787,
FT                   309025..309027,309154..309162,309166..309171))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(309025..309036)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(308830..308859)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(308782..308799)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(308764..308775)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(308677..308697)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="BC1002_5864"
FT   misc_feature    complement(<308545..308622)
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="BC1002_5864"
FT   gene            complement(310294..311274)
FT                   /db_xref="GeneID:9091243"
FT                   /locus_tag="BC1002_5865"
FT   CDS_pept        complement(310294..311274)
FT                   /locus_tag="BC1002_5865"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B1563 ABC peptide
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:295680685"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091243"
FT                   /translation="MASDSSNLVSPPPEPRASTWRRQLGGALFGFRRDGAATATNHAPH
FT                   GAAGLGVWRALLRNRSALGGFALLAAFIALALGAGHLYPGDPLDMVAAPFVWPGTDPQY
FT                   WLGTDSLGRDVAAGIAHGARVSLLIGASAASIGLVIGTLVGATGGFFGGVIDDVLVRIT
FT                   ELFQTIPSFLLVIVIVAIGHPSVTIIALAIGIASWPTVARIVRAEFRSLRRSDFVLAAR
FT                   SQGFSNARIIFGEILPNALPPVIVTASVMVASAILIESSLSFLGMGDPNVVSWGGMIGA
FT                   GRDSLRTAWYLTAVPGAAIVLAVLALNLLGDGLNDALNPRLRERA"
FT                   /protein_id="YP_003609259.1"
FT   misc_feature    complement(310441..310908)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5865"
FT   misc_feature    complement(order(310441..310446,310483..310488,
FT                   310495..310506,310525..310527,310534..310539,
FT                   310579..310581,310630..310632,310639..310644,
FT                   310654..310656,310660..310665,310672..310674,
FT                   310678..310680,310684..310689,310738..310740,
FT                   310744..310749,310756..310785,310789..310800,
FT                   310828..310830,310843..310848,310855..310860))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5865"
FT   misc_feature    complement(order(310489..310506,310738..310782))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5865"
FT   misc_feature    complement(order(310441..310443,310450..310452,
FT                   310486..310488,310702..310704,310738..310740))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5865"
FT   misc_feature    complement(order(310558..310560,310570..310575,
FT                   310591..310629))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5865"
FT   gene            complement(311310..312290)
FT                   /db_xref="GeneID:9091244"
FT                   /locus_tag="BC1002_5866"
FT   CDS_pept        complement(311310..312290)
FT                   /locus_tag="BC1002_5866"
FT                   /gene_family="HOG000170251" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B1564 ABC peptide
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:295680686"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9091244"
FT                   /translation="MSRGLRFAAIARRTACQALPTVIGIVILNFFLLKLMPGDAADVLA
FT                   GEAGSATVETMQVLRAKFGLDQPVLHQLWSYLAHLSHFSLGYSPRYDMPVMQLILSRLP
FT                   NTLLLMGVALSVAIVVGVVLGVVMAHWAGRWPDRVLSVVAMLFYSTPGFWIGLLAIVLF
FT                   SVHLGWLPSGGNITLGAQLHGAAYVIDALKHVLLPAATLATFFIAIYARLTRAAMLEVQ
FT                   RQDFVRTAQAKGLHPWRVTVRHVLRNALMPLTTMIGIHFGTLLGGAAVTETVFSWPGLG
FT                   RLALDAVMARDFSVLLGVLLLSSMLVILANVLVDLLQAWLDPRVA"
FT                   /protein_id="YP_003609260.1"
FT   misc_feature    complement(311430..311894)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5866"
FT   misc_feature    complement(order(311442..311447,311472..311477,
FT                   311484..311495,311514..311516,311523..311528,
FT                   311568..311570,311619..311621,311628..311633,
FT                   311643..311645,311649..311654,311661..311663,
FT                   311667..311669,311673..311678,311811..311813,
FT                   311817..311822,311829..311858,311862..311873))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5866"
FT   misc_feature    complement(order(311478..311495,311811..311855))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5866"
FT   misc_feature    complement(order(311442..311444,311451..311453,
FT                   311475..311477,311691..311693,311811..311813))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5866"
FT   misc_feature    complement(order(311547..311549,311559..311564,
FT                   311580..311618))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="BC1002_5866"
FT   gene            complement(312304..313908)
FT                   /db_xref="GeneID:9091245"
FT                   /locus_tag="BC1002_5867"
FT   CDS_pept        complement(312304..313908)
FT                   /locus_tag="BC1002_5867"
FT                   /gene_family="HOG000164957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_B1565 ABC peptide transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="GI:295680687"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091245"
FT                   /translation="MARLNRRDFLISSGAALAAAGMPARVFAQGSAASPKRGGTLNMLI
FT                   NPEPPVLVSIFQTTGPALVASSKVLEGLLAYDFDLRPRPQLATAWAVSPDGLKYSFTLR
FT                   ENVKWHDGQPFTSTDVAFSIELLKTVHPRGRSTFANVTRVSTPDARTAVIELSKPAPYL
FT                   LKALSAGESPIVPKHLYASGDPLSNPHNNAPIGTGPFRFKSWTRGANIVYERNPDYWDA
FT                   GKPYIDSLVLKVIPDAAARSAAFETGALDLGGENPVPLTDLPRLTQLPQLVVETRGYRF
FT                   LEPLSEIDFNLQHPILSDLRVRQAIAHAINPQVVLRTVAYGYADLSPTPITPGSPYHDG
FT                   KLAPYPFDTAAAEKLLDAAGYPRKSAGVRFGLTHDFLPYGDMYRRQADYVKSALSRVGI
FT                   DVTVRSQDLPAFLKRVYADRQFDFTSIGVNTLFDPSVGVQRLYWSQNIRPGVPFSNAPH
FT                   YSNAEVDRLLESAAIETDESKRVALYQQFQQIVYRELPILNLVAPRMVTLANRRVHNHT
FT                   VSAQGLEGNLADVYLSA"
FT                   /protein_id="YP_003609261.1"
FT   misc_feature    complement(312316..313908)
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="BC1002_5867"
FT   sig_peptide     complement(313822..313908)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 29"
FT                   /locus_tag="BC1002_5867"
FT   misc_feature    complement(312361..313797)
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_13; cd08517"
FT                   /db_xref="CDD:173882"
FT                   /locus_tag="BC1002_5867"
FT   gene            314203..315033
FT                   /db_xref="GeneID:9091246"
FT                   /locus_tag="BC1002_5868"
FT   CDS_pept        314203..315033
FT                   /locus_tag="BC1002_5868"
FT                   /gene_family="HOG000286585" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dac:Daci_1059 hypothetical
FT                   protein"
FT                   /db_xref="GI:295680688"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9091246"
FT                   /translation="MSLSIDHIVIRVQDLEQTIADFTTLGFTVQRGGTHADGATHNALI
FT                   GFADGSYVELIAFLRDAPEHRWWDASRRIGDGFVDYALLPQSVASTIAAARERGLSYDG
FT                   PLAGGRLRPDGERLEWQIGKPSSADLPFLCGDVTPRHLRVAEGDVRHHANGAHGVANIT
FT                   LAVHDLDASLARYRALLGELDVQRAPLPGYDVALAILSLGATTLTLASPTRETRPPAEG
FT                   LAADLRHHLASRGEGVFAVALETYVDGAARRLERTLAHGAIIELVANPSIRRDR"
FT                   /protein_id="YP_003609262.1"
FT   misc_feature    314221..314559
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cl14632"
FT                   /db_xref="CDD:176840"
FT                   /locus_tag="BC1002_5868"
FT   gene            complement(315074..315874)
FT                   /db_xref="GeneID:9091247"
FT                   /locus_tag="BC1002_5869"
FT   CDS_pept        complement(315074..315874)
FT                   /locus_tag="BC1002_5869"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0098 branched chain amino acid ABC
FT                   transporter ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:295680689"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091247"
FT                   /translation="MKTSSQHLVEPNPLPSAQAAMTEPLLNLEQIDTFYGQIQVHFGVN
FT                   LSIARGEIVSLLGGNASGKSTAMKVILGLHKPRAGTISFDGKPLNDLPTSHVVRRGIAS
FT                   VPEARRLFGDMTVRENLLMGAFTRNDRAGISEDYERMLELFPRVKERLTQRAGTLSGGE
FT                   QQMLAMARALMSRPALVCMDEPTMGLSPLYVDKVLDLIQTVNQQGITFFMVEQNASLAL
FT                   QIAHRGYVLQTGRVVLSGTASELLGDQRIRDAYLGGSLAAQTAS"
FT                   /protein_id="YP_003609263.1"
FT   misc_feature    complement(315101..315808)
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivF; COG0410"
FT                   /db_xref="CDD:30759"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315131..315799)
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315680..315703)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(order(315227..315229,315323..315328,
FT                   315554..315556,315677..315685,315689..315694))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315554..315565)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315371..315400)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315323..315340)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315305..315316)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   misc_feature    complement(315221..315241)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5869"
FT   gene            complement(315871..316740)
FT                   /db_xref="GeneID:9091248"
FT                   /locus_tag="BC1002_5870"
FT   CDS_pept        complement(315871..316740)
FT                   /locus_tag="BC1002_5870"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0097 branched chain amino acid ABC
FT                   transporter ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:295680690"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9091248"
FT                   /translation="MTSSLPRGADMLFDVRRVTRRFGGLVAVDEVSLSVARGECVSVIG
FT                   PNGAGKSTLFNLLTGIDAPDAGEVRFAGEDVTGMAPEQLAARGVARTFQHGRVFGNLSV
FT                   LDNVLIGAHARLAMTRRGWPVVGAFAEVLRALARPASVRREDAALREEVTTLLARFGTR
FT                   LLPRIDQPAHSLSYANRRRVEIARALALRPRILLLDEPTAGMNESETAEMLELILQLKH
FT                   DGLTILLIEHKLDLVMQLSDRVLVLEDGRKIASGLPAEVRDDPAVIEAYLGHRQVGATT
FT                   GRKETAAA"
FT                   /protein_id="YP_003609264.1"
FT   misc_feature    complement(315922..316716)
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(315940..316701)
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316585..316608)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(order(316045..316047,316141..316146,
FT                   316459..316461,316582..316590,316594..316599))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316459..316470)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316189..316218)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316141..316158)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316123..316134)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   misc_feature    complement(316039..316059)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5870"
FT   gene            complement(316752..318575)
FT                   /db_xref="GeneID:9091249"
FT                   /locus_tag="BC1002_5871"
FT   CDS_pept        complement(316752..318575)
FT                   /locus_tag="BC1002_5871"
FT                   /gene_family="HOG000138265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_C0096 branched chain amino acid ABC transporter
FT                   inner membrane protein"
FT                   /db_xref="GI:295680691"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9091249"
FT                   /translation="MTAWFDYTINGLIVGNIYALLAVGLALIFGVSHLINFAHGSVYMV
FT                   GGFIGWLCLTRLGLPLPVALLATVAGCALLGILIERIGLRPLQGAARIAPLLATIGISF
FT                   VLDQLAQIVFGPDPRPVPSSLPDWTLSIGGATIGSLDLLIAAIGIGAAGVLYLFLRFTR
FT                   LGWAVRATAQDRDAAQQMGVNVNAVNQAVFAIACGLGGLSGLLVGMYYNSIDPAMGFQA
FT                   TLKGVVALLIGGLGNVPGAIAGSLLLGLVESYGVALFGTSYRDLFAFVLLLAFLVWRPN
FT                   GLFSANRRLPPEPLTGTFLSNRRALHVPRRTIVALVALAFVLPLVVPSSYVLQTLTNGW
FT                   IYGLLALSLTLVAGTVGQISLGHAALLLIGAYASALLSVNLGWSPALTIPLAGLITAAI
FT                   GTVLIYPSFRLRGHYVSIATLGIGEIIGLVVLNWDSLTRGPVGITGIVPLSLFGWQLTG
FT                   VRAVYWFTLAVLVLLALLQARLLHSHLGRTWRAIREDDVAARAYGIRPNRYKAIAFACG
FT                   GLAAGIGGGIAAHLYSYINYQTFDSQVSILALTMVILGGLGSVIGAVAGAVALISLPEL
FT                   FRFAADYRMLIYGMILLLLVRFRPQGLFGSV"
FT                   /protein_id="YP_003609265.1"
FT   misc_feature    complement(317724..318545)
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="BC1002_5871"
FT   misc_feature    complement(317994..318050)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="BC1002_5871"
FT   misc_feature    complement(316761..317555)
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="BC1002_5871"
FT   misc_feature    complement(317031..317087)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="BC1002_5871"
FT   gene            complement(318572..319750)
FT                   /db_xref="GeneID:9091250"
FT                   /locus_tag="BC1002_5872"
FT   CDS_pept        complement(318572..319750)
FT                   /locus_tag="BC1002_5872"
FT                   /gene_family="HOG000138154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_C0095 branched chain amino acid ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680692"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:9091250"
FT                   /translation="MAILWNNKRGAIRSLLHLAGALALATCGVMPVAHAADPYWVGVTG
FT                   PLSGQDAQYGEQWKRGFDLALEQINGNGGINGHPLSYEFEDSRSDPRQAVAIAQKFADD
FT                   KRILLELGDLSSGASMAASPVYQRAGLVQFGFTNSHPDFTKGGDYMWSTAISQAEEQPL
FT                   LAHYVTKGLGFRKIAVLYLNTDWGRTSKDIFAKAATADGAQVVAAEAYQPNEKDFRATL
FT                   TRVRSEQPDSIVLISYYSDGAQIVRQARAAGVSTPIAAVGSVYSPKFLDLGGPAVNGVY
FT                   TESNFFPGDPHPEVQSFVQRYRAKYGTDPDTFAARAYDAMILAAEVIRRYGADRAAVHD
FT                   GFAKINDVPSVIFGKFKFDPQTRRVAGAKNLELVVKDGKFALWDGASAVHTP"
FT                   /protein_id="YP_003609266.1"
FT   sig_peptide     complement(319643..319750)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 36"
FT                   /locus_tag="BC1002_5872"
FT   misc_feature    complement(318611..319663)
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="BC1002_5872"
FT   misc_feature    complement(318611..319633)
FT                   /note="Type I periplasmic ligand-binding domain of
FT                   uncharacterized ABC (Atpase Binding Cassette)-type active
FT                   transport systems; Region: PBP1_ABC_ligand_binding_like_14;
FT                   cd06349"
FT                   /db_xref="CDD:107344"
FT                   /locus_tag="BC1002_5872"
FT   misc_feature    complement(order(318965..318967,319037..319039,
FT                   319193..319195,319334..319342,319403..319411))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107344"
FT                   /locus_tag="BC1002_5872"
FT   gene            320088..321098
FT                   /db_xref="GeneID:9091251"
FT                   /locus_tag="BC1002_5873"
FT   CDS_pept        320088..321098
FT                   /locus_tag="BC1002_5873"
FT                   /gene_family="HOG000138043" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_C0094 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680693"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091251"
FT                   /translation="MELHQLEAFSAVMSTGSMTGAARLLGRSQPGVTRTIQDLEQEIGY
FT                   ALFDRKGPRVTPTSRAFRLYGEVERSLIGLAAIEASARAIGQDESMPLRVVATPALAAA
FT                   LAPRAISKLAQASTRVDTQLRSASAEQVVEALLSRSADIGIATLPLDHAALDVHYIIEA
FT                   PCVAVLHRNDPLAHDAVLRLARLAGQPVATLANRYRLRSRIDRAFDEAGVALHIALETN
FT                   ASLNAMMAAQQQIGVAIVDPVTAFGMRLADVEVRPLDVPIPFLYGVVTLSGQPRSDDVN
FT                   AMIGVLAQVSRELLPGAVRHAASRHGALVAHDRTDSAKTVTHSPTFTHRDIGATA"
FT                   /protein_id="YP_003609267.1"
FT   misc_feature    320094..320969
FT                   /note="DNA-binding transcriptional regulator LysR;
FT                   Provisional; Region: PRK11013"
FT                   /db_xref="CDD:170885"
FT                   /locus_tag="BC1002_5873"
FT   misc_feature    320094..320270
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5873"
FT   misc_feature    320442..320948
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5873"
FT   misc_feature    order(320445..320465,320739..320756,320772..320777,
FT                   320781..320786)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5873"
FT   gene            321095..322600
FT                   /db_xref="GeneID:9091252"
FT                   /locus_tag="BC1002_5874"
FT   CDS_pept        321095..322600
FT                   /locus_tag="BC1002_5874"
FT                   /gene_family="HOG000138042" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bxe:Bxe_C0093
FT                   putative oxidoreductase"
FT                   /db_xref="GI:295680694"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9091252"
FT                   /translation="MNPTTSCHPAAGLTALEARLREDLAWLELPAPSWVPARTSAGQRV
FT                   LDVAIIGAGMAGLTASAELRLLGIDNQRLFDQAPAGQEGPWVTYARMQTLRSPKQLTGP
FT                   ALRLPALTFRAWYEAQFGREQWHALYKIPRAQWMDYLRWYRRVLDLPVSNDTRVEKLQT
FT                   RSDGLIELVLSRGAVNGSKDARRETVLARHVVLATGREGLGGPYVPDVARDIPRHLRAH
FT                   SSDPIDFAALRGKRVGVVGASASAFDNAASALEAGAGRVDLFVRRAALPRINKLTGIGS
FT                   PGLVHGFANLPDAWKWRFLHYSAQTQAPPPRDSVLRVAAHPQAHLHLASPLTGLRHEGD
FT                   TIVVDTPRGRYTLDYLIFATGFHSEIDTRDEFAPIAPHVRRWRDRFTPAAELPNEELAS
FT                   SPDLDRNFAFQERVPGACPALARIHCFNHAASLTHGKVAGDIPAISDGAQRLARAIAAM
FT                   LFDADRDAHYAALQAFDTAELAGDEWGDADAAAGTVPADTPAL"
FT                   /protein_id="YP_003609268.1"
FT   misc_feature    321206..322513
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="BC1002_5874"
FT   misc_feature    <322040..>322177
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5874"
FT   gene            322615..323181
FT                   /db_xref="GeneID:9091253"
FT                   /locus_tag="BC1002_5875"
FT   CDS_pept        322615..323181
FT                   /locus_tag="BC1002_5875"
FT                   /gene_family="HOG000137821" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0092"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0092 hypothetical protein"
FT                   /db_xref="GI:295680695"
FT                   /db_xref="GeneID:9091253"
FT                   /translation="MSSSADSLSATVADDFVAQLAGLAPDGVTAALRAFRGDATRYTQG
FT                   SHDALFSTDVADLTLRERLFAAWYAALLSNSEQTVLAYRERLLTLAAAADAQTETTRSL
FT                   LDAIAAQRAVPVASMATTDQRLVAILRHTEALTLRPAATGKPALATLQAGGLTTRAIVA
FT                   LSQLVAFVTYQVRVVAALRALEARA"
FT                   /protein_id="YP_003609269.1"
FT   misc_feature    322633..323136
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_5875"
FT   gene            323178..323753
FT                   /db_xref="GeneID:9091254"
FT                   /locus_tag="BC1002_5876"
FT   CDS_pept        323178..323753
FT                   /locus_tag="BC1002_5876"
FT                   /gene_family="HOG000137819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /codon_start="1"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0091 alkylhydroperoxidase-related;
FT                   TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="GI:295680696"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="GeneID:9091254"
FT                   /translation="MSSDHGFTTQTLGWSAWLDTVALEQASPEQTAVLEASHPQAKTSD
FT                   YYLLLVHEAEILRQRSGAFNSIMYAPGGLSRAERELASTVVSRVNGCVYCASVHAQRFQ
FT                   QLAKREDVIQQIFAAPETAGTTERERAIVRYAIDLTLHPQALTEESLDALRRVGLDDAQ
FT                   ILDLSHAIAIFAWANRLMLTLGEPVFPA"
FT                   /protein_id="YP_003609270.1"
FT   misc_feature    323223..323747
FT                   /note="uncharacterized peroxidase-related enzyme; Region:
FT                   peroxid_rel; TIGR01926"
FT                   /db_xref="CDD:130981"
FT                   /locus_tag="BC1002_5876"
FT   misc_feature    323364..323591
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="BC1002_5876"
FT   gene            323882..325057
FT                   /db_xref="GeneID:9091255"
FT                   /locus_tag="BC1002_5877"
FT   CDS_pept        323882..325057
FT                   /locus_tag="BC1002_5877"
FT                   /gene_family="HOG000138154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_C0090 branched chain amino acid ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680697"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9091255"
FT                   /translation="MSASRFSALHRRLFVVAGAAFALSLSAVSSAAPASGEPVFFGVSG
FT                   PLTGPNAQYGAQWKAGFDLALDEINRDGGIDGHPLQYVFEDSQSDPRQAVAIAQKFVDD
FT                   KRILIELGDFSSPASMAASPIYQRAGLVQLGFTNSHPDFTKGGDFIWSPSVSQADAQPL
FT                   LADLAVKQGFRHVAVLFQNTDWGRASKDVFVKAAAARGAQVIAAEGYQPNDKDFRATLL
FT                   RVRDTKPDALVLISYYSDGAQIVRQARTSGITLPIVAASSVYSPKFMELGGDAVNGVTT
FT                   NTSFFPGDRSPEVQRFVRDFQAKYHHEPDAFNAFAYDATIIAAYALRTGGLDRRGVRDA
FT                   LAKLHDVPSVVFGKATFDPATRRVIGVKSVNLVVENGRWALLGSKPALAAR"
FT                   /protein_id="YP_003609271.1"
FT   sig_peptide     323882..323977
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 32"
FT                   /locus_tag="BC1002_5877"
FT   misc_feature    323990..325012
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="BC1002_5877"
FT   misc_feature    324002..325018
FT                   /note="Type I periplasmic ligand-binding domain of
FT                   uncharacterized ABC (Atpase Binding Cassette)-type active
FT                   transport systems; Region: PBP1_ABC_ligand_binding_like_14;
FT                   cd06349"
FT                   /db_xref="CDD:107344"
FT                   /locus_tag="BC1002_5877"
FT   misc_feature    order(324221..324229,324290..324298,324434..324436,
FT                   324590..324592,324662..324664)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107344"
FT                   /locus_tag="BC1002_5877"
FT   gene            complement(325111..326433)
FT                   /db_xref="GeneID:9091256"
FT                   /locus_tag="BC1002_5878"
FT   CDS_pept        complement(325111..326433)
FT                   /locus_tag="BC1002_5878"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2176"
FT                   /codon_start="1"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2176 nitrilotriacetate monooxygenase
FT                   component A"
FT                   /db_xref="GI:295680698"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091256"
FT                   /translation="MSRQLRLGAFMRPTTIHTGAWRYPGAYPDANFNFGHLKRFAQTLE
FT                   RGRFDAFFMADHLAVLNMPLDALRHSHTVTSFEPLTLLPALAAVTERLGLVATASTTFD
FT                   APYHVARRFASLDHISGGRAGWNLVTTSNPDAALNFGLDEHVEHDERYRRAREFFDVVT
FT                   GLWDSWADDAFIRDTASGTFFDPQKLHVLNYKSANFSVRGPLNIARPIQGWPVIVQAGS
FT                   SEAGRQIAAETAEVVFTAQTTLADGKRFYADVKSRMEKLGRSRDHMKILPAAFVVVGDT
FT                   LEEARETRERLDTFVHYESGIASLSIALGHDVSGLDPDGPLPEIPETNASRTARQRVVE
FT                   WAQRDGLTIRQLAQRIGGYSGLEMIGTARMIADQMEQWLLEEGSDGFNVMFSHLPAGLD
FT                   DFVDKVIPELQKRGLFRREYEGKTLRENLGLPRPENRFFSA"
FT                   /protein_id="YP_003609272.1"
FT   misc_feature    complement(325189..326421)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5878"
FT   misc_feature    complement(325153..326415)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5878"
FT   misc_feature    complement(order(325759..325764,325981..325983,
FT                   326047..326049,326206..326208,326392..326394,
FT                   326404..326406))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5878"
FT   misc_feature    complement(326137..326142)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5878"
FT   gene            326722..327012
FT                   /db_xref="GeneID:9091257"
FT                   /locus_tag="BC1002_5879"
FT   CDS_pept        326722..327012
FT                   /locus_tag="BC1002_5879"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /codon_start="1"
FT                   /product="Chaperonin Cpn10"
FT                   /transl_table="11"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: bpd:BURPS668_A0737
FT                   co-chaperonin GroES"
FT                   /db_xref="GI:295680699"
FT                   /db_xref="InterPro:IPR001476"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="GeneID:9091257"
FT                   /translation="MSLRPLHDRVIVKRLGQESRTASGIVIPDSAAEKPDQGEILAVGP
FT                   GRRGDDGKRVEPDLQVGDRVLFGKYAGQAVKVDGDELLVLREEDIVAVVQI"
FT                   /protein_id="YP_003609273.1"
FT   misc_feature    326725..327003
FT                   /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
FT                   cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
FT                   to assist the folding and assembly of proteins and is found
FT                   in eubacterial cytosol, as well as in the matrix of
FT                   mitochondria and chloroplasts...; Region: cpn10; cd00320"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5879"
FT   misc_feature    order(326725..326727,326731..326733,326737..326739,
FT                   326746..326748,326827..326832,326893..326895,
FT                   326923..326925,326938..326940,326944..326946,
FT                   326992..327000)
FT                   /note="oligomerisation interface; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5879"
FT   misc_feature    326773..326814
FT                   /note="mobile loop; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5879"
FT   misc_feature    order(326854..326856,326887..326889)
FT                   /note="roof hairpin; other site"
FT                   /db_xref="CDD:73192"
FT                   /locus_tag="BC1002_5879"
FT   gene            327026..328666
FT                   /db_xref="GeneID:9091258"
FT                   /locus_tag="BC1002_5880"
FT   CDS_pept        327026..328666
FT                   /locus_tag="BC1002_5880"
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /codon_start="1"
FT                   /product="chaperonin GroEL"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_A2030 chaperonin GroEL;
FT                   TIGRFAM: chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="GI:295680700"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="GeneID:9091258"
FT                   /translation="MAAKEVAFSDNARSKLVEGVNLLANAVKVTLGPKGRNVVLERSFG
FT                   SPVVTKDGVSVAKEIELADKVQNIGAQLVKEVASKTSDAAGDGTTTATVLAQAIVREGQ
FT                   KYVAAGLNPLDLKRGIDKAVAAAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIA
FT                   EAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNQDRQLAALEQPFVLL
FT                   HDKKISNIRDLLPILEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGEATRIEVGKENTTVIDGAGEKA
FT                   NIEARVKQIRAQIAEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALIRVKQAIAALQGANADQNAGINIVRRALEEPLRQIVANA
FT                   GEEPSVIVARVAEGSGNYGYNAATGEYGDLVETGVVDPTKVTRTALQNAASVASLLLTT
FT                   DATVHEAPKDAAPAASPAGPGAGGPGFDY"
FT                   /protein_id="YP_003609274.1"
FT   misc_feature    327029..328594
FT                   /note="chaperonin GroEL; Reviewed; Region: groEL; PRK12849"
FT                   /db_xref="CDD:171768"
FT                   /locus_tag="BC1002_5880"
FT   misc_feature    327035..328594
FT                   /note="GroEL_like type I chaperonin. Chaperonins are
FT                   involved in productive folding of proteins. They share a
FT                   common general morphology, a double toroid of 2 stacked
FT                   rings, each composed of 7-9 subunits. The symmetry of type
FT                   I is seven-fold and they are found...; Region: GroEL;
FT                   cd03344"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5880"
FT   misc_feature    order(327035..327037,327047..327049,327098..327100,
FT                   327131..327142,327146..327148,327161..327166,
FT                   327170..327172,327200..327202,327206..327208,
FT                   327230..327232,327242..327244,327251..327253,
FT                   327614..327616,327710..327712,327794..327796,
FT                   328175..328177,328181..328183,328400..328402,
FT                   328562..328564,328571..328591)
FT                   /note="ring oligomerisation interface; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5880"
FT   misc_feature    order(327116..327124,327284..327286,327296..327298,
FT                   327473..327475,328217..328219,328268..328270,
FT                   328385..328387,328502..328504,328508..328510)
FT                   /note="ATP/Mg binding site; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5880"
FT   misc_feature    order(327350..327352,328325..328327,328379..328381,
FT                   328406..328408,328412..328417,328424..328426)
FT                   /note="stacking interactions; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5880"
FT   misc_feature    order(327446..327448,327581..327583,327602..327604,
FT                   328148..328150,328250..328255)
FT                   /note="hinge regions; other site"
FT                   /db_xref="CDD:48161"
FT                   /locus_tag="BC1002_5880"
FT   gene            complement(328801..330156)
FT                   /db_xref="GeneID:9091259"
FT                   /locus_tag="BC1002_5881"
FT   CDS_pept        complement(328801..330156)
FT                   /locus_tag="BC1002_5881"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /codon_start="1"
FT                   /product="Luciferase-like, subgroup"
FT                   /transl_table="11"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bxe:Bxe_A2175
FT                   nitrilotriacetate monooxygenase component A"
FT                   /db_xref="GI:295680701"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091259"
FT                   /translation="MSQRKGHLRLGAFLYPTGHHIAAWRHPDAHADAGRDLRHYVQLAQ
FT                   AAEAAKFDLIFLADGSGTRGDNVDFLSRTAHSYVAQFEPITLLSALAGLTERIGLVGTA
FT                   STTFNEPYHIARKFASLDHISAGRAGWNLVTSSSAHEAKNFGFDDHLAHARRYERAVEF
FT                   AEVVDGLWDSWDDDAFVRDKAAGRYFDPAKRHVLDHRGEFFNVRGPLNVERSPQGRPVV
FT                   VQAGSSEAGKALAARTAEVIFTAQQTLEDAVAFYADVKGRLAQYGREPDDLKIMPGVMP
FT                   IVGETEREAREKFDALQALIDPAVGLALVSTLTGGFDLSGYPLDGPIPELPETNASKSR
FT                   QSLTLELARRENLTIRELYLRVAGARGHWQLVGTPQQIADALEERFVNYGADGYNVMPA
FT                   LLPNSLDDFIRLVLPELRRRGLFRHEYEGRTLREHLGLRHPVSRYQRETVTD"
FT                   /protein_id="YP_003609275.1"
FT   misc_feature    complement(328891..330135)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5881"
FT   misc_feature    complement(328855..330129)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5881"
FT   misc_feature    complement(order(329467..329472,329689..329691,
FT                   329755..329757,329914..329916,330106..330108,
FT                   330118..330120))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5881"
FT   misc_feature    complement(329845..329850)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5881"
FT   gene            complement(330198..331547)
FT                   /db_xref="GeneID:9091260"
FT                   /locus_tag="BC1002_5882"
FT   CDS_pept        complement(330198..331547)
FT                   /locus_tag="BC1002_5882"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /codon_start="1"
FT                   /product="Luciferase-like, subgroup"
FT                   /transl_table="11"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bxe:Bxe_B1550
FT                   putative nitrilotriacetate monooxygenase subunit A"
FT                   /db_xref="GI:295680702"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="GeneID:9091260"
FT                   /translation="MSRLPARAARRRLHLNVNILHSGFVPSAWRLDEAEPRAFVDVDHY
FT                   VRVARIAEAGKLDAVFLADNAAIVDQIDFRPITALEPTVLLASIAAATTHIGVIGTAST
FT                   SYNEPYNIARRFATLDHVSNGRAGWNVVTTADLPSARNFGRDAVPNHAQRYERAAEFTE
FT                   VVKALWDSWEDDAFVGDKAGGRFVDVAKVHAIAHRGRYFDVQGPLNVPRSPQGHPVVVQ
FT                   AGASADGRELAARHAEAVFSASQSFEESAAYRRDLNERAAAYGRPPVKVLAGLTTIIGA
FT                   THSEALRRRDELVEQIPWRYSLNRLAGTLGIDVERLTLDAPLPDDLALPGGGNGNHTFF
FT                   HATLAEARRHGHTVRELIRALAGGTGHRVIVGTPEQIADDIERWFDGGAADGFNLMPDA
FT                   LPGGLRDFVDGVVPILQQRGIFRSEYEGTTLREHLGLDRPPNPQRWRDSA"
FT                   /protein_id="YP_003609276.1"
FT   misc_feature    complement(330249..331502)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="BC1002_5882"
FT   misc_feature    complement(330285..331490)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5882"
FT   misc_feature    complement(order(330864..330869,331086..331088,
FT                   331152..331154,331311..331313,331479..331481))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5882"
FT   misc_feature    complement(331242..331247)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="BC1002_5882"
FT   gene            complement(331569..331913)
FT                   /db_xref="GeneID:9091261"
FT                   /locus_tag="BC1002_5883"
FT   CDS_pept        complement(331569..331913)
FT                   /locus_tag="BC1002_5883"
FT                   /gene_family="HOG000268813" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0138"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0138 hypothetical protein"
FT                   /db_xref="GI:295680703"
FT                   /db_xref="GeneID:9091261"
FT                   /translation="MSRDLLILLEPGFTDPHHPGERFICPHGAPIEGLLASDPTRVGRL
FT                   DVLRVPFERPRKAVIEALDEAHQGLPALVFGDEQPAPADADSLGERRFVTDPRRILDLL
FT                   AERHGFPKVH"
FT                   /protein_id="YP_003609277.1"
FT   misc_feature    complement(331575..331910)
FT                   /note="Protein of unknown function (DUF3088); Region:
FT                   DUF3088; pfam11287"
FT                   /db_xref="CDD:151728"
FT                   /locus_tag="BC1002_5883"
FT   gene            complement(332018..333241)
FT                   /db_xref="GeneID:9091262"
FT                   /locus_tag="BC1002_5884"
FT   CDS_pept        complement(332018..333241)
FT                   /locus_tag="BC1002_5884"
FT                   /gene_family="HOG000219185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /codon_start="1"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bxe:Bxe_B1567 putative acyl-CoA dehydrogenase"
FT                   /db_xref="GI:295680704"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="GeneID:9091262"
FT                   /translation="MAESDQHTTAAHERLRAALASLPALAHALAQDAASREARRELPFD
FT                   GFALFRRSGLARLRLPLEWGGLGGSLEDEFEVIATLAAADSNLAHALRIHFDQVEALLL
FT                   SPRTPFNEIQIQRIADGAIFGGASTELGTARPGEITTQLRRDGAHYRLSGRKYYATGTA
FT                   FSDFARLNLQDENGDPVLAIVPVKREGLRVLDDWDGMGQRMTASGSLEFDNLLVRDDEV
FT                   TPRVQTTLVGRHGGALRQLHLVAVAAGIVRNVVADAKHYVLRHGRPALHSPAPSAREDS
FT                   FIQQVIGDLGAHSHTIDALVRDNARVLDRSARAIREGAADAPALVLEGALATARTQLVV
FT                   SKLALYAAERMFEAGGASATSRAHNYDRHWRNLRTIFNHNPLLHKARVIGDYELNGVTT
FT                   HLTEGRVF"
FT                   /protein_id="YP_003609278.1"
FT   misc_feature    complement(332039..333136)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="BC1002_5884"
FT   misc_feature    complement(332045..333136)
FT                   /note="Dibenzothiophene (DBT) desulfurization enzyme C;
FT                   Region: DszC; cd01163"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5884"
FT   misc_feature    complement(order(332762..332764,332768..332770))
FT                   /note="Flavin binding site; other site"
FT                   /db_xref="CDD:173852"
FT                   /locus_tag="BC1002_5884"
FT   gene            complement(333761..335350)
FT                   /db_xref="GeneID:9091263"
FT                   /locus_tag="BC1002_5885"
FT   CDS_pept        complement(333761..335350)
FT                   /locus_tag="BC1002_5885"
FT                   /gene_family="HOG000164957" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_C0161 peptide/opine/nickel ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="GI:295680705"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="GeneID:9091263"
FT                   /translation="MSMRNRWCGYAFGVLISSTMMCAGMLAAQAEPNHGGTLTWLVTPE
FT                   PASIVPLTTTAGGNAEIGPKVVEGLLTYDKNLNPQPLLATAWSVSKDGLEYRFTLRRGV
FT                   KWHDGKPFTSADVAFSILTLKQVHPRGRSTFANVTDVKTPDPYTAVIELSKPAPFLLTA
FT                   LAGTESPIIPKHLYDGTDIVSSPYNSAPVGTGPFIYKSFVHGSYILLERNPDYWDKPKP
FT                   YIDKILVRFLPDAAARAAALESGAANLGDQAIPLSDVKRFTTLPNFTVDTTNWPYVSNH
FT                   QQLIFNLDTPVLKDRAVRKAISQAVDVNALNRVVWYGYGQVSAAAIGAANTKYHDADIH
FT                   YFPYDVAQANAALDAAGLKRGPDGKRFKLRLLFNPFQDPRAADFVRQSLARIGIDGEVE
FT                   SYDFATYVKKAYTDRAFDITLEALSNAFDPTVGVQRVFWSKNFKVGLPFSNAAHYSSPE
FT                   VDRLLEAASVETDDAKRRQLFIQFQQLVHDDVPSIEFGANPNITIVAKKVKDYAPTGEG
FT                   IRGSFADLYIQP"
FT                   /protein_id="YP_003609279.1"
FT   sig_peptide     complement(335258..335350)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.929 at
FT                   residue 31"
FT                   /locus_tag="BC1002_5885"
FT   misc_feature    complement(333767..335323)
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="BC1002_5885"
FT   misc_feature    complement(333818..335248)
FT                   /note="The substrate-binding component of an
FT                   uncharacterized ABC-type nickel/dipeptide/oligopeptide-like
FT                   import system contains the type 2 periplasmic binding fold;
FT                   Region: PBP2_NikA_DppA_OppA_like_13; cd08517"
FT                   /db_xref="CDD:173882"
FT                   /locus_tag="BC1002_5885"
FT   gene            complement(335832..336683)
FT                   /db_xref="GeneID:9091264"
FT                   /locus_tag="BC1002_5886"
FT   CDS_pept        complement(335832..336683)
FT                   /locus_tag="BC1002_5886"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; KEGG: bpt:Bpet1279
FT                   LysR family transcriptional regulator"
FT                   /db_xref="GI:295680706"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:9091264"
FT                   /translation="MRSLESQLDVALFSRGRTGVEPTHAAFALALQVRQGLKVLERAFG
FT                   LSSARVVRRANASKGNTTLAISALPSFAARWLTPRLPRFHAEHPGITIDVRASVQLARL
FT                   DERDGIDVALRYGPGHWPGLASEKLMDEEVFPVASPAYRNGRLPRRLADLAQCTLLVQA
FT                   TQPWEPWFQAVTLALEVPADAPSFDDVSSMLNAAVGGAGIALARRSLVEAELADGRLIR
FT                   LWRRSIVDVHGNYIVWRADSKRLAAIDAFRAWLRREVVAAVPAEGRRPPAQPGVRGPTR
FT                   RY"
FT                   /protein_id="YP_003609280.1"
FT   misc_feature    complement(<336399..336674)
FT                   /note="DNA-binding transcriptional regulator LysR;
FT                   Provisional; Region: PRK11013"
FT                   /db_xref="CDD:170885"
FT                   /locus_tag="BC1002_5886"
FT   misc_feature    complement(335919..336497)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="BC1002_5886"
FT   misc_feature    complement(order(336393..336413,336417..336470,
FT                   336474..336497))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="BC1002_5886"
FT   misc_feature    complement(order(336054..336056,336114..336122,
FT                   336468..336470,336474..336479))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="BC1002_5886"
FT   gene            336685..336876
FT                   /db_xref="GeneID:9091265"
FT                   /locus_tag="BC1002_5887"
FT                   /pseudo
FT   gene            complement(337099..337332)
FT                   /db_xref="GeneID:9091266"
FT                   /locus_tag="BC1002_5888"
FT                   /pseudo
FT   gene            complement(337575..337853)
FT                   /db_xref="GeneID:9091267"
FT                   /locus_tag="BC1002_5889"
FT   CDS_pept        complement(337575..337853)
FT                   /locus_tag="BC1002_5889"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cti:RALTA_B1161 putative lipoprotein"
FT                   /db_xref="GI:295680707"
FT                   /db_xref="GeneID:9091267"
FT                   /translation="MKAEVLFAVLLLGTIDCAAEPGYYNTCAAYPAYPCEFYGGCPSRG
FT                   QPCVFLGGGVRRFHDFDHDDGFRHRLHGRSTQFEQGGSHSGGHGGRN"
FT                   /protein_id="YP_003609281.1"
FT   sig_peptide     complement(337797..337853)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.391 at
FT                   residue 19"
FT                   /locus_tag="BC1002_5889"
FT   gene            complement(338204..339394)
FT                   /db_xref="GeneID:9091268"
FT                   /locus_tag="BC1002_5890"
FT   CDS_pept        complement(338204..339394)
FT                   /locus_tag="BC1002_5890"
FT                   /gene_family="HOG000225062" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_2847"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_2847 hypothetical protein"
FT                   /db_xref="GI:295680708"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017549"
FT                   /db_xref="GeneID:9091268"
FT                   /translation="MSQISRGLKAAAVIVLAAGFTTGYAVADDAYVVKPLVSNVAGAAP
FT                   KVDGVLQNAWGIAFSPAGSPFWINDNATGCSTLYDGEGTKVTTLQVAIPLPGNVIPAGA
FT                   CHAVLPKSAPNPTPAAPTGIVWNPSSAFLVPGTHTQAVFIFATEDGTLSAWAGGLNPAN
FT                   NAVIAVDNSSNPSAASGAVYKGLVFGVNAQGGFLFATNFRSGRIDVFGPNGSDGLFTPA
FT                   TTDGGFADPNIPAGYAPFGIANIDGDLFVTYAKQDKQKHDDDAGRGRGFVDVFDTDGHL
FT                   LRRFASRGPLDSPWGIARASFAFGRFSGKILIGNFGDGRINVFDNDGTFVDQLENEFGN
FT                   PLAIDGLWTLTLGGGRNSSPDTLYFSAGPNKETNGLFGIIAPASGSGERASGQHRQ"
FT                   /protein_id="YP_003609282.1"
FT   sig_peptide     complement(339311..339394)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 28"
FT                   /locus_tag="BC1002_5890"
FT   misc_feature    complement(338249..339304)
FT                   /note="conserved hypothetical protein TIGR03118; Region:
FT                   PEPCTERM_chp_1"
FT                   /db_xref="CDD:132162"
FT                   /locus_tag="BC1002_5890"
FT   gene            339722..341428
FT                   /db_xref="GeneID:9091269"
FT                   /locus_tag="BC1002_5891"
FT   CDS_pept        339722..341428
FT                   /locus_tag="BC1002_5891"
FT                   /gene_family="HOG000220306" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bvi:Bcep1808_6795 phage
FT                   integrase family protein"
FT                   /db_xref="GI:295680709"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="GeneID:9091269"
FT                   /translation="MKTRRASIPSPQPDDPPRFPAADELAVLRAWYAGLPVREAVERYQ
FT                   SALLGDGKSARGVLGRIRRRLQAIARAAHRDDLAALLDHPAEDRARHAKAVAHAIEALR
FT                   TARPPEPQITDDVAQWLAPRAVRVLHAHGLRTLADLTVRIPRRRQWWKAVPGLGVASAR
FT                   AIETFFAAWPALTEKARALVLASRRAELVPWESLQVPHEVDGSQGTFRAPKATCALDAG
FT                   NDYEAVQTWLALQESPATQRTYRKEAERLILWVIVERGRALSSLTTEDAIAYRTFLRHP
FT                   SPHARWVGPVRPRTSPDWRPFNGSLSARSVAHALSILGALFRWLIEQRYVLANPFAGVK
FT                   VREASGANVLDTSHAFTEGEWALVRTIADGLEWSYGWSAPAAHRLRFLLDFGYATGLRA
FT                   SELVGATLGHIETDARGDHWLRVTGKGRKLARVALPPLAWDALAHYLAERELPIAPVRW
FT                   RPETPVIGSLEADSESTISSVRLWGVLRRFFLVAAKSIEADHPPLAEKLRCASPHWMRH
FT                   THATHALGRGAELTTVRDNLRHASVSTTSIYLHSDEVKRARQMSDVFGARK"
FT                   /protein_id="YP_003609283.1"
FT   misc_feature    340022..340303
FT                   /note="Phage integrase protein; Region: DUF3701; pfam12482"
FT                   /db_xref="CDD:152916"
FT                   /locus_tag="BC1002_5891"
FT   misc_feature    340397..341377
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="BC1002_5891"
FT   misc_feature    340784..341371
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="BC1002_5891"
FT   misc_feature    order(340913..340915,340994..340996,341258..341260,
FT                   341267..341269,341336..341338,341363..341365)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="BC1002_5891"
FT   gene            341732..342472
FT                   /db_xref="GeneID:9091270"
FT                   /locus_tag="BC1002_5892"
FT   CDS_pept        341732..342472
FT                   /locus_tag="BC1002_5892"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mlr1693 ATP-binding protein of sugar ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="GI:295680710"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9091270"
FT                   /translation="MSLLELRGVSRHFGAIQALIDVTLSLEPGQVVGLMGDNGAGKSTL
FT                   VKIVAGNFPPSHGEMLIDGNPVHFNKPIDARARGIEVVYQDLALCDNLTAAANVFLGRE
FT                   LRIGFGPIRVLDHATMYRRAGDLFKQLKSETRPRDLVRQMSGGQRQAVAIARTRLSDAR
FT                   LVLMDEPTAAISVRQVAEVLDLIKRLSEHGIAVILISHRMPDVFAVAHRVVVMRRGRKV
FT                   ADKKTEESSPEEVTGLITGAIAAA"
FT                   /protein_id="YP_003609284.1"
FT   misc_feature    341732..342418
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    341741..342403
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    341837..341860
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    order(341846..341851,341855..341863,341984..341986,
FT                   342233..342238,342332..342334)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    341975..341986
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    order(342044..342055,342152..342163,342185..342190)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    342221..342238
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    342245..342256
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   misc_feature    342320..342340
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="BC1002_5892"
FT   gene            342528..343523
FT                   /db_xref="GeneID:9091271"
FT                   /locus_tag="BC1002_5893"
FT   CDS_pept        342528..343523
FT                   /locus_tag="BC1002_5893"
FT                   /gene_family="HOG000212232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_CH03189 sugar ABC transporter, permease protein"
FT                   /db_xref="GI:295680711"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9091271"
FT                   /translation="MPPLIDDPQSARTHTRWSGLLASQVFWVVLATIVACIALSIATST
FT                   FATSENLFNVTRNFAFVAIVALGMMAVIVTGGIDISVGSTIGISGIVLSVVMNAGYPIW
FT                   AGIGMGLLTAGLVGLVNGLLIAYLGMQPFVVTLAMLSVGRSLALVISRSRTIFDFGPDG
FT                   SKLLTLGGGATLGVANPVWFLILLGLLFWFAFGWTRWGRYVFAIGGNRHAATLTGVPVR
FT                   RIVCSVYVLCGLMAGVAAILEVGWLGAVTTGLGTGDELRVIAATVVGGTNLIGGVGSAF
FT                   GTIVGAALIEVIRNSLILLGVDAFWQGTVVGSFIVVAVLFNRLGGERQGD"
FT                   /protein_id="YP_003609285.1"
FT   misc_feature    342702..343493
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5893"
FT   misc_feature    343161..343217
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="BC1002_5893"
FT   gene            343781..344728
FT                   /db_xref="GeneID:9091272"
FT                   /locus_tag="BC1002_5894"
FT   CDS_pept        343781..344728
FT                   /locus_tag="BC1002_5894"
FT                   /gene_family="HOG000212345" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:mll1692"
FT                   /codon_start="1"
FT                   /product="periplasmic sugar-binding protein of sugar ABC
FT                   transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mll1692 periplasmic sugar-binding protein
FT                   of sugar ABC transporter"
FT                   /db_xref="GI:295680712"
FT                   /db_xref="GeneID:9091272"
FT                   /translation="MLASPGFAADKTLALVVKGLDNPYFDLMHQGCERANKELNKQGYN
FT                   CYYTGPATAADESAQVQIIDDLLTKGVASMAISPANAPAVAEVLRRRGGSVPVITADAD
FT                   LLPKDASLRKSYVGTDNYELGAKLGEQLKMLMPKGGKVCLVMGNPAAENINQRAQGARD
FT                   VLSGKKGITKLAGENGWQEISGCPLYVNDDAAKANQMMQDTLTANPTGLDAFLLAGGWP
FT                   LFAPQAFSQVVAPIMDKIKNGKFVIVSADTLGPELQALKDRKVNVLVGQRPEEMGYRAA
FT                   MVMRDLAEGKSVPPVIHTGLDVCTWKNADTCLKH"
FT                   /protein_id="YP_003609286.1"
FT   misc_feature    343781..344665
FT                   /note="D-allose transporter subunit; Provisional; Region:
FT                   PRK09701"
FT                   /db_xref="CDD:170055"
FT                   /locus_tag="BC1002_5894"
FT   misc_feature    343814..344689
FT                   /note="Periplasmic sugar-binding domain of active transport
FT                   systems that are members of the type I periplasmic binding
FT                   protein (PBP1) superfamily; Region:
FT                   PBP1_ABC_sugar_binding_like; cd01536"
FT                   /db_xref="CDD:107249"
FT                   /locus_tag="BC1002_5894"
FT   misc_feature    order(343850..343852,344084..344086,344249..344251,
FT                   344531..344533,344591..344593)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107249"
FT                   /locus_tag="BC1002_5894"
FT   gene            344766..345023
FT                   /db_xref="GeneID:9091273"
FT                   /locus_tag="BC1002_5895"
FT                   /pseudo
FT   gene            complement(345183..345371)
FT                   /db_xref="GeneID:9091274"
FT                   /locus_tag="BC1002_5896"
FT   CDS_pept        complement(345183..345371)
FT                   /locus_tag="BC1002_5896"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B0470 hypothetical protein"
FT                   /db_xref="GI:295680713"
FT                   /db_xref="GeneID:9091274"
FT                   /translation="MNTLTIKDLPMNEDLDHAALARVSGGIGRTPPQIQAWELSGKPAT
FT                   WQGLVLGDDGQLHLPTP"
FT                   /protein_id="YP_003609287.1"
FT   gene            complement(345698..345919)
FT                   /db_xref="GeneID:9091275"
FT                   /locus_tag="BC1002_5897"
FT   CDS_pept        complement(345698..345919)
FT                   /locus_tag="BC1002_5897"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_6278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_6278 hypothetical protein"
FT                   /db_xref="GI:295680714"
FT                   /db_xref="GeneID:9091275"
FT                   /translation="MNSSAMTSADREQEYLDASESYITAIKPTAQQTATFCAATAQMLA
FT                   DDLGGRVEISLPEGIHIVRMPNTKQYGS"
FT                   /protein_id="YP_003609288.1"
FT   gene            complement(346315..347142)
FT                   /db_xref="GeneID:9091276"
FT                   /locus_tag="BC1002_5898"
FT   CDS_pept        complement(346315..347142)
FT                   /locus_tag="BC1002_5898"
FT                   /gene_family="HOG000059130" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bph:Bphy_5645
FT                   alpha/beta hydrolase fold protein"
FT                   /db_xref="GI:295680715"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:9091276"
FT                   /translation="MNDMTTMPLAQLFSFAAPVIALHCSGSGSAQWRKLSDALGSRHKF
FT                   IAPEHYGCESTGPWSGERAFTLADEAARTVGIIDALRVKVHLVGHSYGGGVALRAALER
FT                   PERVASLTLYEPSAFHLLKTMGTYGAEALAEIIAISKRTADGVNCGDYRGAAASFVDYW
FT                   SGRGAWDALRPSVQAALTRWAPKAPLDFRALIDEGTPASAYAALRIPALIMRGQHAPVP
FT                   TRAIAERLPMLLPAARLAVVEGAGHMGPVTHADKVNATIVRHIAEVDSTICTS"
FT                   /protein_id="YP_003609289.1"
FT   misc_feature    complement(346339..347091)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="BC1002_5898"
FT   misc_feature    complement(346360..347016)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5898"
FT   gene            complement(347333..348166)
FT                   /db_xref="GeneID:9091277"
FT                   /locus_tag="BC1002_5899"
FT   CDS_pept        complement(347333..348166)
FT                   /locus_tag="BC1002_5899"
FT                   /gene_family="HOG000240736" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: bph:Bphy_5646
FT                   methyltransferase type 11"
FT                   /db_xref="GI:295680716"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:9091277"
FT                   /translation="MSTVDFASASIPDFAAIKARHQVAWSTGNYAVVGTTLQIVGENLC
FT                   EALDLRAGSRVLDVAAGNGNATLAAARRWCDVTSTDYVASLLDSGRARAQAEGLTVQFQ
FT                   EADAEALPFADAIFDIVMSTFGVMFTANQEKAAAELVRVCKPGGQIGLANWTPESFIGQ
FT                   LFKTIGKYVPPPAGVKSPALWGAKARLEELFGDTARRITAINRDFVFRYRSPAHFIDVF
FT                   RTFYGPMNKAFAALDGEPQAAFHRDLTALIENRNRSNDATLVLPSEYLEVVIERR"
FT                   /protein_id="YP_003609290.1"
FT   misc_feature    complement(347579..348037)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="BC1002_5899"
FT   gene            complement(348674..348976)
FT                   /db_xref="GeneID:9091278"
FT                   /locus_tag="BC1002_5900"
FT   CDS_pept        complement(348674..348976)
FT                   /locus_tag="BC1002_5900"
FT                   /gene_family="HOG000058983" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5270"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5270 hypothetical protein"
FT                   /db_xref="GI:295680717"
FT                   /db_xref="GeneID:9091278"
FT                   /translation="MTKSLKTGLTLPAAVLLLAGCIVGGMPYTGPHLSPAECRDLAALK
FT                   TNAPPTMAQHQNELAALRKAGYDPSPWNDDPYYPDDLQAAQRLVDYWFQTECLPH"
FT                   /protein_id="YP_003609291.1"
FT   sig_peptide     complement(348899..348976)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.594 at
FT                   residue 26"
FT                   /locus_tag="BC1002_5900"
FT   gene            complement(349299..351584)
FT                   /db_xref="GeneID:9091279"
FT                   /locus_tag="BC1002_5901"
FT   CDS_pept        complement(349299..351584)
FT                   /locus_tag="BC1002_5901"
FT                   /gene_family="HOG000132448" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.40, 2.3.1.8"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.8"
FT                   /EC_number="1.1.1.40"
FT                   /transl_table="11"
FT                   /note="KEGG: bgl:bglu_2g14660 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))/phosphate
FT                   acetyltransferase; PFAM: malic protein NAD-binding; malic
FT                   protein domain protein; phosphate acetyl/butaryl
FT                   transferase"
FT                   /db_xref="GI:295680718"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091279"
FT                   /translation="MDRTEREAALQYHEFPTRGKISVSASKPLVTQRDLALAYTPGVAV
FT                   ACEEIAADPREAFRYTSRGNLVGVITNGSAVLGLGNIGALASKPVMEGKAVLFKKFAGI
FT                   DVFDIEITESDPNKLVDIIASLEATFGGINLEDIKAPDCFIVEQKLRERMKIPVFHDDQ
FT                   HGTAITVSAAFLNGLKVVGKDISKVKVVTSGAGAAALACLELMVDLGLPRENVWVTDIE
FT                   GVVYQGRTAAMDPDKARFAQATAARVLSDVIEGADVFLGLSVGGVLKAEMVKQMAPRPL
FT                   ILALANPTPEIFPEKVREARDDAVIATGRSDYPNQVNNVLCFPYVFRGALDVGATTITR
FT                   NMEVAAVHAIAGLAQEEPNDSVAAAYGAYDLSFGPQYLIPKPFDSRLIVRIAPAVAKAA
FT                   MEDGVATRPITDFDAYADQLQQFVYHSGAFMKPLFAAAKQFVREGGNSRIVFTEGEEER
FT                   VLRAVQVIVDEKLARPILVGRPEVLLSRIEKFGLRLKLGEDVEVTNPENDERFHQYWTT
FT                   YWELRCRDGITKEMARVEMRRRLTLIGAMMVRLGDADGMICGTVGGYHKHLRFIDEVIG
FT                   RKHDAQTYAAMNILLLDKRTLALVDTHVNDNPTAEQIAEFTIAAAAQMAWLNLSPKVAL
FT                   LSRSNFGSGSSASGEKMRKVLALVSEKAPDLEIDGEMHGDCALDEALRQRVLPTSRLKG
FT                   AANLLVCPNVDSGNIAYNLLKTEAGSNVAVGPFLLGVNAPVNILTSSSTVRRIINMAAL
FT                   TVLQANRD"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /protein_id="YP_003609292.1"
FT   misc_feature    complement(349302..351584)
FT                   /note="malic enzyme; Reviewed; Region: PRK12861"
FT                   /db_xref="CDD:171778"
FT                   /locus_tag="BC1002_5901"
FT   misc_feature    complement(351132..351530)
FT                   /note="Malic enzyme, N-terminal domain; Region: malic;
FT                   pfam00390"
FT                   /db_xref="CDD:144108"
FT                   /locus_tag="BC1002_5901"
FT   misc_feature    complement(350388..351098)
FT                   /note="NAD(P) binding domain of malic enzyme (ME), subgroup
FT                   2; Region: NAD_bind_2_malic_enz; cd05311"
FT                   /db_xref="CDD:133453"
FT                   /locus_tag="BC1002_5901"
FT   misc_feature    complement(order(350628..350630,350634..350636,
FT                   350658..350660,350724..350732,350784..350786,
FT                   350796..350801,350922..350927,350991..351002))
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:133453"
FT                   /locus_tag="BC1002_5901"
FT   misc_feature    complement(349302..350300)
FT                   /note="Phosphate acetyl/butaryl transferase; Region:
FT                   PTA_PTB; cl00390"
FT                   /db_xref="CDD:174167"
FT                   /locus_tag="BC1002_5901"
FT   gene            351724..352701
FT                   /db_xref="GeneID:9091280"
FT                   /locus_tag="BC1002_5902"
FT   CDS_pept        351724..352701
FT                   /locus_tag="BC1002_5902"
FT                   /gene_family="HOG000233516" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bgl:bglu_2g14670 transcriptional
FT                   regulator, LysR family protein"
FT                   /db_xref="GI:295680719"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091280"
FT                   /translation="MSFNTDEVIRRLGARLKMRHLMLLLQIRQHGSLTRVAEHMASSQP
FT                   AITNALAELEDMFGGSLFERSSRGMIPTPLGTTVLARAESMLHDLDHLASDVGALISGH
FT                   ATRFHIGVISFISGKTLASAIRHTQSQISQRLTFSIHEDTSEGLMSQLRDHTLDIVIGR
FT                   ASSSVDLDNLHFEVIHQQKPRLIASRRLAARLSRNAMNWRKLAELDWILGASQTPMRDQ
FT                   ISDLFLHAGVTPPFPVVESLSPRLIGETVALNENAVSIMPADIAEELVRIAGVAIVPYA
FT                   FDWTLPPVTLFTRPGIPREIDTIFAASLRAQYQTKVVNDPASLG"
FT                   /protein_id="YP_003609293.1"
FT   misc_feature    351766..352617
FT                   /note="pca operon transcription factor PcaQ; Region:
FT                   TF_pcaQ; TIGR02424"
FT                   /db_xref="CDD:162852"
FT                   /locus_tag="BC1002_5902"
FT   misc_feature    351775..351951
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5902"
FT   misc_feature    352126..352605
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5902"
FT   misc_feature    order(352129..352149,352435..352452,352477..352482,
FT                   352483..352485)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5902"
FT   gene            352818..353732
FT                   /db_xref="GeneID:9091281"
FT                   /locus_tag="BC1002_5903"
FT   CDS_pept        352818..353732
FT                   /locus_tag="BC1002_5903"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bam:Bamb_5304 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:295680720"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091281"
FT                   /translation="MLDLDDLRLIRAVGVSRSLASAAQLLNLTPPAVTIRLQRMEERLR
FT                   IRLAVRKAKGISLTEEGQRLHQEAVEILERVEALPAHISGEHGEVTGSLRVVAPFGFGR
FT                   IHVSQIVRKLHLSHPGLEVSLHLSESPLVNAASADVVIHIGELKSSSWVGYPLAPNGRL
FT                   LCASPAYAKSIKELNQPADLVNYHCICLRENDEDLPRWRFSLKSDPKRTTVLRVSGKLS
FT                   ANDGTVITEWALAGLGIVERSEWDVAPLLATGKLVRLLPDWDLPPAPVTALLPSRTGMS
FT                   IRQRIFLETARAFLNPAPWRSRG"
FT                   /protein_id="YP_003609294.1"
FT   misc_feature    352821..353702
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5903"
FT   misc_feature    352827..353006
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5903"
FT   misc_feature    353091..353684
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="BC1002_5903"
FT   misc_feature    order(353139..353144,353148..353153,353160..353162,
FT                   353172..353174,353178..353198,353475..353492,
FT                   353508..353513,353517..353522)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="BC1002_5903"
FT   gene            353839..354969
FT                   /db_xref="GeneID:9091282"
FT                   /locus_tag="BC1002_5904"
FT   CDS_pept        353839..354969
FT                   /locus_tag="BC1002_5904"
FT                   /gene_family="HOG000137375" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /codon_start="1"
FT                   /product="alanine racemase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bac:BamMC406_3484 alanine racemase domain-containing
FT                   protein"
FT                   /db_xref="GI:295680721"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="GeneID:9091282"
FT                   /translation="MSIDTLNTPAALIDVARMRHNIDNMQARLDKLGARFRPHVKTTKC
FT                   KQVVDAQVAAGACGITVSTLKEAEQFFASGVRDIVYAVGMVPTKLPQALALRQRGCDLK
FT                   IVVDSLQVARAVADFGREHDERFEVWVEIDVDGHRSGIQPDDDLLVEVGRALVAGGMTL
FT                   GGVLAHAGSSYEYSTRAALVQIAEQERSRTVRAAERLRAAGLPCPVVSIGSTPTALSAE
FT                   RLEGVTEVRAGVYVMFDLVMHNVGVCDIENIALSVLTTVIGHQEDKGWAIVDAGWMALS
FT                   RDRGTQKQAHDFGYGQVCTEDGRVLGDYLVSGANQEHGIVARVSSPDATIAETLPIGTR
FT                   LRILPNHACATGAQHPEYQAVNTDGSTEAWPRFYGW"
FT                   /protein_id="YP_003609295.1"
FT   misc_feature    353839..354960
FT                   /note="Predicted amino acid aldolase or racemase [Amino
FT                   acid transport and metabolism]; Region: COG3616"
FT                   /db_xref="CDD:33415"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    353845..354966
FT                   /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
FT                   Enzymes Similar to D-Serine Dehydratase and D-Threonine
FT                   Aldolase, Unknown Group 1; Region:
FT                   PLPDE_III_DSD_D-TA_like_1; cd06812"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    order(353860..353862,353959..353961,353965..353967,
FT                   354025..354030,354034..354039,354055..354057,
FT                   354103..354105,354160..354162,354169..354171,
FT                   354181..354183,354250..354261,354622..354633,
FT                   354646..354648,354652..354654,354658..354660,
FT                   354667..354672,354922..354924)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    order(353953..353955,353959..353961,354019..354021,
FT                   354082..354084,354232..354234,354253..354255,
FT                   354343..354345,354478..354483,354529..354540,
FT                   354667..354669)
FT                   /note="active site"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    order(353953..353955,353959..353961,354019..354021,
FT                   354082..354084,354232..354234,354343..354345,
FT                   354478..354483,354529..354540)
FT                   /note="pyridoxal 5'-phosphate (PLP) binding site; other
FT                   site"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    order(353959..353961,354253..354255,354343..354345,
FT                   354538..354540)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   misc_feature    353959..353961
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:143487"
FT                   /locus_tag="BC1002_5904"
FT   gene            355054..355464
FT                   /db_xref="GeneID:9091283"
FT                   /locus_tag="BC1002_5905"
FT   CDS_pept        355054..355464
FT                   /locus_tag="BC1002_5905"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /codon_start="1"
FT                   /product="Endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSS2059 hypothetical protein; manually
FT                   curated; PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="GI:295680722"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="GeneID:9091283"
FT                   /translation="MSTESHTSTITCSSAPTMPPPAGHYSHVCVANGFVFVSGQLPIDS
FT                   AGKPLSDEPFEAQVGQVLRNVDACLNAVGTTRHRLVQVRVFVSDIKHWPAFNKLYAEWI
FT                   GTHRPARAVAQSTSLHYGAAVEVEGVALATAA"
FT                   /protein_id="YP_003609296.1"
FT   misc_feature    355126..355413
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="BC1002_5905"
FT   misc_feature    order(355126..355131,355138..355140,355144..355146,
FT                   355153..355155,355159..355161,355165..355170,
FT                   355288..355290,355294..355299,355303..355305,
FT                   355309..355311,355342..355344,355351..355353,
FT                   355378..355401)
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="BC1002_5905"
FT   misc_feature    order(355126..355128,355330..355332,355342..355344,
FT                   355384..355386)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="BC1002_5905"
FT   gene            355488..356819
FT                   /db_xref="GeneID:9091284"
FT                   /locus_tag="BC1002_5906"
FT   CDS_pept        355488..356819
FT                   /locus_tag="BC1002_5906"
FT                   /gene_family="HOG000208778" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /codon_start="1"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bph:Bphy_5637 sodium:dicarboxylate symporter"
FT                   /db_xref="GI:295680723"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="GeneID:9091284"
FT                   /translation="MKRLKLAHWIMFGMVLGVLVGYACNRYAGNEATAKAIAADFGVVT
FT                   GIFLRLVKMIIAPLVFATLVSGISSMDSGKSIGRIGAKTIGWFVVASLISLTIGLLFVN
FT                   IARPGAHLNLQLPAADVHPNLQTSALNFKDFLTHMFPSSVIEAMANNQIMQILVFSLFF
FT                   GIALGKVPGLPGEFLKRSIDGLMDVMLRATNAVMLFAPVGVFAAIAGAVTSQGLGIIFT
FT                   YGKLIGWFYVALFTLWGALYFAGRAALGCRMGQLFRSIREPMIIAFSTASSEAAYPKLT
FT                   EVLQEFGVRKRLVGFVLPLGYSFNLDGSMVYQAFAAIFIAQAFGVDMPIGIQITMLLIL
FT                   MVSSKGMAAVPRGSLVVVAAILPMFHLPEAGLLLVMGIDQILDMGRTATNVLGNSIATA
FT                   VVAKWEGELAAAGTPENEEAVIGTSSNEHAGQYLHLTKPPGRSI"
FT                   /protein_id="YP_003609297.1"
FT   misc_feature    355503..356699
FT                   /note="Sodium:dicarboxylate symporter family; Region: SDF;
FT                   cl00573"
FT                   /db_xref="CDD:174292"
FT                   /locus_tag="BC1002_5906"
FT   gene            356816..358216
FT                   /db_xref="GeneID:9091285"
FT                   /locus_tag="BC1002_5907"
FT   CDS_pept        356816..358216
FT                   /locus_tag="BC1002_5907"
FT                   /gene_family="HOG000121943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /codon_start="1"
FT                   /product="aminotransferase class V"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class V; KEGG: sus:Acid_5969
FT                   pyridoxal-dependent decarboxylase"
FT                   /db_xref="GI:295680724"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9091285"
FT                   /translation="MKLDESAKAAGLAPTAELLQDAGQRALAYVQSVHDRPVNVSTQAL
FT                   QGLNAFRHSLPDAGLDAREVLRRLDEAGSPATVATTGGRYFGLVIGGALPATIAANWLT
FT                   TAWDQNACFRWTSPIAATLEDVTLRWIGDLFGLPDDIGGAFVTGASMANFAALAAARHA
FT                   LLSRLGWDVEAKGLYGAPELRVVVSKETHVTVSKALSMLGLGRERVIVVPTDHHGRMRV
FT                   SELPKLDEQTIVCIQAGNVNTGDFDPAREICRLARKAGAWVHVDGAFGLWALANRQFDT
FT                   LTDGFAEADSWATDGHKWLNVPYDNGIVLVRRAATLRAAMSLNAAYLAEGDATEREPSH
FT                   YTPESSRRARGVDIWAALLNLGRDGVAALVERTCHYAGMFAQGLEASGYEILNHVALNQ
FT                   VLVSFGTAEMTRAVITRLQTEGICWCGGTVWQGRVAMRISVSSWATTDADVQTSLRAMI
FT                   RAAEACAP"
FT                   /protein_id="YP_003609298.1"
FT   misc_feature    356894..358162
FT                   /note="Glutamate decarboxylase and related PLP-dependent
FT                   proteins [Amino acid transport and metabolism]; Region:
FT                   GadB; COG0076"
FT                   /db_xref="CDD:30425"
FT                   /locus_tag="BC1002_5907"
FT   misc_feature    357104..358195
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="BC1002_5907"
FT   misc_feature    order(357260..357265,357272..357274,357524..357526,
FT                   357611..357613,357620..357622,357698..357700,
FT                   357707..357709)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="BC1002_5907"
FT   misc_feature    357707..357709
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="BC1002_5907"
FT   gene            358300..358917
FT                   /db_xref="GeneID:9091286"
FT                   /locus_tag="BC1002_5908"
FT   CDS_pept        358300..358917
FT                   /locus_tag="BC1002_5908"
FT                   /gene_family="HOG000161265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="KEGG: cak:Caul_0531 TetR family transcriptional
FT                   regulator; manually curated; PFAM: regulatory protein TetR"
FT                   /db_xref="GI:295680725"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9091286"
FT                   /translation="MRNVNTITDRQRGRPREFDVDHTIERAMQVFWTLGYQGTSLPDLM
FT                   QATGLSRGSLYAAFGDKHGLFLLALDHYIVQALKRLDFELASGQKALAGLKACMDGYVE
FT                   RTNGAAGKRGCLVVATAMELAAHDHEVANRIAYFFRTMEARLANALKRAQKEGDLGKNV
FT                   SPEAAAHMLVCFLEGLRVVRKTGIESDRAKDAVQTLIRGLAG"
FT                   /protein_id="YP_003609299.1"
FT   misc_feature    358321..358902
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="BC1002_5908"
FT   misc_feature    358369..358500
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="BC1002_5908"
FT   gene            358981..359859
FT                   /db_xref="GeneID:9091287"
FT                   /locus_tag="BC1002_5909"
FT   CDS_pept        358981..359859
FT                   /locus_tag="BC1002_5909"
FT                   /gene_family="HOG000041648" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cak:Caul_0532 hypothetical protein"
FT                   /db_xref="GI:295680726"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:9091287"
FT                   /translation="MEAIHIAAALLVPLLWGFQFAVVKAGLTVLPPLFFAGLRFAVIAA
FT                   ILIPFVARIRGPEIWPIFLISCFMGGVNFACSYIGLTQSPAGIAGIANQLWTPFTLMLA
FT                   WPMLGEKSSARMVIGVGLALCGVVLSIADPGLKISTIPTLFLIASAFGLAMGNVLARKF
FT                   GPFDPVKLFAWVSFFTAFQLLGLSMIVEGGQIEALQRASSSEWLAFAFTVILGGIAAFT
FT                   IWFWLIARFSMARVAPYALLQSFFAIGAGVAFRHEPITPTLILGAIICVSGVALSQWPI
FT                   STRLRNEDGAP"
FT                   /protein_id="YP_003609300.1"
FT   misc_feature    359005..359802
FT                   /note="O-acetylserine/cysteine export protein; Provisional;
FT                   Region: PRK11453"
FT                   /db_xref="CDD:138583"
FT                   /locus_tag="BC1002_5909"
FT   misc_feature    359020..359373
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="BC1002_5909"
FT   misc_feature    359440..359808
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="BC1002_5909"
FT   gene            359916..360623
FT                   /db_xref="GeneID:9091288"
FT                   /locus_tag="BC1002_5910"
FT   CDS_pept        359916..360623
FT                   /locus_tag="BC1002_5910"
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Swit_1907"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swi:Swit_1907 hypothetical protein"
FT                   /db_xref="GI:295680727"
FT                   /db_xref="GeneID:9091288"
FT                   /translation="MAKFVLVHGAFQGGWVYARVARKLREAGHDVYTPTLTGLGERSHL
FT                   ADRAINLDTHIQDVVNVFKYEDITDAILCGHSYGGLVITGVAHEIGERIRTLFYLDAYA
FT                   PADGQSLVDITGAETALAFLAQAGQNDGMIPPIPAAIFNVNNADAAWVDSMSGPQPLAT
FT                   FVQGVRAGVDSAPVANRTYVFASDNGGDWFVDTYARLKDALGWKVHAIPCGHSIMLDRP
FT                   VDLAALLLAEATH"
FT                   /protein_id="YP_003609301.1"
FT   misc_feature    359925..>360221
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="BC1002_5910"
FT   misc_feature    359928..360620
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="BC1002_5910"
FT   gene            360681..361469
FT                   /db_xref="GeneID:9091289"
FT                   /locus_tag="BC1002_5911"
FT   CDS_pept        360681..361469
FT                   /locus_tag="BC1002_5911"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sme:SMa1757 putative short chain"
FT                   /db_xref="GI:295680728"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091289"
FT                   /translation="MNLVPASSSQLSESPHTDESTRYMLLTGASRGIGHATVKLFQQHN
FT                   WEVFTVSRQPFSEDCKWPAARESHIQADLADLNSVEEIADEVRRRLPHGKLHALVNNAG
FT                   ISPKGKNRTRLGVLDSDIHTWSTVLNVNLISNALLARALFPELACGKGAIVNVTSIAGF
FT                   KVHPFAGTAYAASKAALFALTREMAHEFGPHGIRVNAIAPGEIDTSILSPGTENIVNNE
FT                   IPLHRLGDPREVAETIHFLCGPASSYINGTEIYIDGGQHV"
FT                   /protein_id="YP_003609302.1"
FT   misc_feature    360732..361466
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5911"
FT   misc_feature    360753..361460
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="BC1002_5911"
FT   gene            complement(361513..361737)
FT                   /db_xref="GeneID:9091290"
FT                   /locus_tag="BC1002_5912"
FT                   /pseudo
FT   gene            complement(361968..362174)
FT                   /db_xref="GeneID:9091291"
FT                   /locus_tag="BC1002_5913"
FT   CDS_pept        complement(361968..362174)
FT                   /locus_tag="BC1002_5913"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Smed_1278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: smd:Smed_1278 hypothetical protein"
FT                   /db_xref="GI:295680729"
FT                   /db_xref="GeneID:9091291"
FT                   /translation="MAGFYPRQTALFGDAWFAGYAAALEGVRIDTLTLGAWTEERGLAD
FT                   VSDRMYRRAKRARAHSSRGGQSD"
FT                   /protein_id="YP_003609303.1"
FT   gene            complement(362245..362865)
FT                   /db_xref="GeneID:9091292"
FT                   /locus_tag="BC1002_5914"
FT   CDS_pept        complement(362245..362865)
FT                   /locus_tag="BC1002_5914"
FT                   /gene_family="HOG000251846" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BamMC406_5615"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bac:BamMC406_5615 hypothetical protein"
FT                   /db_xref="GI:295680730"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="GeneID:9091292"
FT                   /translation="MSHLQERFVELWTRCGGAHAEAVYADLAQRYSEPIRHYHTLRHVR
FT                   RCLRYFDLACSAIPHPDLVELALWCHDVVYVPGAGDNEQRSADWLRRSADDRIMMCEHI
FT                   CEMILATRHTGAPEEPDERFTCDIDLAVLGAARSRFLAEGVRVRRERSDLDDLAYDVQE
FT                   RNFLGGLLARPRIYFTDYFHARCETRARGNLTWRLASETPESQ"
FT                   /protein_id="YP_003609304.1"
FT   misc_feature    complement(362284..362847)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="BC1002_5914"
FT   gene            complement(362927..363602)
FT                   /db_xref="GeneID:9091293"
FT                   /locus_tag="BC1002_5915"
FT                   /pseudo
FT   gene            complement(363628..363870)
FT                   /db_xref="GeneID:9091294"
FT                   /locus_tag="BC1002_5916"
FT                   /pseudo
FT   gene            364037..364312
FT                   /db_xref="GeneID:9091295"
FT                   /locus_tag="BC1002_5917"
FT   CDS_pept        364037..364312
FT                   /locus_tag="BC1002_5917"
FT                   /gene_family="HOG000023914" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF156"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bac:BamMC406_6017 regulator protein FrmR"
FT                   /db_xref="GI:295680731"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:9091295"
FT                   /translation="MPHSAEEKKRVLTRVRRVRGQLDALERALEEGADCAPVLQQLAAI
FT                   RGAINGVMAGVLESHLREEFTHLAGSADASSGSIDDVVTLVRTYLR"
FT                   /protein_id="YP_003609305.1"
FT   misc_feature    364037..364309
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="BC1002_5917"
FT   gene            364364..365473
FT                   /db_xref="GeneID:9091296"
FT                   /locus_tag="BC1002_5918"
FT   CDS_pept        364364..365473
FT                   /locus_tag="BC1002_5918"
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02818"
FT                   /codon_start="1"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_5114 S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; TIGRFAM:
FT                   S-(hydroxymethyl)glutathione dehydrogenase/class III
FT                   alcohol dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="GI:295680732"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091296"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVEPPRKGEVLIKITHTGVCHTDAF
FT                   TLSGDDPEGLFPVVLGHEGAGIVVEVGEGVTSVKPGDHVIPLYTAECGECLFCKSGKTN
FT                   LCVSVRATQGKGVMPDGTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLARINPQANPEQ
FT                   VCLLGCGVTTGLGAVKNTAKVQEGDTVAVFGLGGIGLAVIQGAKLAKAGRIIAIDTNPG
FT                   KFDLARAFGATDCINPKDYAKPIQQVIVEMTDWGVDHSFECIGNVNVMRAALECAHRGW
FT                   GQSVVIGVAGAGQEISTRPFQLVTGRRWLGTAFGGVKGRSELPGMVEDAMEGKIQLAPF
FT                   VTHTKPLSGINEAFDLMHEGKSIRTVVHY"
FT                   /protein_id="YP_003609306.1"
FT   misc_feature    364364..365467
FT                   /note="class III alcohol dehydrogenases; Region:
FT                   alcohol_DH_class_III; cd08300"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    364367..365470
FT                   /note="S-(hydroxymethyl)glutathione dehydrogenase/class III
FT                   alcohol dehydrogenase; Region: adh_III_F_hyde; TIGR02818"
FT                   /db_xref="CDD:131865"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    order(364481..364483,364487..364489,364514..364522,
FT                   364547..364549,364625..364630,364868..364870,
FT                   365228..365230,365300..365302)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    order(364481..364483,364547..364552,364868..364870)
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    order(364484..364489,364868..364870,364880..364882,
FT                   364943..364957,365015..365020,365030..365032,
FT                   365150..365155,365165..365170,365222..365227,
FT                   365297..365305,365453..365455)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    order(364637..364639,364646..364648,364655..364657,
FT                   364679..364681)
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   misc_feature    order(364649..364654,364661..364663,364667..364672,
FT                   364676..364678,364682..364684,365123..365125,
FT                   365138..365140,365171..365176,365195..365206,
FT                   365231..365233,365240..365263,365270..365278,
FT                   365285..365302)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="BC1002_5918"
FT   gene            complement(365602..366003)
FT                   /db_xref="GeneID:9091297"
FT                   /locus_tag="BC1002_5919"
FT                   /pseudo
FT   gene            complement(366288..366452)
FT                   /db_xref="GeneID:9091298"
FT                   /locus_tag="BC1002_5920"
FT   CDS_pept        complement(366288..366452)
FT                   /locus_tag="BC1002_5920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:295680733"
FT                   /db_xref="GeneID:9091298"
FT                   /translation="MKFAEMFRFAKRGAKVGQSADGEHQHDHGKSAQKEARKQWDVVGR
FT                   NRHKNAKWQ"
FT                   /protein_id="YP_003609307.1"
FT   gene            complement(366596..367282)
FT                   /db_xref="GeneID:9091299"
FT                   /locus_tag="BC1002_5921"
FT   CDS_pept        complement(366596..367282)
FT                   /locus_tag="BC1002_5921"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:295680734"
FT                   /db_xref="GeneID:9091299"
FT                   /translation="MSSKSDRDNRSTQLNPDNPASASSRAGSFRDDDDDGEPVSYVDRY
FT                   FYTPPRATPFQVIGQYGVGVVSQEGEARFVTFCLEATASATLLYSHSSLQSRMEDYFER
FT                   FAIHVHGLFHAHFKAPPVLYVQFDGTSGRLPWHVPLNLEQPETMRTFLMSHKPQMNCAP
FT                   APDAVIELLCDRLSEPSEDWGTFQVLHRDASDLTFIYARRCNAEIQKNSHPGATAIEAI
FT                   RTITII"
FT                   /protein_id="YP_003609308.1"
FT   gene            complement(367747..368544)
FT                   /db_xref="GeneID:9091300"
FT                   /locus_tag="BC1002_5922"
FT   CDS_pept        complement(367747..368544)
FT                   /locus_tag="BC1002_5922"
FT                   /gene_family="HOG000263018" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_2365"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcm:Bcenmc03_2365 hypothetical protein"
FT                   /db_xref="GI:295680735"
FT                   /db_xref="GeneID:9091300"
FT                   /translation="MAADHDTLHPLRPLLKNWVWEHGRIGTRYLDCIDGEIKFDEGKKS
FT                   RFAADKYVYVPLDTDAADDTVADGPPIQEAGLARFLRAAQLGKPDEAGSVAEIHRAVQD
FT                   CVELGVFSAYQSDAREAFARYANEPMFEDEIRAAVIADIRRAYAGMRKQLALYDFSVLY
FT                   GLAMPLLISETPFIDWRVRGSPAVPFVSLPLGPYCLLVGAPSGRSSRIGPVVWKAATSM
FT                   GPLKDHNRKIEEHARLWLVATTDDQLVGIQRRFAAGRSSRPES"
FT                   /protein_id="YP_003609309.1"
FT   gene            368907..370028
FT                   /db_xref="GeneID:9091301"
FT                   /locus_tag="BC1002_5923"
FT   CDS_pept        368907..370028
FT                   /locus_tag="BC1002_5923"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_2147"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bvi:Bcep1808_2147 hypothetical protein"
FT                   /db_xref="GI:295680736"
FT                   /db_xref="GeneID:9091301"
FT                   /translation="MPLARLLLCFLQCSLAAAVLLPVVAGAANLPEASQRYASDTRDAA
FT                   PSDSATPHELKAGIERLRTGTWWEANRKIRPELAQVGDLMFLLPLADRQLEPSSDAIGR
FT                   VQRLREALRGHLMREPAGWTRLVAQVRAERAKAGDASAVLLADALINEVRYRDGTDGSY
FT                   YAPARFFAESGVCKDFAVAKYLLLRDAGFDIERLRLVSLAPRYNNTPDDWHVILVVRID
FT                   GAGEPLALDSPSPPGAKRAADSANEASASSGPSALLSAILAGREPADAVLRAPAGPLAT
FT                   PLSRSGQARRPLATVFNELGSRSFERAAPGAPRRASAAGRSANANPKYVDEMGESWTVD
FT                   GSGTFPKWRVAVDQADAPAKPGPAARLIRVAAR"
FT                   /protein_id="YP_003609310.1"
FT   sig_peptide     368907..368990
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.935 at
FT                   residue 28"
FT                   /locus_tag="BC1002_5923"
FT   misc_feature    369330..369581
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="BC1002_5923"
FT   gene            complement(370094..374035)
FT                   /db_xref="GeneID:9091302"
FT                   /locus_tag="BC1002_5924"
FT   CDS_pept        complement(370094..374035)
FT                   /locus_tag="BC1002_5924"
FT                   /gene_family="HOG000133693" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /codon_start="1"
FT                   /product="adenylate/guanylate cyclase"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B5817 adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; PFAM: transcriptional activator
FT                   domain; adenylyl cyclase class-3/4/guanylyl cyclase; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="GI:295680737"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="GeneID:9091302"
FT                   /translation="MTRLTIEVFGGLHIRLAGERMPLDFPTRKSKAILAYLALSPGMLR
FT                   SREQLASVFWERSAEEQARASLRQTLSSLRRMLSYAAPLLKTGPDAIWLDAHLVDVDAL
FT                   QFTHFSGERSAASLAKAVALYRGALLDGFGLREEPFEQWMAIERRWFHERAVEVFGELV
FT                   SLYEQSGASNDAIATASRILALDPLLEWAHAALMRLYARAGRRDAAMRQYQECVRVLNT
FT                   ELGIVPTEATQRLAAEIQQDGYGVPGAPDLIAGVRAEQPGVASRDAHEAVHAELSPAER
FT                   KQVSVLCTRVREPIGDTDPELGVEQVDAVLKTMVDAVHRFGGLTTQLRSDGVTALFGAP
FT                   VSQEDHAVRACYAALAMREAMPAVVGRPLDVRIGIHSGDAVVRTIGTDRAQHYDALGAV
FT                   PQLANLIDSVLRVDEIGVSADTVRCAEGFIELADRRPRVLPGAAPSVEVFILRARSGLR
FT                   LRWDARAARGLSRFVGRDTEMATLQGLLERAAYGTGQVCAIVGEAGVGKSRLVHEFVTA
FT                   ARAAGWTTLETGTSSHDNSAIYLPIADLLRTWFGIGERDTLAEAADRLSQGIGAVDPQL
FT                   AVTRPPLAALLDLPTDDPQWEIASPPQKRKRTLEAVASLIIRASENHPLVVVVEDLHWN
FT                   DDGTQAVLDHLVDCMGAARVLLLVTHRPEYRHAWFGKSYFSQIRVDSLAAESADLLLRS
FT                   LLGDDAGVLALRRRLIERTGRTPLFLEESVRALVDAGALVGQTGAYRMVRSVDTFEIPS
FT                   TVHAVLASRIDRLSAQQKGLLQTAAVIGQEFAVDLLQPVAQLEHERLLDLLGELQAAEF
FT                   LYQTRLLPHQQYTFKHALTHRVAYASVLKERRRAVHVQLVEVIERLHEQRLDEHVERLA
FT                   HHALAGELWEKAVDYLYRSACKALQRSAYQQAVEYLNRGLDIIRTLPRTPALLRHELDY
FT                   QKVLGVTMMAAKGWAAKEVLDAYTRARSLCEELADDSELFTVLRGEGQYRMIRGESEVA
FT                   RELGNRCAALTADSHDPAMRIETHHLFWTNSFFMGEYAAAGFHCAKGIALYERERDHAL
FT                   TFKYSGHDPGVCCRCFTALVQCLRGYPDKSLAISDETLELARELDHPLTTALAYWTRSF
FT                   AHILRGEPELARQWAVREIAVCEEYALPLLLSQGAFQLGWTLAQCGDLDEGIERMREGI
FT                   AAISATGAEMGLPYFNALLGEALGRAGRRGAGLVAIDRALAAVDEHGGRFQLSEMLRLK
FT                   GELLAAQRTARSEEGLALIREAVAVAQRQGACFPGLRAATSLARGLASTGNFDHACAVL
FT                   QPACEAISEGSGLTDVRAARALLAELENR"
FT                   /protein_id="YP_003609311.1"
FT   misc_feature    complement(373319..374029)
FT                   /note="DNA-binding transcriptional activator of the SARP
FT                   family [Signal transduction mechanisms]; Region: DnrI;
FT                   COG3629"
FT                   /db_xref="CDD:33428"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(<373802..373984)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cl00209"
FT                   /db_xref="CDD:153590"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(372683..373189)
FT                   /note="cyclase homology domain; Region: CHD; cd07302"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(order(372716..372718,372821..372826,
FT                   372833..372838,372848..372856,373034..373036,
FT                   373043..373051,373055..373057,373142..373150,
FT                   373160..373168,373172..373174))
FT                   /note="nucleotidyl binding site; other site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(order(373043..373045,373166..373168))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(order(372716..372718,372833..372835,
FT                   372842..372853,372884..372886,372893..372895,
FT                   373052..373057,373091..373093,373103..373105,
FT                   373112..373117,373124..373126,373142..373144))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(<371246..372622)
FT                   /note="Predicted ATPase [General function prediction only];
FT                   Region: COG3899"
FT                   /db_xref="CDD:33687"
FT                   /locus_tag="BC1002_5924"
FT   misc_feature    complement(370139..371287)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="BC1002_5924"
FT   gene            374320..375261
FT                   /db_xref="GeneID:9091303"
FT                   /locus_tag="BC1002_5925"
FT   CDS_pept        374320..375261
FT                   /locus_tag="BC1002_5925"
FT                   /gene_family="HOG000018871" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B5819"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B5819 hypothetical protein"
FT                   /db_xref="GI:295680738"
FT                   /db_xref="GeneID:9091303"
FT                   /translation="MEITTAMNPIDTSRYAKCIAASKRVRWDIDRDVIRGRSFDFSKKF
FT                   LPDALSKIDSLDFLGPDEQRMLSQIQGRTYANMFGLVERFIAAKVLEMSGPYRLGDQDA
FT                   LEALVRFSDEEIKHQELFRRIEHMCAEGMPAGYAFLPEANSVASFVLSKSTWAVLALTC
FT                   HIELFVLAHYRGSIGDDPNSSELWKDVFLYHWREESQHAILDELEWQREDARLSPEERD
FT                   KAVDELIELVAAVDDMLQTQARADADYFARICGRPLPMAEKEAVHAGLLGAYRWQYIIS
FT                   GVQEPRFSHALGSMITANQVSRIETAMAPIMS"
FT                   /protein_id="YP_003609312.1"
FT   gene            complement(375337..376492)
FT                   /db_xref="GeneID:9091304"
FT                   /locus_tag="BC1002_5926"
FT                   /pseudo
FT   gene            complement(376524..376793)
FT                   /db_xref="GeneID:9091305"
FT                   /locus_tag="BC1002_5927"
FT   CDS_pept        complement(376524..376793)
FT                   /locus_tag="BC1002_5927"
FT                   /gene_family="HOG000280989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /codon_start="1"
FT                   /product="thiamineS protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamineS protein; KEGG: rso:RS04773
FT                   hypothetical protein"
FT                   /db_xref="GI:295680739"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="GeneID:9091305"
FT                   /translation="MAHIFFAASIQRHIATPEREIDARTLGEALEAVFVAQPRLRGYIL
FT                   DDQGSLRPHLAVFVDGRRVHDREHLSDALGEQSRVYVVQALSGG"
FT                   /protein_id="YP_003609313.1"
FT   gene            complement(376885..377802)
FT                   /db_xref="GeneID:9091306"
FT                   /locus_tag="BC1002_5928"
FT   CDS_pept        complement(376885..377802)
FT                   /locus_tag="BC1002_5928"
FT                   /gene_family="HOG000162432" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gau:GAU_3706 hypothetical membrane
FT                   protein"
FT                   /db_xref="GI:295680740"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:9091306"
FT                   /translation="MRADGKASSAAAITGVLVGVAMVSTRAVSSHASPPTLAFLRYLIG
FT                   TLVLVVPVLCGPRPRFTLKDALAIVVLGVFQFALLIVLINEALRTLSAAICALVFSTMP
FT                   LFTMIFAIMVGREVFRWTKLAGLTLAVCGIALLLAASASPGGAHPSTAPAFAALFGATL
FT                   IGAVCSIMYRPYVQRYPALPTSALAMTAAVVFLAVWCVVASQPLVPGLTVSQWANVGVI
FT                   GLSSGIGYFCLLWALARIDASRVVAFQALGPVTAAAIELFIARRPPSMTLLVSIAIVVM
FT                   GLELALSEAPHWPRRSGTGRAARR"
FT                   /protein_id="YP_003609314.1"
FT   sig_peptide     complement(377704..377802)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.843 at
FT                   residue 33"
FT                   /locus_tag="BC1002_5928"
FT   misc_feature    complement(377407..377748)
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="BC1002_5928"
FT   misc_feature    complement(376954..377691)
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Region:
FT                   2A78; TIGR00950"
FT                   /db_xref="CDD:162128"
FT                   /locus_tag="BC1002_5928"
FT   misc_feature    complement(376954..377277)
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="BC1002_5928"
FT   gene            complement(377799..378719)
FT                   /db_xref="GeneID:9091307"
FT                   /locus_tag="BC1002_5929"
FT   CDS_pept        complement(377799..378719)
FT                   /locus_tag="BC1002_5929"
FT                   /gene_family="HOG000146696" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /transl_table="11"
FT                   /note="KEGG: smt:Smal_1052 transcriptional regulator, MarR
FT                   family with acetyltransferase activity; PFAM: GCN5-related
FT                   N-acetyltransferase; regulatory protein MarR; SMART:
FT                   regulatory protein MarR"
FT                   /db_xref="GI:295680741"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9091307"
FT                   /translation="MADLTVDQRAHTVRSFNRFYTRQIGVLHEHLLESEFSLTEVRILY
FT                   ELAHRADLTTSDLCRELGLNAGYLSRVISGFEKKGLVVKSRSATDARVAHLELTDHGRA
FT                   TFAPLDQASQREVIAMLERLPQTAQQQLVDAMEQIRTLLSDPEPGFILREPQPGDMGWI
FT                   VHRQAVLYAREFGWNAEYEALVAEIVAKFVREFDPKRERCWIAEKDGKPVGSVFVVRQD
FT                   DATAKLRLLAVEASARGLGIGHRLVDECIRFARYAGYRKLVLWTNSVLTDARRIYERAG
FT                   FTLVEEQPHHSFGQDLIGQNWALDL"
FT                   /protein_id="YP_003609315.1"
FT   misc_feature    complement(378348..378596)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5929"
FT   misc_feature    complement(377925..378113)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="BC1002_5929"
FT   misc_feature    complement(order(377988..377993,378021..378029))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="BC1002_5929"
FT   gene            378893..379243
FT                   /db_xref="GeneID:9091308"
FT                   /locus_tag="BC1002_5930"
FT   CDS_pept        378893..379243
FT                   /locus_tag="BC1002_5930"
FT                   /gene_family="HOG000130654" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /codon_start="1"
FT                   /product="transport-associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5898 transport-associated; PFAM:
FT                   transport-associated; SMART: Transport-associated and
FT                   nodulation region"
FT                   /db_xref="GI:295680742"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="GeneID:9091308"
FT                   /translation="MRNAPYIEGRLLIVAMFALPAFVFNNGCKSTATATPSANAPGAIA
FT                   TDDATLANRVKQALAADPALRSLPMSVATYRGVVQLSGYVDSEAQILKALAVTHAVPGV
FT                   QSVSNDLHLKPQ"
FT                   /protein_id="YP_003609316.1"
FT   misc_feature    379052..379237
FT                   /note="Putative phospholipid-binding domain; Region: BON;
FT                   cl02771"
FT                   /db_xref="CDD:155094"
FT                   /locus_tag="BC1002_5930"
FT   gene            379470..379781
FT                   /db_xref="GeneID:9091309"
FT                   /locus_tag="BC1002_5931"
FT   CDS_pept        379470..379781
FT                   /locus_tag="BC1002_5931"
FT                   /gene_family="HOG000218005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01355"
FT                   /codon_start="1"
FT                   /product="High potential iron-sulfur protein"
FT                   /transl_table="11"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bmj:BMULJ_00190 putative iron-sulfur protein"
FT                   /db_xref="GI:295680743"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:9091309"
FT                   /translation="MSLSRRHFMILAASVASTTVLSTKSNADAPVLAENDPTAQALGYK
FT                   MDVSKVDKTKFPRYQTGQTCANCQLYQGKPGSTNGPCPTYGGKLVEAKGWCNAYVKKA"
FT                   /protein_id="YP_003609317.1"
FT   sig_peptide     379470..379553
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT                   /locus_tag="BC1002_5931"
FT   misc_feature    379569..379769
FT                   /note="High potential iron-sulfur protein; Region: HIPIP;
FT                   pfam01355"
FT                   /db_xref="CDD:144811"
FT                   /locus_tag="BC1002_5931"
FT   gene            complement(379848..380264)
FT                   /db_xref="GeneID:9091310"
FT                   /locus_tag="BC1002_5932"
FT   CDS_pept        complement(379848..380264)
FT                   /locus_tag="BC1002_5932"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:pBCA077 hypothetical protein"
FT                   /db_xref="GI:295680744"
FT                   /db_xref="GeneID:9091310"
FT                   /translation="MHRSPLPGSLQCCIATTVRHFHWRFLALGRFRSSKNRLLPQKAMM
FT                   NRTIWPGIRDEIEFSKLDCAVVLSDDKSTAQQIIELLRRRSLEGVFRTLEIVMQTLSHW
FT                   IVVLTNAYMEYTTCNWNATHVYRRTVGYDQVTWC"
FT                   /protein_id="YP_003609318.1"
FT   gene            complement(380371..381387)
FT                   /db_xref="GeneID:9091311"
FT                   /locus_tag="BC1002_5933"
FT   CDS_pept        complement(380371..381387)
FT                   /locus_tag="BC1002_5933"
FT                   /gene_family="HOG000059941" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   bac:BamMC406_6431 tryptophanyl-tRNA synthetase II; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="GI:295680745"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="GeneID:9091311"
FT                   /translation="MTHTNRPTILTGDRTTGPLHLGHYIGSLRARVQLQHEAQQFLLLA
FT                   DTQALTDNVGRHQKVTQNVIEVALDYLAVGIDPAKSTIFIQSQVPELAELFQYLLNVVT
FT                   VARLERNPTIKEEIRLRGFERDIPAGFLTYPISQAADITAFKATHVPVGDDQLPMIEQT
FT                   NELVRRFNNTVDRPVLVECEAVLSQVTRLPGIDGKAKMSKSLGNAIALGATPDEITKAV
FT                   NNMYTDQNHLRVSDPGQVEGNVVFAFLDAFEPDVQKVDELKSHYRRGGLGDSVIKRVLN
FT                   ERLQSLIEPIRARRRELEEDPAEVLAILRRGTMRAREVAGETLSEVRGALGLTYFQR"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /protein_id="YP_003609319.1"
FT   misc_feature    complement(380380..381372)
FT                   /note="tryptophanyl-tRNA synthetase II; Reviewed; Region:
FT                   PRK12282"
FT                   /db_xref="CDD:171365"
FT                   /locus_tag="BC1002_5933"
FT   misc_feature    complement(380527..381366)
FT                   /note="catalytic core domain of tryptophanyl-tRNA
FT                   synthetase; Region: TrpRS_core; cd00806"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="BC1002_5933"
FT   misc_feature    complement(order(380779..380781,380785..380790,
FT                   380815..380817,380911..380913,380920..380925,
FT                   380929..380934,380938..380940,380965..380967,
FT                   380974..380976,380986..380988,381130..381132,
FT                   381244..381246,381259..381261,381310..381312,
FT                   381319..381324,381328..381330,381346..381360))
FT                   /note="active site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="BC1002_5933"
FT   misc_feature    complement(381319..381330)
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="BC1002_5933"
FT   misc_feature    complement(order(380977..380982,380989..380994,
FT                   380998..381000,381061..381066,381070..381081,
FT                   381085..381090,381097..381105,381109..381114,
FT                   381235..381240,381247..381249))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="BC1002_5933"
FT   misc_feature    complement(380776..380790)
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="BC1002_5933"
FT   gene            381692..382072
FT                   /db_xref="GeneID:9091312"
FT                   /locus_tag="BC1002_5934"
FT   CDS_pept        381692..382072
FT                   /locus_tag="BC1002_5934"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sma:SAV_359 NDP-hexose 4-ketoreductase"
FT                   /db_xref="GI:295680746"
FT                   /db_xref="GeneID:9091312"
FT                   /translation="MPIYQITRSVLERVAQAVSRSFHDDAIYSEEAAADGRLNVLLVRN
FT                   PAGPETPYISLRFPGDLLGRLETLGPKQTAIVGNHIRNIVSARLADYRNAADAGTLSRN
FT                   APFPIEFDERIFDDSAGGDAIT"
FT                   /protein_id="YP_003609320.1"
FT   gene            complement(382065..383786)
FT                   /db_xref="GeneID:9091313"
FT                   /locus_tag="BC1002_5935"
FT   CDS_pept        complement(382065..383786)
FT                   /locus_tag="BC1002_5935"
FT                   /gene_family="HOG000173156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_5997 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="GI:295680747"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="GeneID:9091313"
FT                   /translation="MNQKPHGLDNGLTNYGDHDFARYLRRSFAKSMGYTGESLDKPIVG
FT                   ICTSESGFNNCHRHFPEMIKSVERGVLAAGALPVVFPVISLGEVFLSPTSLVYRNLMAM
FT                   AVEEMIRAQPMDAVVMLGGCDKTVPAMLMGATSAGRPAAMVVAGPMMTGRHRGERLGAC
FT                   TDCRRFWSNFRAGKVPEQEIRQVEGRLAVTAGTCAVMGTASTMALIAETLGMMLPGSAA
FT                   IPAVHADRLRNCEETGALVARMALDGGPKPAEIVTPASVRNALRVLLAVSGSTNAVIHL
FT                   AAIAGRIGLKIDYDEFNRLSDETPVLVDLKPVGNGYMEDFHAAGGLEGVLRGLMPQLDL
FT                   TCRDISGQSLEERLNKPLADPIDPAVIRSTEQPVSAEGGLIVLNGSLAPGGAVLKRAAA
FT                   TPELLEHEGRAVVFTSLEDLAARIDDPDLDVRADDILVLQNAGPRSASGMPEAGYLPIP
FT                   QKLARAGVKDMVRISDARMSGTAYGTIVLHVTPEAALGGPLALVRNGDRIRLSARNKRI
FT                   DLLVHEAELARRATEIRPAEAMYARGYQRLYHDHVLSAAAGCDFDFLTAFPSDELK"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /protein_id="YP_003609321.1"
FT   misc_feature    complement(382071..383786)
FT                   /note="Dehydratase family; Region: ILVD_EDD; cl00340"
FT                   /db_xref="CDD:174127"
FT                   /locus_tag="BC1002_5935"
FT   misc_feature    complement(382110..383690)
FT                   /note="dihydroxy-acid dehydratase; Region: ilvD; TIGR00110"
FT                   /db_xref="CDD:161713"
FT                   /locus_tag="BC1002_5935"
FT   gene            complement(383783..384844)
FT                   /db_xref="GeneID:9091314"
FT                   /locus_tag="BC1002_5936"
FT                   /pseudo
FT   gene            complement(384855..385898)
FT                   /db_xref="GeneID:9091315"
FT                   /locus_tag="BC1002_5937"
FT                   /pseudo
FT   gene            complement(385917..386590)
FT                   /db_xref="GeneID:9091316"
FT                   /locus_tag="BC1002_5938"
FT                   /pseudo
FT   gene            complement(386767..387243)
FT                   /db_xref="GeneID:9091317"
FT                   /locus_tag="BC1002_5939"
FT   CDS_pept        complement(386767..387243)
FT                   /locus_tag="BC1002_5939"
FT                   /gene_family="HOG000005405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /codon_start="1"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmu:Bmul_4804 hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="GI:295680748"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="GeneID:9091317"
FT                   /translation="MTDSVLKDVEAPVRESDNSLVWSDARLLGFTPMDDVHKEFYEVAL
FT                   RLVTCTDASALAAIEEFEKHAVSHFEQEDEWMRTTNFPPRDCHIEEHEAVLKSVRDVKA
FT                   AVEAGQAGCALVHDIGMHLYNWFPGHADYLDSALAAWMTKQTMGGKPVVLRRTI"
FT                   /protein_id="YP_003609322.1"
FT   misc_feature    complement(386800..387189)
FT                   /note="cation-binding hemerythrin HHE family protein;
FT                   Provisional; Region: PRK01917"
FT                   /db_xref="CDD:167297"
FT                   /locus_tag="BC1002_5939"
FT   misc_feature    complement(<386926..387186)
FT                   /note="Hemerythrin (Hr) is a non-heme diiron oxygen
FT                   transport protein found in four marine invertebrate phyla
FT                   including priapulida, brachiopoda, sipunculida, and
FT                   annelida, as well as in protozoa. Myohemerythrin (Mhr), a
FT                   hemerythrin homolog, is found in the...; Region:
FT                   Hemerythrin; cl11605"
FT                   /db_xref="CDD:159574"
FT                   /locus_tag="BC1002_5939"
FT   misc_feature    complement(order(386944..386946,386956..386958,
FT                   386998..387000,387004..387012,387022..387024,
FT                   387028..387033,387040..387057,387061..387066,
FT                   387106..387111,387118..387123,387127..387132,
FT                   387139..387144,387151..387153,387163..387165,
FT                   387172..387183))
FT                   /note="octamerization interface; other site"
FT                   /db_xref="CDD:29622"
FT                   /locus_tag="BC1002_5939"
FT   misc_feature    complement(order(386968..386970,386980..386982,
FT                   387025..387027,387037..387039,387133..387135))
FT                   /note="diferric-oxygen binding site; other site"
FT                   /db_xref="CDD:29622"
FT                   /locus_tag="BC1002_5939"
FT   gene            387519..387764
FT                   /db_xref="GeneID:9091318"
FT                   /locus_tag="BC1002_5940"
FT   CDS_pept        387519..387764
FT                   /locus_tag="BC1002_5940"
FT                   /gene_family="HOG000222419" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_7697"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_7697 hypothetical protein"
FT                   /db_xref="GI:295680749"
FT                   /db_xref="GeneID:9091318"
FT                   /translation="MAGNRSLRSEVEKLVGPTRGHGACVRLLDRSRSGGTCRVCIQIDR
FT                   PSGTFSLFFFRHADGTWHVFPPGLRRPEMGIGGLAA"
FT                   /protein_id="YP_003609323.1"
FT   gene            complement(388050..389168)
FT                   /db_xref="GeneID:9091319"
FT                   /locus_tag="BC1002_5941"
FT   CDS_pept        complement(388050..389168)
FT                   /locus_tag="BC1002_5941"
FT                   /gene_family="HOG000281564" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.1.168"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.168"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RSc1799 branched-chain alpha-keto acid
FT                   dehydrogenase subunit E2; PFAM: catalytic domain of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein"
FT                   /db_xref="GI:295680750"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="GeneID:9091319"
FT                   /translation="MKIFKLPDLGEGLQEAEIVEWHVSDGDEVRADQPLLSVETAKAIV
FT                   EIPAPQSGRITKLFGRTGDIVHLGAPLVAFEGEGDDADAGTVVGHMEVGQHVVQDAPAA
FT                   LGTGGGVGAGGGVIKAIPAARALARKLDVDLSMVTPSGPEGVITAADVQRVAKILGEVG
FT                   PPEVLRGVRRAMAHNMARAQSEVAAATVIDDADIHAWPPHTDVTIRLIRALVAGCRAEP
FT                   ALNAWFDGHTGRRHVLEKIDLGIAVDLPDGLFVPVLRDVAHRDAADLRGGLDRMRADIR
FT                   ARKIPPEEMRGNTITLSNFGMISGKYAAPIVVPPTVAILGAGRIHEQVVAAGGAPAVHR
FT                   ILPLSLTFDHRVVTGGEAARFLAATIADLQNA"
FT                   /product="Dihydrolipoyllysine-residue
FT                   (2-methylpropanoyl)transferase"
FT                   /protein_id="YP_003609324.1"
FT   misc_feature    complement(388056..389168)
FT                   /note="branched-chain alpha-keto acid dehydrogenase subunit
FT                   E2; Reviewed; Region: PRK11856"
FT                   /db_xref="CDD:171309"
FT                   /locus_tag="BC1002_5941"
FT   misc_feature    complement(388953..389165)
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="BC1002_5941"
FT   misc_feature    complement(order(389025..389027,389037..389054,
FT                   389073..389075))
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="BC1002_5941"
FT   misc_feature    complement(389043..389045)
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="BC1002_5941"
FT   misc_feature    complement(388707..>388796)
FT                   /note="e3 binding domain; Region: E3_binding; pfam02817"
FT                   /db_xref="CDD:111687"
FT                   /locus_tag="BC1002_5941"
FT   misc_feature    complement(388056..388667)
FT                   /note="2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Region: 2-oxoacid_dh; cl02008"
FT                   /db_xref="CDD:174698"
FT                   /locus_tag="BC1002_5941"
FT   gene            complement(389173..390153)
FT                   /db_xref="GeneID:9091320"
FT                   /locus_tag="BC1002_5942"
FT   CDS_pept        complement(389173..390153)
FT                   /locus_tag="BC1002_5942"
FT                   /gene_family="HOG000281451" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /codon_start="1"
FT                   /product="Transketolase central region"
FT                   /transl_table="11"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bph:Bphy_6076 transketolase central
FT                   region"
FT                   /db_xref="GI:295680751"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="GeneID:9091320"
FT                   /translation="MADLNMIDALNLALAYELEHDPAVMLLGEDIGVNGGVFRATVGLQ
FT                   ARFGAQRVLDTPLAEAAIAGTAIGMAAMGLKPVAEIQFSGFLYPAIDHVLNHASRLRHR
FT                   TRGRLTCPLVIRTPCGAGIHAPEHHSENPEALFAHIPGLRVVTPSSPARAYGLLLAAIR
FT                   DPDPVIFFEPTRLYRLYRQTVDDNGEGLPLDTCFTLREGSDVTLVCWGGAVQDAQGAAD
FT                   LLAQEGVMAEVIDVATLKPIDMNTILASVAKTGRCVIVHEGSRTGGIGAEIAANIAERG
FT                   LYSLLAPVQRVTGYDVVVPLYRLENQYMPGASRIVAAVRQAMEAS"
FT                   /protein_id="YP_003609325.1"
FT   misc_feature    complement(389179..390144)
FT                   /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, beta subunit
FT                   [Energy production and conversion]; Region: AcoB; COG0022"
FT                   /db_xref="CDD:30372"
FT                   /locus_tag="BC1002_5942"
FT   misc_feature    complement(389632..390132)
FT                   /note="Pyrimidine (PYR) binding domain of the beta subunits
FT                   of the E1 components of human pyruvate dehydrogenase
FT                   complex (E1- PDHc) and related proteins; Region:
FT                   TPP_PYR_E1-PDHc-beta_like; cd07036"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="BC1002_5942"
FT   misc_feature    complement(order(389656..389661,389722..389727,
FT                   389770..389772,389779..389781,389845..389850,
FT                   389875..389880,389887..389889,389944..389952,
FT                   389956..389961,389968..389985,389989..389991,
FT                   389998..390000,390064..390066,390082..390084,
FT                   390088..390090))
FT                   /note="alpha subunit interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="BC1002_5942"
FT   misc_feature    complement(order(389887..389889,389896..389898,
FT                   389974..389976,389980..389982,390067..390069))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="BC1002_5942"
FT   misc_feature    complement(order(389731..389733,389737..389742,
FT                   389746..389748,389770..389775,389779..389781,
FT                   389845..389847,389854..389856,389866..389868,
FT                   389881..389883,389887..389892,389974..389985,
FT                   389989..389991,390064..390066))
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="BC1002_5942"
FT   misc_feature    complement(389212..389559)
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="BC1002_5942"
FT   gene            complement(390146..391261)
FT                   /db_xref="GeneID:9091321"
FT                   /locus_tag="BC1002_5943"
FT   CDS_pept        complement(390146..391261)
FT                   /locus_tag="BC1002_5943"
FT                   /gene_family="HOG000281335" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /codon_start="1"
FT                   /EC_number="1.2.4.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; KEGG:
FT                   bph:Bphy_6075 pyruvate dehydrogenase (acetyl-transferring)
FT                   E1 component, alpha subunit; PFAM: dehydrogenase E1
FT                   component"
FT                   /db_xref="GI:295680752"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="GeneID:9091321"
FT                   /translation="MTTTASFHIGYTRYLGPESEPVQPLPAFAREPEALISLYRAMVLT
FT                   RAFDTKAVALQRTGKLGTFASSVGQEAIGVGVASAMQADDVLFPSYRDHAAQLLRGVTM
FT                   TESLLYWGGDERGSDFSVPRFDFPNCVPIGTQVCHAAGAAYAFKLRGEPRVAVAICGDG
FT                   STSKGDFYEAMNMAGVWQTPLVLVVNNNQWAISVPRSTQSAAQTLAQKAIAAGIDGLQV
FT                   DGNDVIAVHQVMHAALAKARRGDGPTLIEALSYRLGDHTTADDATRYRDSDEIQKQWEY
FT                   EPLLRLRKYLMRMNFWDKAQDEQLGRACHAQVEAAVEAYLAVPPPDTSAMFDHLYETLP
FT                   HAMREQLESAQRFAPIAGNGQPGRNGGNGHG"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /protein_id="YP_003609326.1"
FT   misc_feature    complement(390206..391228)
FT                   /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, alpha
FT                   subunit [Energy production and conversion]; Region: AcoA;
FT                   COG1071"
FT                   /db_xref="CDD:31269"
FT                   /locus_tag="BC1002_5943"
FT   misc_feature    complement(390302..391150)
FT                   /note="Thiamine pyrophosphate (TPP) family, E1 of
FT                   PDC_ADC_BCADC subfamily, TPP-binding module; composed of
FT                   proteins similar to the E1 components of the human pyruvate
FT                   dehydrogenase complex (PDC), the acetoin dehydrogenase
FT                   complex (ADC) and the branched chain...; Region:
FT                   TPP_E1_PDC_ADC_BCADC; cd02000"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="BC1002_5943"
FT   misc_feature    complement(order(390458..390460,390470..390472,
FT                   390614..390616,390629..390631,390671..390682,
FT                   390725..390727,390737..390739,390749..390751,
FT                   390758..390769,390773..390775,390866..390871,
FT                   390923..390925,391076..391078))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="BC1002_5943"
FT   misc_feature    complement(order(390482..390484,390683..390685,
FT                   390689..390691,390770..390781,390863..390865,
FT                   390869..390871,390986..390991))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="BC1002_5943"
FT   misc_feature    complement(order(390725..390727,390734..390739,
FT                   390755..390760,390815..390817,390824..390829,
FT                   390833..390838,390845..390850,390857..390859,
FT                   390872..390874,390878..390880,390884..390886))
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="BC1002_5943"
FT   misc_feature    complement(order(390413..390421,390443..390475,
FT                   390479..390499))
FT                   /note="phosphorylation loop region"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="BC1002_5943"
FT   gene            complement(391476..392261)
FT                   /db_xref="GeneID:9091322"
FT                   /locus_tag="BC1002_5944"
FT   CDS_pept        complement(391476..392261)
FT                   /locus_tag="BC1002_5944"
FT                   /gene_family="HOG000228895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_4108 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:295680753"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9091322"
FT                   /translation="MSLKNGLRVLDFLASQPEGAGLLAIADALSLPRSTCHRLLAELIE
FT                   GGYVRQLVDHSRYILTMRMTSNGLEFLSLTGIADIAQPIIERVAAQTGELARLSLVDGE
FT                   AIIWVGKADGQRIGFRYDPDMGQAARLSCTSTGHAWLMTMTDEQAAALVLKQGFGQPNE
FT                   FGPNAPTTLKALLGFLHAARVRGYAMIDEVFAPRMSAVAVPVVSGSRCVGVISLAGPRV
FT                   RLTTGKIHEYSILLRDATNELAQLSNMAGFPSRPPLGKG"
FT                   /protein_id="YP_003609327.1"
FT   misc_feature    complement(391524..392258)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="BC1002_5944"
FT   misc_feature    complement(391995..392258)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5944"
FT   misc_feature    complement(391533..391871)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="BC1002_5944"
FT   gene            392385..393728
FT                   /db_xref="GeneID:9091323"
FT                   /locus_tag="BC1002_5945"
FT   CDS_pept        392385..393728
FT                   /locus_tag="BC1002_5945"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_4107 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:295680754"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9091323"
FT                   /translation="MSFFADSDLAAEEHSAQAHLMARRAVAGATVGTALEWFDFALYGV
FT                   VAATIFPKLFFPSLDPTASLLASLASFWAGLAARPLGAVICGMLGDRWGRRKLMLITVS
FT                   VMGVSSFLMGLLPTYHQVGILAPTLLVTLRIIQGFALGGESTGAQLMAVEHASANRRGL
FT                   YSGLLGICSPLSQILANFSLFTLAALLSSDDFDAWGWRVPFLASFVLVLLGIYIRRKVS
FT                   ETPAFEALKKTGARTRAANPLGTVFKYHWRTALRLTLFFCGPAALFYLIVVFSLSYLTK
FT                   HLGVPKQTGFMLLMVANVCAIAGALVGGYLSDRIGRKRALMIGSFCTLICCLIYFPILN
FT                   QNSIAMTMAVMGAFLGFTQFQSGIQPVWFAESFPTEARYTGSALSYSGANLLTGGPMPI
FT                   VAVALLNAFNGSPWAIVAVCGSLNLISFLMIAISRETKDTALERSSTH"
FT                   /protein_id="YP_003609328.1"
FT   misc_feature    392478..393650
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="BC1002_5945"
FT   misc_feature    392625..393677
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5945"
FT   misc_feature    order(392631..392636,392640..392645,392805..392810,
FT                   392817..392822,392829..392834,392841..392843,
FT                   392877..392882,392889..392894,392910..392912,
FT                   393177..393179,393186..393191,393198..393203,
FT                   393210..393212,393252..393254,393264..393266,
FT                   393276..393278,393285..393287,393297..393299,
FT                   393438..393440,393447..393452,393459..393461,
FT                   393480..393485,393492..393494,393525..393530,
FT                   393537..393542,393549..393554,393561..393563)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="BC1002_5945"
FT   gene            393733..394179
FT                   /db_xref="GeneID:9091324"
FT                   /locus_tag="BC1002_5946"
FT   CDS_pept        393733..394179
FT                   /locus_tag="BC1002_5946"
FT                   /gene_family="HOG000217278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.10"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.10"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_4106 3-dehydroquinate dehydratase;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="GI:295680755"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="GeneID:9091324"
FT                   /translation="MTRKLYILNGSNLNMLGMREPHLYGSTTLKDIERNCLALADALKF
FT                   DCVFRQTNSESELIDWIQEAFLQDAALIINPAGFSFGRIPVLDAVKLIRRPVVELHITN
FT                   IHRRSEEYRHSTISVAATAVICGAGANGYLLAIRAIDDLWGNQT"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /protein_id="YP_003609329.1"
FT   misc_feature    393742..394161
FT                   /note="Dehydroquinase (DHQase), type II. Dehydroquinase (or
FT                   3-dehydroquinate dehydratase) catalyzes the reversible
FT                   dehydration of 3-dehydroquinate to form 3-dehydroshikimate.
FT                   This reaction is part of two metabolic pathways: the
FT                   biosynthetic shikimate pathway...; Region: DHQase_II;
FT                   cd00466"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="BC1002_5946"
FT   misc_feature    order(393766..393768,393772..393774,393889..393903,
FT                   393910..393912,393919..393921,393964..393966,
FT                   393985..393987,393994..393999,394006..394008,
FT                   394066..394068)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="BC1002_5946"
FT   misc_feature    order(393787..393789,393802..393804,393955..393957,
FT                   393961..393966,393973..393975,393994..393996,
FT                   394033..394041,394066..394068)
FT                   /note="active site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="BC1002_5946"
FT   misc_feature    order(394042..394044,394048..394053,394084..394089,
FT                   394093..394104,394108..394116,394123..394125,
FT                   394135..394137,394147..394149,394156..394158)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:63885"
FT                   /locus_tag="BC1002_5946"
FT   gene            complement(394247..394594)
FT                   /db_xref="GeneID:9091325"
FT                   /locus_tag="BC1002_5947"
FT   CDS_pept        complement(394247..394594)
FT                   /locus_tag="BC1002_5947"
FT                   /gene_family="HOG000269058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /codon_start="1"
FT                   /product="NIPSNAP family containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   lch:Lcho_1202 NIPSNAP family protein"
FT                   /db_xref="GI:295680756"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="GeneID:9091325"
FT                   /translation="MNARSMYLAKPLLDFRVYTIALRKMPEFLDVFDRLAMPILLETLG
FT                   HPLGFWTSVVGPQNQFTHLWGYDDLADYERRCLARDTHPDFPAYLKASGHLITAQETRL
FT                   IRATALDSVAK"
FT                   /protein_id="YP_003609330.1"
FT   misc_feature    complement(394268..394555)
FT                   /note="NIPSNAP; Region: NIPSNAP; pfam07978"
FT                   /db_xref="CDD:149193"
FT                   /locus_tag="BC1002_5947"
FT   gene            complement(394591..396312)
FT                   /db_xref="GeneID:9091326"
FT                   /locus_tag="BC1002_5948"
FT   CDS_pept        complement(394591..396312)
FT                   /locus_tag="BC1002_5948"
FT                   /gene_family="HOG000245848" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /codon_start="1"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: pna:Pnap_2710 putative
FT                   succinate dehydrogenase"
FT                   /db_xref="GI:295680757"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="GeneID:9091326"
FT                   /translation="MTKEITCDLVVVGSGAAGLATAITARKRGLDVIVLEKEPVFGGTT
FT                   ALSGGVLWIPLSKFGRQQNPADTVERVREYMMSETGDNFDAAAVQCFIENGPKMVEFFE
FT                   RETEMKFVPTLYPDYHPDAPGGVDIGRSILAAPYDIRGLGKDMRRLKQPLETITFMGMM
FT                   FNSSNADLKHFFRATKSIVSFMYVARRLATHIKELALYRRGINVTSGNALAARLAKSAL
FT                   AIDIPILTSTPVKELLSEDDKVIGVRAAAADGELRITARHGVVLACGGFPHDLKRIAQV
FT                   YPHVKRGGEHLSPTPVGNTGDGLTMAQQVGGAVKLGFADAAAWMPVSKVPFGKGRTGVF
FT                   PHLLDRYKPGVIGVLRNGQRFTNESNSYHDVGAALMRACEGERETAMWLICDKVALGKY
FT                   GLGYAKPAPMPVGPLLRKGYLVKGDTIGELARNCGIAPDALEMTVHAYNRDAERGEDPA
FT                   FHRGRTSFNRYLADPDHKPNPCVAPIATGPFYAVKVVMGDLGTFDGLKTSVTGEVLRAD
FT                   GSEIEGLYAVGNDRRSVMGGNYPGAGITHGPNMTFGFVTGNAIAAKATTSKQEVCA"
FT                   /protein_id="YP_003609331.1"
FT   misc_feature    complement(394621..396312)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5948"
FT   misc_feature    complement(394606..396291)
FT                   /note="putative FAD-binding dehydrogenase; Reviewed;
FT                   Region: PRK12843"
FT                   /db_xref="CDD:139269"
FT                   /locus_tag="BC1002_5948"
FT   gene            complement(396345..397190)
FT                   /db_xref="GeneID:9091327"
FT                   /locus_tag="BC1002_5949"
FT   CDS_pept        complement(396345..397190)
FT                   /locus_tag="BC1002_5949"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   lch:Lcho_1200 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:295680758"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9091327"
FT                   /translation="MRQELENRAAASTPYALNLDGKVCVVTGAGSGIGAGIARAFAAVG
FT                   AHVALVDRNLAGAEAVAAELRKAGAVTQAIACDVSDEASVAAAADKVRAELGPVSALVN
FT                   NAGLLRAGALETVSIEDWNQAIAVNLTGYLLCARAFGRDMLAAGKGSIVHVASIASLNP
FT                   QTNSGSYSPSKAGVLLLSRQLAAEWGPRGVRSNCVLPGMIRTALSAKFYEEPGFEARRA
FT                   AATASRRIGEPEDLAGPALFLASDMAAYVNGAEVLVDGGLDCMLMDMVPRPGFNATAAA
FT                   "
FT                   /protein_id="YP_003609332.1"
FT   misc_feature    complement(396399..397037)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="BC1002_5949"
FT   gene            397274..398245
FT                   /db_xref="GeneID:9091328"
FT                   /locus_tag="BC1002_5950"
FT   CDS_pept        397274..398245
FT                   /locus_tag="BC1002_5950"
FT                   /gene_family="HOG000220004" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6092 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; Cupin 2 conserved barrel domain protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:295680759"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9091328"
FT                   /translation="MDRVDIEQDITCIMASDPQRRRTVLHFALYGAEADQPWVDMVHYE
FT                   RIPLRAGRFDFDIEPHVHDALIQVLYVTAGGGETFIDGKTWAVQAPCLIVVPARSVHGF
FT                   HFRSDIDGHVITAAQSALESLAMTAAPELLEFIRTPTVLSIDPDVERGTSLDTLFQSIG
FT                   HEAESHERWQFTAGAALTITLFVKIGRLSESARLSANSEQRTMAARIERFRALLDRHCR
FT                   ERRPVASYAGEMGVTTGQLSRICRATFGVSAIEAIDARSIHEAKRLLGYSTLSVKQIAS
FT                   ELGFQDEAYFGRFFRKQTGLRPTEYRSAAHDRSLPPEKARAD"
FT                   /protein_id="YP_003609333.1"
FT   misc_feature    397397..398194
FT                   /note="4-hydroxyphenylacetate catabolism regulatory protein
FT                   HpaA; Region: HpaA; TIGR02297"
FT                   /db_xref="CDD:131350"
FT                   /locus_tag="BC1002_5950"
FT   misc_feature    397442..397618
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="BC1002_5950"
FT   misc_feature    398093..398194
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="BC1002_5950"
FT   gene            complement(398269..401070)
FT                   /db_xref="GeneID:9091329"
FT                   /locus_tag="BC1002_5951"
FT   CDS_pept        complement(398269..401070)
FT                   /locus_tag="BC1002_5951"
FT                   /gene_family="HOG000059152" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /codon_start="1"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; GntR domain protein; cytochrome P450; KEGG:
FT                   bph:Bphy_6093 oxidoreductase FAD-binding subunit"
FT                   /db_xref="GI:295680760"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="GeneID:9091329"
FT                   /translation="MAHQITLRFEDGVTRFIDCEEGERVTDAAIRARINIPLDCRDGVC
FT                   GTCKAVCESGEYVLGDCVEDALSPDEVSARKVLTCQMSPRSDCVIQIATISDVSGTGPA
FT                   SHKGRIVACQRASDTTIAFAVELEDRADLSFLPGQYVNVQVPGTDQTRSYSFSSGPSEP
FT                   HVSFLVRNVRQGVMSTWLCETAKVGDPIEFRGPMGSFYLRAIERPVLFLAGGTGLAPFL
FT                   SMLDKIVEDGGSPYPIHMILGVNSDEDLVGIDRLETYAQRLPNFTYACTVSNADSAYPN
FT                   KGYVTHHIGASQLNGGDADVYLCGPPPMVDAVRDFLSSEGLTPRNFYYEKFAGTGLVVQ
FT                   TGEERIAPVDVDEALDLRMALELGAAQLTMGRLSSEQLITFRQLAEATAPFVRGRHFTD
FT                   VPRYIEANHAFHLFTIEASGNAQLIALYRQLAVQDYIARALSDQIEIVGDIVQQHRDIV
FT                   AAFELGDLNAARDVIALHALHSKATMSRALERMATAKTAPVAAAAPAPAPVLPAAVPQS
FT                   APQVCPFSGSTLPAYSHELDWPDGLEPFKVVDDGSQGDPYEHYRWMREHAPVLRCQSAT
FT                   SDVWFLSRYDDVYQAIRNPKLFSSEVVSPPPLTFLTLFDAPDHSRLRKVVQPSFLPLAL
FT                   DPFIDQIAQRAEDLLDAMIAKGGGDVVNDFAIPLSISTISTMIDVPNEDEEKMKFWSDE
FT                   TFSYFGRLARNAPGTGTDEQSAKAFFAYLKEAMERLAHTDSQSIGGHIARMWKDGLLSE
FT                   KEAKELCAFVFIAGHDTTTILVANAFRMFAEQPNLLRRLRENPADAERYVEEVARYRGT
FT                   VQRVSRITTEATTIAGVDLPKGAVVRLLLSAANRDSRKFADGETFDIDRDSSGHLGFGN
FT                   GMHKCLGAPLAKLETLIATKALARKIGEIALDPARPIQYVRGNNLTNSGPEHLYVKLGA
FT                   LSA"
FT                   /protein_id="YP_003609334.1"
FT   misc_feature    complement(400072..401070)
FT                   /note="anthranilate dioxygenase reductase; Provisional;
FT                   Region: antC; PRK11872"
FT                   /db_xref="CDD:171318"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(400798..401037)
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400831..400836,400927..400938,
FT                   400942..400944,400951..400953,400960..400965))
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400831..400833,400927..400929,
FT                   400936..400938,400951..400953))
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(400072..400755)
FT                   /note="Benzoate dioxygenase reductase (BenDO) FAD/NAD
FT                   binding domain. Oxygenases oxidize hydrocarbons using
FT                   dioxygen as the oxidant. As a Class I bacterial
FT                   dioxygenases, benzoate dioxygenase like proteins combine an
FT                   [2Fe-2S] cluster containing N-terminal...; Region:
FT                   BenDO_FAD_NAD; cd06209"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400072..400083,400414..400416,
FT                   400423..400425,400537..400548,400555..400557,
FT                   400561..400569,400606..400617,400651..400653))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400606..400611,400615..400617))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400477..400479,400483..400485,
FT                   400507..400509,400528..400530,400537..400539,
FT                   400546..400548))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400411..400413,400417..400428,
FT                   400438..400440))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(order(400153..400158,400336..400344,
FT                   400420..400425))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99805"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(399643..400014)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="BC1002_5951"
FT   misc_feature    complement(398281..399414)
FT                   /note="Cytochrome P450; Region: p450; cl12078"
FT                   /db_xref="CDD:176837"
FT                   /locus_tag="BC1002_5951"
FT   gene            401433..404210
FT                   /db_xref="GeneID:9091330"
FT                   /locus_tag="BC1002_5952"
FT   CDS_pept        401433..404210
FT                   /locus_tag="BC1002_5952"
FT                   /gene_family="HOG000011547" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpy:Bphyt_6278 hypothetical protein"
FT                   /db_xref="GI:295680761"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="GeneID:9091330"
FT                   /translation="MSSLRANDLLRSKEGSRLHGPDLDCWRRWGPYLSDRQWGTVREDY
FT                   SDYGTAWEYFPHDQARSRMYRWGEDGIAGFGNDPLDWCVSLALWNGRDPILKERLFGLT
FT                   NAQGNHGEDVKELYFYVDGTPTHSYMKMLYKYPHDAYPYQDLIDENGRRGADQPEYEIL
FT                   DTGVFDNDRYFDVWVEYAKHTPDDIVMRVTVENRADQHAPLHVLPLFWARNRWAWSGKP
FT                   GRPSLTLEPASVEGARVIAHNPALGTMIVTASAPQPIEWLFCENETNVRRIFGIAGAGP
FT                   FKDGFNDYLVDGDEQAIRRDAGTRAAAHVALSLAPHERAVLYLRWRPAALPGITRDDAP
FT                   LDFEALFARRIAEADEFYAALQHDIADADARLVQRQALAGMLWTKQYYQFDVTRWHDGD
FT                   PGQPKPPKGRRHGRNADWRHMCNGDVVSMPDKWEYPWYASWDLAFHAAAFAMIDPDFAK
FT                   KQLLLLVKERYMHPNGQLPAYEWAFGDANPPVHAWATWRVYELDREVTGVGDHQFLEVM
FT                   FHKLLLNFSWWVNRKDAEDRNIFQGGFLGLDNVGIFDRSSPLPTGGRIDQADGTAWMAS
FT                   YALDLMQIGLELAMTNNAYVEIAVKFFEHFLYIAEAVGCSEGCRTGLWDGRDEFFYDVL
FT                   HLPDGTRVPMRVRSIVGLIPLFAVHVLEERIYGHLPGLRERLAWFLDHRPNLAKLVSRW
FT                   TEPGKGNTTLLSLLRGYRMTALLRRALDENEFLSDHGVRALSRVHRDTPYEFDHGGAHV
FT                   CIEYQPAESDSRVFGGNSNWRGPVWMPVNYLLIESLYEFHRYYGDEFRIEYPTGSGNRC
FT                   SLSEIADGLARRVTTLFLKDERGMRPVMAAYPQLQADPRSSELVLFHEYFHGDSGRGVG
FT                   ASHQTGWSGLVALLLQPRLMKLAHLASDTAAAAAAEDARAGAPAAEDALPTMAR"
FT                   /protein_id="YP_003609335.1"
FT   misc_feature    <402750..>403031
FT                   /note="putative glycosyl hydrolase; Provisional; Region:
FT                   PRK10137"
FT                   /db_xref="CDD:170272"
FT                   /locus_tag="BC1002_5952"
FT   misc_feature    <403566..403811
FT                   /note="Mannosyl oligosaccharide glucosidase; Region:
FT                   Glyco_hydro_63; pfam03200"
FT                   /db_xref="CDD:146033"
FT                   /locus_tag="BC1002_5952"
FT   gene            404419..405741
FT                   /db_xref="GeneID:9091331"
FT                   /locus_tag="BC1002_5953"
FT   CDS_pept        404419..405741
FT                   /locus_tag="BC1002_5953"
FT                   /gene_family="HOG000015055" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10011"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF2254, membrane"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2254, membrane;
FT                   KEGG: sfu:Sfum_2428 membrane protein-like"
FT                   /db_xref="GI:295680762"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="GeneID:9091331"
FT                   /translation="MDWNRWYSLKSYLRSSLWTVPLVAVAIYAVVKPLTEMLGRWLIGH
FT                   DILDPKTGLFGLSMTGARSLVGDIVSADLAFLVFTFGSLLVAIQVAGGQYTPRIIATTL
FT                   LRDNVIRNISGLFVFTLLFANRTLGWMGDSQVHQLQVFIAALFGFASVVAFLFLIDYAA
FT                   KFLRPVSLVARVGELGIAVIEGVYPAPATGRIAPPCVDRKRGVPDRIVRHSGISGIVLA
FT                   VNLERLVAKARRTNSVIEFVPQVGDFVAVDEPLFYLYGDSGAIDENRLRTLIAFGTERT
FT                   MEQDPMFAFRILVDIALKALSAAINDPTTAVLAIDQLQRLLRVVGKRSLYTEEITDKSG
FT                   RVCVIFRTPNWEDFVHISFREIRQYGAGSIQIARRQRAAIENLLHCLPEHRHDALRVEL
FT                   TLLDREIGARHPFPEDQALARIPDSQGLGGSDTSAARQPVL"
FT                   /protein_id="YP_003609336.1"
FT   misc_feature    404455..405567
FT                   /note="Predicted membrane protein (DUF2254); Region:
FT                   DUF2254; pfam10011"
FT                   /db_xref="CDD:150659"
FT                   /locus_tag="BC1002_5953"
FT   gene            405751..406428
FT                   /db_xref="GeneID:9091332"
FT                   /locus_tag="BC1002_5954"
FT   CDS_pept        405751..406428
FT                   /locus_tag="BC1002_5954"
FT                   /gene_family="HOG000125182" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.1"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_5185 carbonic anhydrase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="GI:295680763"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="GeneID:9091332"
FT                   /translation="MQKLIMGIVEFREKMLPQYAQQFSKLALAQTPDALFITCSDSRVV
FT                   PDLLASTHPGDLFTMRNVGNLIPPATSEGVSTGDLSEASAIEYAVLVLKVANIVVCGHS
FT                   ECGAMKSVFSRNAKLKSPNLDKWLCHANNAAFRLEQEGPLDDSLKAHDQLSQLNVLVQL
FT                   EHLMTYPIVRQQVTAGALVLSGWWFDIATGAMYAYERTSRSFEVIDRAMAERMIARLAA
FT                   RAR"
FT                   /product="Carbonate dehydratase"
FT                   /protein_id="YP_003609337.1"
FT   misc_feature    405769..406344
FT                   /note="Carbonic anhydrases (CA) are zinc-containing enzymes
FT                   that catalyze the reversible hydration of carbon dioxide in
FT                   a two-step mechanism in which the nucleophilic attack of a
FT                   zinc-bound hydroxide ion on carbon dioxide is followed by
FT                   the regeneration of an...; Region: beta_CA_cladeB; cd00884"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="BC1002_5954"
FT   misc_feature    order(405838..405840,405844..405846,405865..405867,
FT                   405871..405879,405913..405915,405922..405924,
FT                   406012..406014,406027..406029,406057..406059,
FT                   406066..406068,406312..406314)
FT                   /note="active site clefts"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="BC1002_5954"
FT   misc_feature    order(405865..405867,405871..405873,406057..406059,
FT                   406066..406068)
FT                   /note="zinc binding site; other site"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="BC1002_5954"
FT   misc_feature    order(405868..405879,405883..405885,405889..405900,
FT                   405913..405921,405925..405927,405931..405933,
FT                   405997..406002,406009..406014,406129..406131,
FT                   406312..406314,406318..406323,406327..406329,
FT                   406333..406335)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48223"
FT                   /locus_tag="BC1002_5954"
FT   gene            406720..407934
FT                   /db_xref="GeneID:9091333"
FT                   /locus_tag="BC1002_5955"
FT   CDS_pept        406720..407934
FT                   /locus_tag="BC1002_5955"
FT                   /gene_family="HOG000008604" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpy:Bphyt_0915 extracellular ligand-binding receptor"
FT                   /db_xref="GI:295680764"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:9091333"
FT                   /translation="MGIRLKSVVSALALCALIDVSYAADPIKIGVDGPFTGGSSSMGVS
FT                   MRDGVRLATAEINKAGGVLGRQIVLVERDDEAKNERGVQIAQELINKEKVAAVVGYINT
FT                   GVALASQRFFQEAKIPVFNNVATGSVLTKQFTDQPDNYVFRNAAADRIQAPMIVEEAIV
FT                   KRGFKKVAILADSTNYGQLGREDLEKALGTKGVKPVAVEKFNIKDVDMTAQLLKAKEAG
FT                   AEAVLTYGIGPELAQIANGMAKLGWKVPLVGSWTLSMANYIDNASTNGEGARMPQTFIQ
FT                   EANTPKRKAFIDAYLKEFKPKNNRIESAVSAAQGYDSVYLLAAAMTQAGSIEGPKVRAA
FT                   LENLNGKVEGVVMVYDKPFTHDDHEAISPNVPVVGEVKGGRVIYAYDADRKDGNQLRAK
FT                   QASTN"
FT                   /protein_id="YP_003609338.1"
FT   sig_peptide     406720..406791
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.839 at
FT                   residue 24"
FT                   /locus_tag="BC1002_5955"
FT   misc_feature    406786..407883
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="BC1002_5955"
FT   misc_feature    406801..407829
FT                   /note="Type I periplasmic ligand-binding domain of
FT                   uncharacterized ABC (ATPase Binding Cassette)-type active
FT                   transport systems that are predicted to be involved in
FT                   transport of amino acids, peptides, or inorganic ions;
FT                   Region: PBP1_ABC_ligand_binding_like_2; cd06335"
FT                   /db_xref="CDD:107330"
FT                   /locus_tag="BC1002_5955"
FT   misc_feature    order(407023..407031,407092..407100,407254..407256,
FT                   407410..407412,407482..407484)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107330"
FT                   /locus_tag="BC1002_5955"
FT   gene            408043..408918
FT                   /db_xref="GeneID:9091334"
FT                   /locus_tag="BC1002_5956"
FT   CDS_pept        408043..408918
FT                   /locus_tag="BC1002_5956"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bpy:Bphyt_0914 inner-membrane translocator"
FT                   /db_xref="GI:295680765"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9091334"
FT                   /translation="MTILLQLIYSGIALGMIYAVIAFGYQLTFATSGTLNFGQGDALML
FT                   GALVGLTLVSLGVNYWLMIPLVCAFGLLQGAFVERIGVRPAIKIKSEFGWIMSTIALGI
FT                   IFKNVAENVWGRDDLRFPSPLPEAPLKVFGANVLPMELLVVGGALAMMLAVEFFNRKTI
FT                   FGKAVVATANDRDAAALMGINTGLVITFSYALSSLTAAFAGVLIAPLTLTGATMGAVLG
FT                   LKAFAVAIIGGLTSGLGILVGGVILGIAETTTGFYLSTGYKDVPGLVLLLIVLAMKPAG
FT                   LFGKTSIKKV"
FT                   /protein_id="YP_003609339.1"
FT   misc_feature    408073..408891
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="BC1002_5956"
FT   misc_feature    408568..408624
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="BC1002_5956"
FT   gene            408927..410867
FT                   /db_xref="GeneID:9091335"
FT                   /locus_tag="BC1002_5957"
FT   CDS_pept        408927..410867
FT                   /locus_tag="BC1002_5957"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A3708 branched chain amino acid ABC
FT                   transporter ATPase/inner membrane protein; PFAM: ABC
FT                   transporter related; inner-membrane translocator; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:295680766"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9091335"
FT                   /translation="MNLKKLVATAFVLIALAVFPVLSGNPYYIHLVETIMIYAILLFGL
FT                   DIVVGYTGQVSLGHAGLFGVGAYTAGVLFMKLGLPIFVTAPLAILVTAGFGAILALPAL
FT                   RVSGPYLAMVTLAFGTILQILINEMDFLTNGPMGVKIPKPSLGARPMNEVEYYWLVAAL
FT                   LVASLIVVHRVLKSHLGRAFEALRDSPIASDCMGVSVYRYKVYAFVISAGFAGLAGCLY
FT                   SYSEQYISPNTYNFELTILFLLAIIMGGRKTRTGAVLGSAIIVLLPKLLDDIDMFRIVA
FT                   SVLAAAVVIGAGVALARKVSTARKVAIPVLGTVGLAAFSYGIDTLADWRLTIFGLMILL
FT                   VVYYLQDGVIGFVRKSTMGGVVRASTVDTHQPATISADAVAAVHAGDAEEILQLRGILM
FT                   QFSGLKALNQVDLTVRRGTVHGLIGPNGSGKSTMMNVLTGIYVPTAGSIEYRGMSLAGK
FT                   TSSQIALAGIARTFQNVQLFGEMTALENVLVGLHHTFRAHIADVGLMSPRYRREERAAR
FT                   ERALGMLRFVGLEHVAGEEARNLPYGKQRLLEIARALALDPQVLLLDEPAAGLTAPDIK
FT                   ELVAIIRKVRDHGITVVLIEHHMDVVMSVCDRVSVLDFGQKIAEGNPADIQSNEKVIEA
FT                   YLGGETAGQAA"
FT                   /protein_id="YP_003609340.1"
FT   sig_peptide     408927..408998
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.927 at
FT                   residue 24"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    409029..409739
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    409497..409553
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410097..410843
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410100..410822
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410196..410219
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    order(410205..410210,410214..410222,410343..410345,
FT                   410616..410621,410715..410717)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410334..410345
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410544..410573
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410604..410621
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410628..410639
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   misc_feature    410703..410723
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="BC1002_5957"
FT   gene            410910..411644
FT                   /db_xref="GeneID:9091336"
FT                   /locus_tag="BC1002_5958"
FT   CDS_pept        410910..411644
FT                   /locus_tag="BC1002_5958"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A3709 branched chain amino acid ABC
FT                   transporter ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:295680767"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9091336"
FT                   /translation="MLSVKNLHAGYGKVKVLHGISIDVPKGSVVTLIGSNGAGKTTTMR
FT                   AISGMIRPSDGEITMGVGASAKRIDALDSHRIARLGLAHSPEGRRVFATMSVHDNLILG
FT                   AFPRLTWARPRGDVNADLERAIELFPRLKERRHQLAGTLSGGEQQMLAMARAIMLNPEL
FT                   VLLDEPSMGLAPILVEEVFRIIENLKGQGVTMLLVEQFAAAALNVADYGYVLENGRIAA
FT                   HGPALQLRNDPSVKAAYLGTSH"
FT                   /protein_id="YP_003609341.1"
FT   misc_feature    410910..411632
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivF; COG0410"
FT                   /db_xref="CDD:30759"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    410913..411605
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411009..411032
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    order(411018..411023,411027..411035,411168..411170,
FT                   411408..411413,411507..411509)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411159..411170
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411336..411365
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411396..411413
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411420..411431
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   misc_feature    411495..411515
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="BC1002_5958"
FT   gene            412068..413723
FT                   /db_xref="GeneID:9091337"
FT                   /locus_tag="BC1002_5959"
FT   CDS_pept        412068..413723
FT                   /locus_tag="BC1002_5959"
FT                   /gene_family="HOG000191142" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bphy_5856"
FT                   /codon_start="1"
FT                   /product="BNR/Asp-box repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_5856 BNR/Asp-box repeat-containing
FT                   protein"
FT                   /db_xref="GI:295680768"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="GeneID:9091337"
FT                   /translation="MKIDFSCLSRSILRGIAGAGVVALACSIGPGAHAQTLGSLVQVAA
FT                   GDPFSGCTADQLNAQESAFGSVLFPATSIEPWVAVDPTDPSRLLAGHQQDRWSDGGSRG
FT                   LVGVVSNDAGGTWSNSIPSGVTNCTGGKFRRASDPWVDFARDGTAFFFSLVLDPAKPTT
FT                   PFGARNSGMLVSRSTDHGATWQTPVTLIRSNSPHVLNDKNSLTADPTASDYVYAVWDQL
FT                   SVFPQTKEGAQLLAQNDGVLIARQLRNGAASAAGGAPLFKFNFTGPSFFSRSTDKGVTW
FT                   STAAPIYQPGTNAQTIDNIVRVLPDGTLLDFFTAINATPSGLSIGYIKSGDRGGNWSAP
FT                   TFINDISVVGVVSPDSGQSIRDASILYSVAVNPMSGAIYLTWQDDRFSSATCTTPTGSI
FT                   PIDGIAFSQSTDGGSTWSTPVMINKTPPNGTDPCRQQAFIPAVVASNDGNTIVVTYYDF
FT                   RNDTNTPAGFEGTDYFAVFCSTATACTNPANWSNERKLTDTSFNILNAPVAGGHFLGDY
FT                   MGLAASGSKIVYPVFGVATGPNVTAEFTRKITLP"
FT                   /protein_id="YP_003609342.1"
FT   sig_peptide     412068..412172
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.966 at
FT                   residue 35"
FT                   /locus_tag="BC1002_5959"
FT   misc_feature    412314..>413165
FT                   /note="Sialidases or neuraminidases function to bind and
FT                   hydrolyze terminal sialic acid residues from various
FT                   glycoconjugates as well as playing roles in pathogenesis,
FT                   bacterial nutrition and cellular interactions. They have a
FT                   six-bladed, beta-propeller fold...; Region: Sialidase;
FT                   cl01922"
FT                   /db_xref="CDD:92329"
FT                   /locus_tag="BC1002_5959"
FT   misc_feature    412881..>413390
FT                   /note="Sialidases or neuraminidases function to bind and
FT                   hydrolyze terminal sialic acid residues from various
FT                   glycoconjugates as well as playing roles in pathogenesis,
FT                   bacterial nutrition and cellular interactions. They have a
FT                   six-bladed, beta-propeller fold...; Region: Sialidase;
FT                   cl01922"
FT                   /db_xref="CDD:92329"
FT                   /locus_tag="BC1002_5959"
FT   misc_feature    order(412887..412895,412902..412910)
FT                   /note="Asp-box motif; other site"
FT                   /db_xref="CDD:29333"
FT                   /locus_tag="BC1002_5959"
FT   misc_feature    order(413220..413228,413235..413243)
FT                   /note="Asp-box motif; other site"
FT                   /db_xref="CDD:29333"
FT                   /locus_tag="BC1002_5959"
FT   gene            complement(413828..414577)
FT                   /db_xref="GeneID:9091338"
FT                   /locus_tag="BC1002_5960"
FT   CDS_pept        complement(413828..414577)
FT                   /locus_tag="BC1002_5960"
FT                   /gene_family="HOG000079692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF62"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   app:CAP2UW1_3654 protein of unknown function DUF62"
FT                   /db_xref="GI:295680769"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="GeneID:9091338"
FT                   /translation="MLALFTDFGADDIYVGQVRVALLRHAAAGTPIIDVLHTAPNYNAQ
FT                   AGAHLLAALAQWYPPDCVFLAVVDPGVGSERDAVVLQADGQRFVGPDNGLLSVVAARAA
FT                   HTRTWRITWRPAALSASFHGRDLFAPMAAWVSRGELPSDKLVERTGLSVQMDAGDFAQV
FT                   IYVDHYGNALTGLRAGTVPKSARLSIGDADVEYARVFSDVAAGQAFWYENSIGLVEIAV
FT                   NGGSAATQLGVRVGDPVRVQGGGESAA"
FT                   /protein_id="YP_003609343.1"
FT   misc_feature    complement(413855..414577)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1912"
FT                   /db_xref="CDD:32096"
FT                   /locus_tag="BC1002_5960"
FT   misc_feature    complement(413855..414577)
FT                   /note="S-adenosyl-l-methionine hydroxide
FT                   adenosyltransferase; Region: SAM_adeno_trans; pfam01887"
FT                   /db_xref="CDD:145188"
FT                   /locus_tag="BC1002_5960"
FT   gene            complement(414648..415625)
FT                   /db_xref="GeneID:9091339"
FT                   /locus_tag="BC1002_5961"
FT   CDS_pept        complement(414648..415625)
FT                   /locus_tag="BC1002_5961"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rlg:Rleg_4851 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:295680770"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9091339"
FT                   /translation="MTFDGRLFAGITVLAAVAESGSFVRAAEALGVSPSGVSRAISRLE
FT                   KQIGVRLLDRTTRSQTLTDEGRRLYETVSPHLVGIECAASTASGSAGVVQGKLRVNVDP
FT                   FFSRTVLASKLPALLQQFPELSVELIMRDDVGDLVADGFDLAIRFGPPPVGTLVARKLL
FT                   EARIITVASPAYLESNGRPNCPDDVVDHERILFYNPLSGRPFEWEFHRGKEVVGIPVYG
FT                   RLLVSDVGTMLNACVAGAGIAQVMSIGTETLIAQQDLVDLFPDWPDERFPLYALYPSRR
FT                   HLAAKVQAFISFCVDTQIAPNGSASSEQAKPSRSGLKRSQSRSR"
FT                   /protein_id="YP_003609344.1"
FT   misc_feature    complement(414738..415595)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="BC1002_5961"
FT   misc_feature    complement(415425..415589)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="BC1002_5961"
FT   misc_feature    complement(414747..415340)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BC1002_5961"
FT   misc_feature    complement(order(414807..414809,414888..414890,
FT                   414939..414941,415131..415133,415137..415139,
FT                   415179..415181,415296..415298,415308..415310))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BC1002_5961"
FT   misc_feature    complement(order(414912..414914,414921..414926,
FT                   414945..414959,415050..415052,415233..415253,
FT                   415257..415259,415269..415271,415278..415283,
FT                   415287..415292,415302..415307))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="BC1002_5961"
FT   misc_feature    complement(<414654..414824)
FT                   /note="ribokinase/pfkB superfamily: Kinases that accept a
FT                   wide variety of substrates, including carbohydrates and
FT                   aromatic small molecules, all are phosphorylated at a
FT                   hydroxyl group. The superfamily includes ribokinase,
FT                   fructokinase, ketohexokinase, 2-...; Region:
FT                   ribokinase_pfkB_like; cl00192"
FT                   /db_xref="CDD:176811"
FT                   /locus_tag="BC1002_5961"
FT   gene            415746..416567
FT                   /db_xref="GeneID:9091340"
FT                   /locus_tag="BC1002_5962"
FT   CDS_pept        415746..416567
FT                   /locus_tag="BC1002_5962"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /codon_start="1"
FT                   /product="aldo/keto reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bja:blr2609
FT                   oxidoreductase"
FT                   /db_xref="GI:295680771"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="GeneID:9091340"
FT                   /translation="METIKRGELAIPRLGFGTFRMPGNDCQPVVESALEVGYRHIDTAE
FT                   MYQNEESVGAAIASSGIARDELFVTTKVWHENLEPNALRRAFAASLEKLRLDFVDLYMI
FT                   HWPSRDMNLGAVLETLVHLKEAGLARGIGVCNFNMPLIKAAVEDIGAPIACHQLEYHPF
FT                   LDQTAMLAYLRSKNIPLVAYAPLAQGRAASDSTLARIGSRHGATAAQIAIAWLLDQDGV
FT                   IAIPKAQRRESQQANLDALAVRLDDDDRQAIAALRKDQRYVVPPFAPQWDA"
FT                   /protein_id="YP_003609345.1"
FT   misc_feature    415752..416513
FT                   /note="Aldo-keto reductases (AKRs) are a superfamily of
FT                   soluble NAD(P)(H) oxidoreductases whose chief purpose is to
FT                   re