(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_1

ID   BURVG_1; SV 1; empty ; DNA; empty ; PRO; 88096 BP.
XX
AC   NC_009226;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 plasmid pBVIE05, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-88096
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of plasmid pBVIE05 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-88096
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-88096
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000621.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..88096
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /plasmid="pBVIE05"
FT                   /db_xref="taxon:269482"
FT   gene            complement(3..1433)
FT                   /db_xref="GeneID:4947200"
FT                   /locus_tag="Bcep1808_7665"
FT   CDS_pept        complement(3..1433)
FT                   /locus_tag="Bcep1808_7665"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287419"
FT                   /db_xref="GeneID:4947200"
FT                   /translation="MSYSRDDFMTAIAAEVSNQPLAAQYYQAGDPRLLAQLNAMATMLA
FT                   MLSQQIDTESMEPFIKARDTTVLADASMKGILPFARPPRLALTVTNNDVTTLNIAVGRN
FT                   VIDQNGRVYVTETQASIPAGQTATVNVKQVTTRTFSHTVSNSVAFYGVQIPPNSDTEQV
FT                   ISGIYVSIGGVPYPYTPEFQNLAAGAAGYSLETDEQRRLWVKFGWANVVGVQPSNGTQI
FT                   DFTVEETFGANVLSVDASFTFESSVSSADRIATLKLASVIFAGADPLDIETLREYAKYP
FT                   STYDSSAVYLGNFDFLIRRNVFPLRFLSVWNEQVEESVRGPSVANINKLFVSALMDGVD
FT                   TTWLQGEIRRIIKLADDSYSAIFVNAVPTELPLTINAQVSVVHDVGDVEAKIRDVVYRL
FT                   YGKDSQAAAKGMMAMNNKKLSDALKTNVVALQDDGSDLQVSLAALPVTLPEQYRYVSEA
FT                   SLTVNVTQATYNDGMWSF"
FT                   /protein_id="YP_001109586.1"
FT   gene            complement(1433..1759)
FT                   /db_xref="GeneID:4947201"
FT                   /locus_tag="Bcep1808_7666"
FT   CDS_pept        complement(1433..1759)
FT                   /locus_tag="Bcep1808_7666"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287420"
FT                   /db_xref="GeneID:4947201"
FT                   /translation="MAAARPRTIRRMDTKITTADAQDMVSHWLETPVNGYLGSDYGSNF
FT                   PDLLQTPLRTGGADAVIAKLKTDVPLLAAMPRGSVNLYSQDTGPDQRRYFIDLSGQTVD
FT                   IGGK"
FT                   /protein_id="YP_001109587.1"
FT   gene            complement(1799..1912)
FT                   /db_xref="GeneID:4947202"
FT                   /locus_tag="Bcep1808_7667"
FT   CDS_pept        complement(1799..1912)
FT                   /locus_tag="Bcep1808_7667"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287421"
FT                   /db_xref="GeneID:4947202"
FT                   /translation="MHRAALATYELQLPGHRQTPRVTLEYRNTNIDSGYMQ"
FT                   /protein_id="YP_001109588.1"
FT   gene            2089..2448
FT                   /db_xref="GeneID:4947203"
FT                   /locus_tag="Bcep1808_7668"
FT   CDS_pept        2089..2448
FT                   /locus_tag="Bcep1808_7668"
FT                   /gene_family="HOG000263386" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6886 hypothetical protein"
FT                   /db_xref="GI:134287422"
FT                   /db_xref="GeneID:4947203"
FT                   /translation="MNFDLKKPCKDCPFRSDITFHLNTERVEEICDAITRKQQTFACHK
FT                   TTQHDDETGDHIPHDKEQHCAGALILLERMNKPNQMMRIAERLRYYDRQALHMDAPVFE
FT                   TPEAMIAHFRALNDE"
FT                   /protein_id="YP_001109589.1"
FT   gene            2441..3073
FT                   /db_xref="GeneID:4947204"
FT                   /locus_tag="Bcep1808_7669"
FT   CDS_pept        2441..3073
FT                   /locus_tag="Bcep1808_7669"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_2145 hypothetical protein"
FT                   /db_xref="GI:134287423"
FT                   /db_xref="GeneID:4947204"
FT                   /translation="MNEAKQKPLKAYQVDHYEGPCEGSALVFAKSNAAARTEGASELGL
FT                   GWDDVSAHRSAQFDHYAPGPVPIMALIDGGWTFHCHLHECQSPITREHHNDDGDEVDTA
FT                   ERAIVRGRKVFCDASCAAMHDASKRRRAAAEAALIELVEAKFPGCTITRIHICHDRLEP
FT                   TEPNHGIMCSAEFKFPGAKYGATYIYGEGNVARVAQYDLEAFKSIYQ"
FT                   /protein_id="YP_001109590.1"
FT   gene            3082..3789
FT                   /db_xref="GeneID:4947205"
FT                   /locus_tag="Bcep1808_7670"
FT   CDS_pept        3082..3789
FT                   /locus_tag="Bcep1808_7670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: hac:Hac_1228 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="GI:134287424"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="GeneID:4947205"
FT                   /translation="MATLKIKRLHPDAVIPKFATEGAACFDLVAIDVDNAVAHPNDRQA
FT                   AIVRTGLAVEIPPGYVMKIYSRSGHGFRDAVRLSNCVGIIDRDYRGEIKVALRADGGNY
FT                   VVNNGDRVAQAMLELAPSVQFAEVEDLSETTRGEGGFGSTGTGALPADTAATAVLDTNG
FT                   YERDDESLQCALELVGYEVPLDVIGYWPLETCIAVHDWALAAHLKASDNDVVVPECPAS
FT                   LARFAPKGCSYTI"
FT                   /protein_id="YP_001109591.1"
FT   misc_feature    3151..3432
FT                   /note="Trimeric dUTP diphosphatases; Region:
FT                   trimeric_dUTPase; cd07557"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Bcep1808_7670"
FT   misc_feature    order(3151..3156,3190..3192,3205..3210,3220..3222,
FT                   3268..3270,3274..3291,3307..3315,3331..3333,3340..3342,
FT                   3361..3363,3367..3369,3373..3375,3379..3381,3388..3402,
FT                   3409..3411,3421..3423)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Bcep1808_7670"
FT   misc_feature    order(3280..3288,3331..3339,3346..3348,3358..3363)
FT                   /note="active site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Bcep1808_7670"
FT   gene            3797..4099
FT                   /db_xref="GeneID:4947206"
FT                   /locus_tag="Bcep1808_7671"
FT   CDS_pept        3797..4099
FT                   /locus_tag="Bcep1808_7671"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287425"
FT                   /db_xref="GeneID:4947206"
FT                   /translation="MNTNLDARRAALRDAEGVMIDGPRIAAPGARIDASDLAQMLTDAM
FT                   RASRIPRLTLLANAVREAPVVDLLIALAPMADAIARHYARSIPETAAESPTTSRD"
FT                   /protein_id="YP_001109592.1"
FT   gene            4155..5558
FT                   /db_xref="GeneID:4947207"
FT                   /locus_tag="Bcep1808_7672"
FT   CDS_pept        4155..5558
FT                   /locus_tag="Bcep1808_7672"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_4971 hypothetical protein"
FT                   /db_xref="GI:134287426"
FT                   /db_xref="GeneID:4947207"
FT                   /translation="MSQDHQNPRVLGRLSTLNADLPTFQDRVQPWLMECFGPVIAGDRE
FT                   ERNHRFFEEAAELVQACGMTASEAFQLVNYVWNRPVGEPHQETGGVMVTLAALCLANGL
FT                   DMHEAAETELARVWTKVEAIRTKQAAKPKHSPLPQAVETQPIMRFNLIPGGLINPEPNG
FT                   LYVRFEDHIRALNTPRAAAPVQTGDRLTDVKANDIVARGGYKVTGAVLANEEGSRCIVE
FT                   MSAVRWLDNQEMWRLMHPDAQAAQPVASVTISKPGDSVTGIVFMALNEHGRATLGKGKH
FT                   QLYAEQRATTNADTLVSLLRSIRPNFGDVGTRDADVRRKQGYIDEAIALLTTGPGLAPS
FT                   ITPNLEGLKARLLAPRWPLTRNADGALYHPDMPVMDEGTDYAGFLKAFGLECCFTTLES
FT                   EDSDKSEAYHEGRMTLAEWTPAYPAHEEGTQPFTLLEVFDTEDGPMATFIRPMQAAPRR
FT                   RRTAAENKA"
FT                   /protein_id="YP_001109593.1"
FT   gene            5889..6545
FT                   /db_xref="GeneID:4947208"
FT                   /locus_tag="Bcep1808_7673"
FT   CDS_pept        5889..6545
FT                   /locus_tag="Bcep1808_7673"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287427"
FT                   /db_xref="GeneID:4947208"
FT                   /translation="MDTKPTPEVAAEPAPLSLARVSQRTHDRAARVIERCRFHVTGYVL
FT                   SDVWDLRKAIVEEGAVRWLPNREDFTRVMAWQDTKGPNTPPDEAIGDELIGTAAQAVSV
FT                   PPIVLAAPAAEPSRPVLTAPPSARLLESTEEALGVLAGELGCVRNEDIPHNAGWFVPGK
FT                   ATAYASALDAIKGLVSSLKQGGTVFDCAGKSGAAEKLPKKVDQPVALEANQADLF"
FT                   /protein_id="YP_001109594.1"
FT   gene            6598..7413
FT                   /db_xref="GeneID:4947209"
FT                   /locus_tag="Bcep1808_7674"
FT   CDS_pept        6598..7413
FT                   /locus_tag="Bcep1808_7674"
FT                   /gene_family="HOG000263387" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methionine biosynthesis MetW;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   pol:Bpro_5441 methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like"
FT                   /db_xref="GI:134287428"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:4947209"
FT                   /translation="MAAGNRNHGFISATHSHHKTKATTKIMKLSTDKILKKVVQLAHTL
FT                   APTGKTHLDIGSGTGELIALLRNANGMTSRACDYTDELMRLPGQKVDIVNLNVDSTLPY
FT                   DGQSFDVVTCTEVVEHLENYRSLVREAYRVTKPGGVAIFTTPNVLNLKSRLRFMFFGFW
FT                   NLFGPLPITRSENFSTAGHITPVPYFYLAHALHEAGFKSVELEIDKVQRSAIPRLFVWW
FT                   PFISLLSLSSKRREVKKYKTVDAGNSKIVDDMNTLKMLTGRTIIVSARR"
FT                   /protein_id="YP_001109595.1"
FT   misc_feature    6754..7029
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep1808_7674"
FT   misc_feature    order(6760..6780,6829..6834,6883..6891,6940..6942)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep1808_7674"
FT   gene            complement(7709..7963)
FT                   /db_xref="GeneID:4947210"
FT                   /locus_tag="Bcep1808_7675"
FT   CDS_pept        complement(7709..7963)
FT                   /locus_tag="Bcep1808_7675"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287429"
FT                   /db_xref="GeneID:4947210"
FT                   /translation="MRTSIVSPSSFAAESLLYALTQINARGQNKKTSYVWKTTAAFFAR
FT                   RQLQLTRLMRGSSRGAKVEAGIAEIPDCRAKPVAFLDWE"
FT                   /protein_id="YP_001109596.1"
FT   gene            8384..9478
FT                   /db_xref="GeneID:4947211"
FT                   /locus_tag="Bcep1808_7676"
FT   CDS_pept        8384..9478
FT                   /locus_tag="Bcep1808_7676"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287430"
FT                   /db_xref="GeneID:4947211"
FT                   /translation="MTTDKSRADALTGDKRQALGEALTEYFAELDRDIGIDTPDRILSL
FT                   IDYHDERFIYDLIDRVIVPTIAASPVEQHEAAPAGIEPPRHIIDAAMDVARDQYGHGVT
FT                   RASIVAIWKALGRPWAAPLEGTGNGADERAACEKAYQATASNRRTDELSFEAGWECAVE
FT                   WAHARAPRTEVAGAVPNPTGDQLRAAVRSVGSLGTNHADAPHEYVLAGWRAAMRAAAPS
FT                   ADAAAASQPVSCKCRRLGDWDGAHHPLCDGAAPHPAAAAGQEAVEPVATGHGLSGIPRA
FT                   AFGPHTEADRIDHCGACGAENAPQKDDVCPTCGATCSLVSTWGGFQHERYRNGQRYANN
FT                   GPQWWEDGPQPAAPTTATSPSAEG"
FT                   /protein_id="YP_001109597.1"
FT   gene            9657..10184
FT                   /db_xref="GeneID:4947212"
FT                   /locus_tag="Bcep1808_7677"
FT   CDS_pept        9657..10184
FT                   /locus_tag="Bcep1808_7677"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_II1012 GP38"
FT                   /db_xref="GI:134287431"
FT                   /db_xref="GeneID:4947212"
FT                   /translation="MNDRTNPVESKAAQAAEPVTQWQYRTKVTTGVWSHWHNCKEAQAQ
FT                   RLREPEYATYNQVRALYDTPRPTAQADYRGEDAYVTKRLSEALASVYTTLIGDDKADVD
FT                   ENMNAFERVERAAQVIRLEVELYRGQADAREGLTADDVSELKGMTSDPRLFEAEREAIR
FT                   KAVALLQGANQS"
FT                   /protein_id="YP_001109598.1"
FT   gene            10242..10862
FT                   /db_xref="GeneID:4947213"
FT                   /locus_tag="Bcep1808_7678"
FT   CDS_pept        10242..10862
FT                   /locus_tag="Bcep1808_7678"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287432"
FT                   /db_xref="GeneID:4947213"
FT                   /translation="MPTTRISTARTNRWIGLMGSTMKNAEPTMPNNNVLTAGERNAIER
FT                   AISEVELCCQFSLANELRALLAAHPGQPEPRDAIARSKRILMLVDEYHDNPTSDTRTAL
FT                   RVALMDEFQPEPRAEVAEEQPSLTNPLTPYGMLVRALRVAAKTTLNDMAKHMQCGPAAL
FT                   SAVEFGRKPLTDAMVADTAAYFSSVGIHDTLHALNAARAGDAS"
FT                   /protein_id="YP_001109599.1"
FT   gene            10859..11224
FT                   /db_xref="GeneID:4947214"
FT                   /locus_tag="Bcep1808_7679"
FT   CDS_pept        10859..11224
FT                   /locus_tag="Bcep1808_7679"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287433"
FT                   /db_xref="GeneID:4947214"
FT                   /translation="MSKYGKLAAPSITDGIIRTSRGRAYVLSDWPDGGRPTDHFDQGRW
FT                   ADCLHACLFAASLRGIPADIEDDGPVHELSHLVCGIPICTHNTMENLREQVHELELFVS
FT                   DFVSRAGLNPAPAGRGA"
FT                   /protein_id="YP_001109600.1"
FT   gene            11221..11544
FT                   /db_xref="GeneID:4947215"
FT                   /locus_tag="Bcep1808_7680"
FT   CDS_pept        11221..11544
FT                   /locus_tag="Bcep1808_7680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB3538 hypothetical protein"
FT                   /db_xref="GI:134287434"
FT                   /db_xref="GeneID:4947215"
FT                   /translation="MSKRFEFERFDVRGCACDECDTGVTPSAEFDGEWVKAQAALDREA
FT                   VLQAQIRTLEVQLKETRARALDEAAAAISDHRRAGREWVPASFWANVTNEAAARIRALK
FT                   EAK"
FT                   /protein_id="YP_001109601.1"
FT   gene            11541..11990
FT                   /db_xref="GeneID:4947216"
FT                   /locus_tag="Bcep1808_7681"
FT   CDS_pept        11541..11990
FT                   /locus_tag="Bcep1808_7681"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1033 hypothetical protein"
FT                   /db_xref="GI:134287435"
FT                   /db_xref="GeneID:4947216"
FT                   /translation="MRELEPCPTCGSGDVGGASGIVHCYRCKAEMRAATTPEAAERWNI
FT                   RAVFIRHGFIIPTDSEAIYRAARALLEHDRERRGNPGEDAMQTAARDLPDGYELRVCLE
FT                   RGAGWVEFYAPDGEAVDLADDTDDGMTGRIRSATQAAIEHAKERT"
FT                   /protein_id="YP_001109602.1"
FT   misc_feature    11550..11681
FT                   /note="restriction alleviation and modification protein;
FT                   Reviewed; Region: lar; cl08047"
FT                   /db_xref="CDD:174921"
FT                   /locus_tag="Bcep1808_7681"
FT   gene            12375..12659
FT                   /db_xref="GeneID:4947217"
FT                   /locus_tag="Bcep1808_7682"
FT   CDS_pept        12375..12659
FT                   /locus_tag="Bcep1808_7682"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287436"
FT                   /db_xref="GeneID:4947217"
FT                   /translation="MPKGRRIYGVFANTSYEGGDIVCSFDSEDDAKAFAQKCRDYEEKR
FT                   PAMLDADATDADWDAYIKRNANWEKRHPARPYFMRDYAVAPFPHHTKKD"
FT                   /protein_id="YP_001109603.1"
FT   gene            12669..12896
FT                   /db_xref="GeneID:4947218"
FT                   /locus_tag="Bcep1808_7683"
FT   CDS_pept        12669..12896
FT                   /locus_tag="Bcep1808_7683"
FT                   /gene_family="HOG000263188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6383 hypothetical protein"
FT                   /db_xref="GI:134287437"
FT                   /db_xref="GeneID:4947218"
FT                   /translation="MARNQRDTPPLKDGEYWATCKERSPMAAILNGHGAVFPQSRMTVR
FT                   DGWAYFMRDGKEVWRCNARYAAFNFTIQDA"
FT                   /protein_id="YP_001109604.1"
FT   gene            12896..13210
FT                   /db_xref="GeneID:4947219"
FT                   /locus_tag="Bcep1808_7684"
FT   CDS_pept        12896..13210
FT                   /locus_tag="Bcep1808_7684"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287438"
FT                   /db_xref="GeneID:4947219"
FT                   /translation="MKKPYLVEMTFTIAVMANDENHAAEVAEEHACEAVTHGDIPPTAG
FT                   SIDLLDRLDKLRDGWTGDCVPYGADDDADLKILIAEQTGGPAGTLDTHTIDMFKEQVAA
FT                   "
FT                   /protein_id="YP_001109605.1"
FT   gene            13207..13521
FT                   /db_xref="GeneID:4947220"
FT                   /locus_tag="Bcep1808_7685"
FT   CDS_pept        13207..13521
FT                   /locus_tag="Bcep1808_7685"
FT                   /gene_family="HOG000165187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nmu:Nmul_A1711 hypothetical protein"
FT                   /db_xref="GI:134287439"
FT                   /db_xref="GeneID:4947220"
FT                   /translation="MKVSEMSGASLNYWVARAEGVDHAIATRDAMNYRPSEVWSQGGPI
FT                   IDRERITVNAWQDGSGEWTADVERATGPIAAYGGKTALIAAMRAYVASKFGEEVPDAGI
FT                   "
FT                   /protein_id="YP_001109606.1"
FT   misc_feature    13207..13488
FT                   /note="Protein of unknown function (DUF2591); Region:
FT                   DUF2591; cl11584"
FT                   /db_xref="CDD:159559"
FT                   /locus_tag="Bcep1808_7685"
FT   gene            13508..13879
FT                   /db_xref="GeneID:4947221"
FT                   /locus_tag="Bcep1808_7686"
FT   CDS_pept        13508..13879
FT                   /locus_tag="Bcep1808_7686"
FT                   /gene_family="HOG000165187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_3432 hypothetical protein"
FT                   /db_xref="GI:134287440"
FT                   /db_xref="GeneID:4947221"
FT                   /translation="MQVSELTGAMLDYWVARGWELTDPVIGSDDVCRVLVKPAFESQPR
FT                   RVNYLPSSSWVDGGPIIELGHISVRWIDDETLYGQPVPPHWVAEHPSVNYGIEGATALE
FT                   AAMRVYVASKFGDTVPDNE"
FT                   /protein_id="YP_001109607.1"
FT   misc_feature    13508..13849
FT                   /note="Protein of unknown function (DUF2591); Region:
FT                   DUF2591; cl11584"
FT                   /db_xref="CDD:159559"
FT                   /locus_tag="Bcep1808_7686"
FT   gene            13938..14183
FT                   /db_xref="GeneID:4947222"
FT                   /locus_tag="Bcep1808_7687"
FT   CDS_pept        13938..14183
FT                   /locus_tag="Bcep1808_7687"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287441"
FT                   /db_xref="GeneID:4947222"
FT                   /translation="MLACAALTACGHQPVVENNEIGYMSRQEVSAAIADCESAGQRASV
FT                   IYAKADWRGKKVPVPVDVQCAPRGPGNYRIGLQRDE"
FT                   /protein_id="YP_001109608.1"
FT   gene            complement(14243..14425)
FT                   /db_xref="GeneID:4947223"
FT                   /locus_tag="Bcep1808_7688"
FT   CDS_pept        complement(14243..14425)
FT                   /locus_tag="Bcep1808_7688"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287442"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="GeneID:4947223"
FT                   /translation="MKASDLSHSLAVLGWSQAEFARRLGVDPTTVSRWVSGRSKFPKWV
FT                   GEYLRLAVLVKTALE"
FT                   /protein_id="YP_001109609.1"
FT   misc_feature    complement(<14306..14389)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Bcep1808_7688"
FT   gene            15280..15996
FT                   /db_xref="GeneID:4947224"
FT                   /locus_tag="Bcep1808_7689"
FT   CDS_pept        15280..15996
FT                   /locus_tag="Bcep1808_7689"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_0214 hypothetical protein"
FT                   /db_xref="GI:134287443"
FT                   /db_xref="GeneID:4947224"
FT                   /translation="MASVTIELGSGKRATLTRASGSAGANLSAGQRSDVSELMLHWPKY
FT                   EGLTANAREYLRQLGLDALQGAPLDALRSAIEEGRVAVEISRHVVGGGASGGQPSTPPF
FT                   PRASRLASVPGVASLPVDKPLPSWATPSDVSAGELISYLESVVGGAGATLADSASGLVD
FT                   GTPLGDAAPFSLDDSPLGDVLNVAAVDPFQEEQCFARYEIDMEMCAAAGAMYKDPRTYA
FT                   LCSQRAFDKYQTCRGM"
FT                   /protein_id="YP_001109610.1"
FT   gene            15998..16306
FT                   /db_xref="GeneID:4947225"
FT                   /locus_tag="Bcep1808_7690"
FT   CDS_pept        15998..16306
FT                   /locus_tag="Bcep1808_7690"
FT                   /gene_family="HOG000263388" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5274 hypothetical protein"
FT                   /db_xref="GI:134287444"
FT                   /db_xref="GeneID:4947225"
FT                   /translation="MSKPQRATIVFYDEDTEQVTLCTVFRKDVQAVLDRELNAGVAITI
FT                   PPHAEPNDGCEITDEDARRLGGMALLMQAGAHPELRDRLKFAEAGSVDWSPVRRPDA"
FT                   /protein_id="YP_001109611.1"
FT   gene            complement(16329..16955)
FT                   /db_xref="GeneID:4947226"
FT                   /locus_tag="Bcep1808_7691"
FT   CDS_pept        complement(16329..16955)
FT                   /locus_tag="Bcep1808_7691"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: vei:Veis_3355
FT                   resolvase, N-terminal domain"
FT                   /db_xref="GI:134287445"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:4947226"
FT                   /translation="MKVARVYLRVSTEQQDIERQEGIVEGARAAGYYVAGVYREKASGA
FT                   SVDRPELQRMIADLQPGEVVIAEKIDRISRLPLADAERLVASIREKGARLAVPGIVDLT
FT                   DLAADARGVAKVVLESVQDMLLKVALQAARDDYEDRRERQRQGIAIAKRDGRYAGRKPD
FT                   EAVHRRVLALLAGGHGVSDAARLAGCSPATVKRVRAAAQKVESPS"
FT                   /protein_id="YP_001109612.1"
FT   misc_feature    complement(16566..16946)
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cl02788"
FT                   /db_xref="CDD:155104"
FT                   /locus_tag="Bcep1808_7691"
FT   misc_feature    complement(order(16731..16733,16740..16745,16923..16925,
FT                   16929..16931))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="Bcep1808_7691"
FT   misc_feature    complement(16923..16925)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="Bcep1808_7691"
FT   gene            complement(16952..17248)
FT                   /db_xref="GeneID:4947227"
FT                   /locus_tag="Bcep1808_7692"
FT   CDS_pept        complement(16952..17248)
FT                   /locus_tag="Bcep1808_7692"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287446"
FT                   /db_xref="GeneID:4947227"
FT                   /translation="MTIKVEVETLRMVMQLNRDAIDMKVPMLDEFKLHFMRNRRRILEN
FT                   FRLHGVGMSMAMDALSSDDGNDGLAELKAEVARYQGWVDDEIGKLDAMKEDLE"
FT                   /protein_id="YP_001109613.1"
FT   gene            complement(17264..17761)
FT                   /db_xref="GeneID:4947228"
FT                   /locus_tag="Bcep1808_7693"
FT   CDS_pept        complement(17264..17761)
FT                   /locus_tag="Bcep1808_7693"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287447"
FT                   /db_xref="GeneID:4947228"
FT                   /translation="MSEQTFEVSKRLEKAGGGWNVKFYRDGIEMGGGAFPADPHRDPHA
FT                   GMYWWNGLAESDRAEWMKRAGDTGKAVDAWAAYLDSEAHAAALGAGEEWVGGTLDAGEL
FT                   REREPFDALRERITQLMRDAEALGLSCASFFRSPGSARGPVAYVLIGETAEDVEQARAD
FT                   KR"
FT                   /protein_id="YP_001109614.1"
FT   gene            complement(17881..18153)
FT                   /db_xref="GeneID:4947229"
FT                   /locus_tag="Bcep1808_7694"
FT   CDS_pept        complement(17881..18153)
FT                   /locus_tag="Bcep1808_7694"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287448"
FT                   /db_xref="GeneID:4947229"
FT                   /translation="MTTRTLIVLGPAALGAAIARSLADGSVIVTADDFGRVRERYAEPV
FT                   KVEARDYDYERESEVAHLRRENRWRERRNNAHINTRIKAQQRGAR"
FT                   /protein_id="YP_001109615.1"
FT   sig_peptide     complement(18082..18153)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7694"
FT                   /product="hypothetical protein"
FT   gene            complement(18167..18793)
FT                   /db_xref="GeneID:4947230"
FT                   /locus_tag="Bcep1808_7695"
FT   CDS_pept        complement(18167..18793)
FT                   /locus_tag="Bcep1808_7695"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287449"
FT                   /db_xref="GeneID:4947230"
FT                   /translation="MRKLFNHSTYWALTIGVTLAMVEAIALGSRWLFDTLGGKLTMVGF
FT                   WSAVAAAFVYNVARTYRSAEADEHIRGKLGALGRICGMLLCWRTVLMAVLAFFAWFAWR
FT                   DIGSYHEAHSWAVPDALLVLGFLVCLAALAFLAGRESRNRAVSDLRGLIAKAQAEYGAL
FT                   AAHHGSMVAQLGGASESTACGRQDANAELSSADLLAASQQFAAQA"
FT                   /protein_id="YP_001109616.1"
FT   sig_peptide     complement(18713..18793)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.622) with cleavage site probability 0.457 at
FT                   residue 27"
FT                   /locus_tag="Bcep1808_7695"
FT                   /product="hypothetical protein"
FT   gene            complement(18859..19446)
FT                   /db_xref="GeneID:4947231"
FT                   /locus_tag="Bcep1808_7696"
FT   CDS_pept        complement(18859..19446)
FT                   /locus_tag="Bcep1808_7696"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neq:NEQ415 hypothetical protein"
FT                   /db_xref="GI:134287450"
FT                   /db_xref="GeneID:4947231"
FT                   /translation="MGFALVLALNFGISWLNCWSVGGIWQESKALGGWIRLVAWCAAAQ
FT                   SAIGFSSVIGFVAGYALYATGHLPPAAARSAASLWYLVVIVPAIGTGLVLTIQSWIVAF
FT                   RTRRILDMGIAAYNTFAQVKNMVDAVSGIGEAFSVVGDLFKSDSKDDDGGAIVMLVIGL
FT                   VAFALAGGVILTAVLIRRYSGRLSLPARAAAA"
FT                   /protein_id="YP_001109617.1"
FT   gene            complement(19446..19751)
FT                   /db_xref="GeneID:4947232"
FT                   /locus_tag="Bcep1808_7697"
FT   CDS_pept        complement(19446..19751)
FT                   /locus_tag="Bcep1808_7697"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287451"
FT                   /db_xref="GeneID:4947232"
FT                   /translation="MSGRPNKEGIAGVLAHVRRANALREEQADLEQAVKAAEERLKTVR
FT                   EQIGKADALKLKAMAQMDVLHSGNFGFEQRLTAFLGELIRQAEQKDVAVANKGEAE"
FT                   /protein_id="YP_001109618.1"
FT   gene            complement(19748..20380)
FT                   /db_xref="GeneID:4947233"
FT                   /locus_tag="Bcep1808_7698"
FT   CDS_pept        complement(19748..20380)
FT                   /locus_tag="Bcep1808_7698"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pca:Pcar_0531 hypothetical protein"
FT                   /db_xref="GI:134287452"
FT                   /db_xref="GeneID:4947233"
FT                   /translation="MKVLQLTALDGSKWNIPVEVIARNCADYYAPIDFGGDADAALSGI
FT                   LAQFEKDPSEAAEWASNNMNWSDVKERAVCVSGPEPINMEDSWMEGEKRVVDVPDAPAE
FT                   CGESDATPLRWYQRGALSIANADALKPSLVIRAVAEQPRVLFSIRADGRVELGDDVTPD
FT                   EAARAFWDNVRLMGARMGIAVGAQDDAAGKVRALEAGNRPLVAETQS"
FT                   /protein_id="YP_001109619.1"
FT   gene            complement(20596..20949)
FT                   /db_xref="GeneID:4947234"
FT                   /locus_tag="Bcep1808_7699"
FT   CDS_pept        complement(20596..20949)
FT                   /locus_tag="Bcep1808_7699"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287453"
FT                   /db_xref="GeneID:4947234"
FT                   /translation="MDSMQEPPPTIITREQAAEQGLTRYFTGEACRNGHIAERNTKSRR
FT                   CVECERRRAYASYKKAMQTDPAARRAAIAASVKRHYQRHAAEILAKKKKYYEENAEAIK
FT                   KRMRDYRAAKNQQ"
FT                   /protein_id="YP_001109620.1"
FT   gene            complement(20959..22488)
FT                   /db_xref="GeneID:4947235"
FT                   /locus_tag="Bcep1808_7700"
FT   CDS_pept        complement(20959..22488)
FT                   /locus_tag="Bcep1808_7700"
FT                   /gene_family="HOG000263389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rru:Rru_A2590 hypothetical protein"
FT                   /db_xref="GI:134287454"
FT                   /db_xref="GeneID:4947235"
FT                   /translation="MASRRTLLQDPRYLSFVERYADDCTRFAIEVCGLKAPTHHQIQMF
FT                   DSVSKQGSRTSVSSGHGTGKTSGFAIIALWHLLCYYLSNTILTAPKISTVSDGVWKEFA
FT                   DLSTKISNGPQSWIWEYFVIESERVYVRGYKLNWFVIAKSAPRGSPENLAGAHRDWLLW
FT                   LADEASGIPDDNFGVITGSLTDERNRMCLASQPTRSSGFFYETHHALSRAEGGPWNNLV
FT                   FNSEFSPIVSAKFIAEKKLQYTEEEYQIKVQGRFPENSSKYLVGPQAIEACVGRTVIKP
FT                   DEHWGWLLPVDVGGGGWRDETVMPALHVIGRGEYGMDARRAQLISVPLHSNTQDPAQLH
FT                   GVIVHAARERSNATAMIDAGGMGLIVCKQLDLDGFSQYRKVNWGNPNFAKEYKDRYVNQ
FT                   RAQACCGFARAITEGRFGINPDVPKSFVKKLVKQGSRIPYFWDEKARRQIMKKEDMREK
FT                   ENLPSPDVFDALSFAFLEDAHYSLAEETVVDAGDQKEIARQALLASMGLTA"
FT                   /protein_id="YP_001109621.1"
FT   misc_feature    complement(<22204..22404)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="Bcep1808_7700"
FT   gene            complement(22488..23378)
FT                   /db_xref="GeneID:4947236"
FT                   /locus_tag="Bcep1808_7701"
FT   CDS_pept        complement(22488..23378)
FT                   /locus_tag="Bcep1808_7701"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287455"
FT                   /db_xref="GeneID:4947236"
FT                   /translation="MATRSKAPVAASGRRAGKTTAQKEEIAQANAKGQTVEVRGPGGST
FT                   IHEPGKAPRKVARKAPADKPQAKGAPAAKKPARKADKAPSNGKVAADGKLLPKAPDTVA
FT                   TPEVKRPVGRPSVYRPEFCDALIAFFRIEVERTEAVVVPDPSSEGGTKTEMVKVLNTFP
FT                   TLERFADSIDVTRQTLYDWAHATVDTPDGPTLRHPEFSYAYARARDLQAALLQEGGMAG
FT                   AYESRFATLATKNLIGWRDQIEQVVDQTITAVNTTDLDAIYEKARERSKQAEEEAKARA
FT                   AAAGVEGMENGGVGA"
FT                   /protein_id="YP_001109622.1"
FT   gene            complement(23388..24137)
FT                   /db_xref="GeneID:4947237"
FT                   /locus_tag="Bcep1808_7702"
FT   CDS_pept        complement(23388..24137)
FT                   /locus_tag="Bcep1808_7702"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   ajs:Ajs_0932 putative transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="GI:134287456"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4947237"
FT                   /translation="MKVSKNLPKGYGTSASRKKPEMTEGQRDKLVRESLRRFKRDPRKP
FT                   DDLEKLRYNLIVARVMAGLTAVEAAQKLGYANSTQLSLIESGERKTPDSYRFLMDCARV
FT                   YSCSVDFLLGLTPHVDESARVAHEHAMARGIEDIGQGIASILTTAIVKYTEQAHPVASE
FT                   YQRMLTAVERVDQAVSVMRDRFGFDDVPGSAPVLAAVEQLSAFAEPIRDKLRHFQNVEA
FT                   YIDDVKQGRMPAITYLSERHAQFKMAF"
FT                   /protein_id="YP_001109623.1"
FT   misc_feature    complement(23802..23978)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Bcep1808_7702"
FT   gene            complement(24134..24595)
FT                   /db_xref="GeneID:4947238"
FT                   /locus_tag="Bcep1808_7703"
FT   CDS_pept        complement(24134..24595)
FT                   /locus_tag="Bcep1808_7703"
FT                   /gene_family="HOG000263390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1367; KEGG:
FT                   hso:HS_1399 hypothetical protein"
FT                   /db_xref="GI:134287457"
FT                   /db_xref="InterPro:IPR009797"
FT                   /db_xref="GeneID:4947238"
FT                   /translation="MEILLTKAADGTLRPLDEAQADLLKRYATDTLIRCEVKQVRNPRF
FT                   HRKFFALLTLGFESWEPPILEYKGFEVQKDFEHFREDVTIAAGFYVVTTNLHGSVRLRA
FT                   QSISFASMKQDEFERLYNAVANVLLQKVLTRYTRADLDQVINRVLGFCS"
FT                   /protein_id="YP_001109624.1"
FT   misc_feature    complement(24140..24592)
FT                   /note="Protein of unknown function (DUF1367); Region:
FT                   DUF1367; pfam07105"
FT                   /db_xref="CDD:148613"
FT                   /locus_tag="Bcep1808_7703"
FT   gene            complement(24599..25090)
FT                   /db_xref="GeneID:4947239"
FT                   /locus_tag="Bcep1808_7704"
FT   CDS_pept        complement(24599..25090)
FT                   /locus_tag="Bcep1808_7704"
FT                   /gene_family="HOG000111689" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1064; KEGG:
FT                   bte:BTH_II1034 GP72"
FT                   /db_xref="GI:134287458"
FT                   /db_xref="InterPro:IPR009414"
FT                   /db_xref="GeneID:4947239"
FT                   /translation="MAKGGKKKGSKGVVRWSAAQLAAYLANRPGATSTTVAGGAVAPAE
FT                   PADDVPARRGKYNAKPTYVGTIKFDSKREAARYQELRRMELAGLIRDLRLQVVFVLAPA
FT                   VDIGEARKKPALRYIADFAYVEGATGEQVVEDAKGFRTRSYRDKKHLMKSVHNIIIREV
FT                   "
FT                   /protein_id="YP_001109625.1"
FT   misc_feature    complement(24608..24931)
FT                   /note="Protein of unknown function (DUF1064); Region:
FT                   DUF1064; pfam06356"
FT                   /db_xref="CDD:115039"
FT                   /locus_tag="Bcep1808_7704"
FT   gene            complement(25149..25406)
FT                   /db_xref="GeneID:4947240"
FT                   /locus_tag="Bcep1808_7705"
FT   CDS_pept        complement(25149..25406)
FT                   /locus_tag="Bcep1808_7705"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287459"
FT                   /db_xref="GeneID:4947240"
FT                   /translation="MDDNRERLLRERIAKLESTLTFYDRRFNTNAADEERKRLAALESA
FT                   LDDVLCSHPTDDPAMILVKAGLSPERGAEILILLNKKFAT"
FT                   /protein_id="YP_001109626.1"
FT   gene            complement(25690..25965)
FT                   /db_xref="GeneID:4947241"
FT                   /locus_tag="Bcep1808_7706"
FT   CDS_pept        complement(25690..25965)
FT                   /locus_tag="Bcep1808_7706"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287460"
FT                   /db_xref="GeneID:4947241"
FT                   /translation="MTRKYAIGEILIFQKARHEPERNGMECLVMQYRDVSVDPVAMGYE
FT                   HGTFYGIEFEDGARRSALEYQLRRRDEPPPVDGIERDARLTGEVSA"
FT                   /protein_id="YP_001109627.1"
FT   gene            complement(25962..26384)
FT                   /db_xref="GeneID:4947242"
FT                   /locus_tag="Bcep1808_7707"
FT   CDS_pept        complement(25962..26384)
FT                   /locus_tag="Bcep1808_7707"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287461"
FT                   /db_xref="GeneID:4947242"
FT                   /translation="MNHRRIVCWLAIDPCALVAAKLAIRENDAQANPLPLVVVAHRLFG
FT                   DEFIEQAARYLGVPVISASSAKWLSFDMPGDVHVWGVPVEEQRAHADIQSAFPSRSFAS
FT                   VLADRALRREDCIELARRAGFTFAPSPYANAPRAAA"
FT                   /protein_id="YP_001109628.1"
FT   gene            complement(26396..26740)
FT                   /db_xref="GeneID:4947243"
FT                   /locus_tag="Bcep1808_7708"
FT   CDS_pept        complement(26396..26740)
FT                   /locus_tag="Bcep1808_7708"
FT                   /gene_family="HOG000263391" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287462"
FT                   /db_xref="GeneID:4947243"
FT                   /translation="MILPPIKLDEEVDNVVKLRTPFKAPVPEERYLVAPVAECQHFNGP
FT                   FLVDDTLAEVTCGRCKQKLNPMWVLKQLVQKENRWHAHFARYQEEMKRLAERSRTKCRH
FT                   CGEMTPISHK"
FT                   /protein_id="YP_001109629.1"
FT   gene            complement(26737..27765)
FT                   /db_xref="GeneID:4947244"
FT                   /locus_tag="Bcep1808_7709"
FT   CDS_pept        complement(26737..27765)
FT                   /locus_tag="Bcep1808_7709"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sab:SAB1743c hypothetical phage-related
FT                   protein"
FT                   /db_xref="GI:134287463"
FT                   /db_xref="GeneID:4947244"
FT                   /translation="MHHMFDTEHARLYGLEEAVLINNLKFWIVRNRANGENFREDRTWS
FT                   YNSINAFSEQFPYLSRDRIRRTLASLMKQGVIQSGNFNERATDRTLWYAFVDEEAFLQD
FT                   VPELAKSQNGKGKSANAHVAKSPNAGGDSAASLTTTDVNANKKADSGRGTRLTKDWELS
FT                   AEAIQRTVAVTETYAANLDEWAGGAWSIQHVIFEAEKFRDYWTAKSGKDATKTDWPATW
FT                   RNWVRNAGPMRAARKGGAGGGNWRASDEAALAKANEVGVGRAHPSESRDAWHARIQAAI
FT                   ENGGAPPVPRPQAVTPLDPIPVPGPVPPADAPRTGPSDASRSAMAGVKDLLKKQSFGGA
FT                   PA"
FT                   /protein_id="YP_001109630.1"
FT   gene            complement(27765..28337)
FT                   /db_xref="GeneID:4947245"
FT                   /locus_tag="Bcep1808_7710"
FT   CDS_pept        complement(27765..28337)
FT                   /locus_tag="Bcep1808_7710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppu:PP_1553 hypothetical protein"
FT                   /db_xref="GI:134287464"
FT                   /db_xref="GeneID:4947245"
FT                   /translation="MSKITDSARGETCALRLPGVCNRDPETTVWAHGNDVEGGKAKGKK
FT                   LLRYDHIGCYACYSCHMVLDGQAKRPAHLALEQVREAELLARAESAQKLKDKGLWPTDE
FT                   QLARKPVTAHKPIEKKMTAAAARAIVKKVTPLEERAREERKPRPASRPMATGTSMSTRT
FT                   TTESRWPKRKRKLQSANRLQSRPFGGR"
FT                   /protein_id="YP_001109631.1"
FT   misc_feature    complement(28038..28334)
FT                   /note="Protein of unknown function (DUF1364); Region:
FT                   DUF1364; pfam07102"
FT                   /db_xref="CDD:148610"
FT                   /locus_tag="Bcep1808_7710"
FT   gene            complement(28544..28930)
FT                   /db_xref="GeneID:4947246"
FT                   /locus_tag="Bcep1808_7711"
FT   CDS_pept        complement(28544..28930)
FT                   /locus_tag="Bcep1808_7711"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287465"
FT                   /db_xref="GeneID:4947246"
FT                   /translation="MNQIKSINSVTGHNSLGAAIGQRTYHRTIARPLTSRARVVDVSTC
FT                   YTIEKIGATLGHADLRETMIDDGLLMADGMPYQHYRDCEYLTVVMSDAGTSEVLVLPEG
FT                   QVWLARRYPATKKARKHARRSALQ"
FT                   /protein_id="YP_001109632.1"
FT   misc_feature    complement(28598..28819)
FT                   /note="Phage antirepressor protein KilAC domain; Region:
FT                   ANT; cl01462"
FT                   /db_xref="CDD:154416"
FT                   /locus_tag="Bcep1808_7711"
FT   gene            complement(29008..29550)
FT                   /db_xref="GeneID:4947247"
FT                   /locus_tag="Bcep1808_7712"
FT   CDS_pept        complement(29008..29550)
FT                   /locus_tag="Bcep1808_7712"
FT                   /gene_family="HOG000263392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287466"
FT                   /db_xref="GeneID:4947247"
FT                   /translation="MAGNKKPRKKYSGPKFSPVVQRAISFLKIQRNHTLNALNANYDVV
FT                   LDDDQQRDIAIAYGVAIDRMSKGMGDAEDLGQLGFMANVSRVLCERSTEELDFGKQYEP
FT                   DIIAAQQALMRAHFRKRAGKTLGFDAVGLQAIRRAYQIHSAQMQVAGAGHLISASAEVT
FT                   RRQRAGDVMNEEEAMAA"
FT                   /protein_id="YP_001109633.1"
FT   gene            complement(29565..29765)
FT                   /db_xref="GeneID:4947248"
FT                   /locus_tag="Bcep1808_7713"
FT   CDS_pept        complement(29565..29765)
FT                   /locus_tag="Bcep1808_7713"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:134287467"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4947248"
FT                   /translation="MHTSKTISALRTKAKLTQKQIASALGCSQPHVHYLEHGDVKKPRT
FT                   SAAMVDGLKALCAKHGVPVVQ"
FT                   /protein_id="YP_001109634.1"
FT   misc_feature    complement(29607..29747)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Bcep1808_7713"
FT   gene            29989..30696
FT                   /db_xref="GeneID:4947249"
FT                   /locus_tag="Bcep1808_7714"
FT   CDS_pept        29989..30696
FT                   /locus_tag="Bcep1808_7714"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phage repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase
FT                   S24, S26A and S26B; KEGG: pau:PA14_07960 transcriptional
FT                   regulator PrtR"
FT                   /db_xref="GI:134287468"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006198"
FT                   /db_xref="GeneID:4947249"
FT                   /translation="MAAPADSVGARVSARRTELGISQKELARRVGLTQPTISALEKGKS
FT                   NTSGSIASLAKALGVVPLWLETGLGDKEPGAREYRRVLDDGTQTSVIEFEVTVLASDGS
FT                   CGGGAPGQTVIADVRTKVGPVIRDQRFFERIGASPEHVFAILGDGDGMARFIEHGDMVF
FT                   FSSAGCDRLVTGQIYAFETIDGPRIKRVHRRADGHVILSNDNPDKNRYPDEIYSQADAE
FT                   ALHCLGVFLYREG"
FT                   /protein_id="YP_001109635.1"
FT   misc_feature    30013..30183
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    order(30025..30027,30037..30039,30112..30114)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    order(30034..30036,30109..30111)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    30040..30651
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2932"
FT                   /db_xref="CDD:32756"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    order(30055..30060,30091..30093,30100..30102,30112..30117)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    30415..30672
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bcep1808_7714"
FT   misc_feature    order(30439..30441,30553..30555)
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Bcep1808_7714"
FT   gene            complement(30733..31263)
FT                   /db_xref="GeneID:4947250"
FT                   /locus_tag="Bcep1808_7715"
FT   CDS_pept        complement(30733..31263)
FT                   /locus_tag="Bcep1808_7715"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287469"
FT                   /db_xref="GeneID:4947250"
FT                   /translation="MLFECIHEHVDGARTDGGVGQRHRIGGFDDHLKRLHGPAPGGWRR
FT                   LKYRSVYVETIAIAFPLCNRNIYISERAGPMDGGLRLCCGGATRRAPIQAFRLLPSTKK
FT                   DFFGIRNDLLAWNGVLRPHSEQMFKGGAGLRSGPFFCIKYDESWIAIFGRTWALFREGS
FT                   PLLWAKKDPPKRV"
FT                   /protein_id="YP_001109636.1"
FT   gene            31345..32676
FT                   /db_xref="GeneID:4947251"
FT                   /locus_tag="Bcep1808_7716"
FT   CDS_pept        31345..32676
FT                   /locus_tag="Bcep1808_7716"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO5397 large Ala/Glu-rich protein"
FT                   /db_xref="GI:134287470"
FT                   /db_xref="GeneID:4947251"
FT                   /translation="MNAPTPIALLEHPAAEPAVVSSVDIDAILEGSIVLSSEQRETLKI
FT                   SEILDAAPKGEKGDAIATITPFALGMTGEMLALLQNTYGGAVFDVKDPAGMKEAKATVS
FT                   RLTKLKTSLEEAYTEWNAPIQTMTKLAREQRDHATAAILALRDPIKEQVDVQQKELDRI
FT                   KNEKAVAESRRIETHQGELTKLQKLPEQFMSAPSADIEAQIRELDSFEYLTRRDWEEYM
FT                   PAAQDAVRAGIETLKTHLTNAKAREELATLQAKAAAEQAERDRTAAAEAAERERVEKLR
FT                   ERINNIRLAPTTCIGLPAAQIERTIGKLDAVALNEFAEFETEAREAIEGARSNLSTMLE
FT                   AAKDAEELAVFRAQKQRNEQAAQEAAERAEREAKEAAERKEREAREEAERIQHERDEAA
FT                   RIARERAEAHAELLLSLLVEAAPHVTDMDLRHRIHVAIDAAKGE"
FT                   /protein_id="YP_001109637.1"
FT   gene            32680..33387
FT                   /db_xref="GeneID:4947252"
FT                   /locus_tag="Bcep1808_7717"
FT   CDS_pept        32680..33387
FT                   /locus_tag="Bcep1808_7717"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ERF family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ERF family protein; KEGG: sag:SAG0565
FT                   hypothetical protein"
FT                   /db_xref="GI:134287471"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="GeneID:4947252"
FT                   /translation="MNAPTTLPPEVIAQKPTVADMNLFDGGNPANLGEMFAALALAQGG
FT                   FDPIVKNREVTVQPKDQSKRAYKFKYADLEEIRSKTTPHLSKNGFALLSLVTTHTTGGV
FT                   HIRTILAHKTGARIESDMDVNRIGGEIKDFGATITYLRRYVVSALLGVAADDDLDEDGQ
FT                   EPGAGGGSSAAVGVAVHKGLKDAKTLGELGKIMAGLPKDEKAKYSAYYNQRQDELEAEQ
FT                   RDAGGKPAGGDDL"
FT                   /protein_id="YP_001109638.1"
FT   misc_feature    32815..>33111
FT                   /note="ERF superfamily; Region: ERF; pfam04404"
FT                   /db_xref="CDD:146841"
FT                   /locus_tag="Bcep1808_7717"
FT   gene            33384..34097
FT                   /db_xref="GeneID:4947253"
FT                   /locus_tag="Bcep1808_7718"
FT   CDS_pept        33384..34097
FT                   /locus_tag="Bcep1808_7718"
FT                   /gene_family="HOG000226545" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative exonuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: bbk:BARBAKC583_0196 putative exonuclease"
FT                   /db_xref="GI:134287472"
FT                   /db_xref="GeneID:4947253"
FT                   /translation="MIVVECQQGTPEWLAARAGVTTASNYRIARTLARDGRTPSDTARH
FT                   LAFRLAIERISGVPLDDDAPETWQMKRGQLLEDDARILHTSEIGLRVKPVGIILTDDRK
FT                   FGASADGWIECPRLGPGGAEYKCLIGPKELEAVYIDDDPSKYMDQIQGNLWLSGRKWWD
FT                   FCVYCPALESINLHFYRQRVMRDDDYIAELVADLWKFDCMVEEFREKLLVRQARREGRE
FT                   FVAEAADELGVDTPY"
FT                   /protein_id="YP_001109639.1"
FT   misc_feature    33417..33854
FT                   /note="YqaJ-like viral recombinase domain; Region: YqaJ;
FT                   cl09232"
FT                   /db_xref="CDD:158462"
FT                   /locus_tag="Bcep1808_7718"
FT   gene            34161..35270
FT                   /db_xref="GeneID:4947254"
FT                   /locus_tag="Bcep1808_7719"
FT   CDS_pept        34161..35270
FT                   /locus_tag="Bcep1808_7719"
FT                   /gene_family="HOG000117544" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative exonuclease, RdgC"
FT                   /transl_table="11"
FT                   /note="PFAM: putative exonuclease, RdgC; KEGG:
FT                   reh:H16_A3189 DNA recombination-dependent growth factor C"
FT                   /db_xref="GI:134287473"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="GeneID:4947254"
FT                   /translation="MWFKNLTLFKLTDFAIDAQTLSDKLAKAAFSPCTDLQEKSVGFVT
FT                   PRPDSPHVYAVNGEFLIALRTQKRNLPGSVVKEEVARRAAEYEKEYGHKPGRKMLKELK
FT                   EQSIDALLPQAFKTSRTTHAWISPKAGLLVIDTASTAIADDFIGALLRAIEVPVKLHPL
FT                   ATNTAPSAAMSKWLLDEPPSFLTIDSDAVFVTTHGGNIKYSNTPVEGDDAKRQLEAGQR
FT                   VSSLALTWDDKVSFVLAGKGTIKRVKALDVLKGEAADKADEDSFASDFLLMAGTLAQMV
FT                   GELVESLGGEREPEHDIADAADDSDDELYGKARQIVIENERASISLVQRHLRIGYNRAA
FT                   RLLDSLESHGVVSAMDSSGNRRVLATEAA"
FT                   /protein_id="YP_001109640.1"
FT   misc_feature    34164..35039
FT                   /note="Putative exonuclease, RdgC; Region: RdgC; cl01122"
FT                   /db_xref="CDD:174540"
FT                   /locus_tag="Bcep1808_7719"
FT   misc_feature    35082..35261
FT                   /note="Ftsk gamma domain; Region: Ftsk_gamma; cl09645"
FT                   /db_xref="CDD:158603"
FT                   /locus_tag="Bcep1808_7719"
FT   gene            35267..36160
FT                   /db_xref="GeneID:4947255"
FT                   /locus_tag="Bcep1808_7720"
FT   CDS_pept        35267..36160
FT                   /locus_tag="Bcep1808_7720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p1B250 hypothetical protein"
FT                   /db_xref="GI:134287474"
FT                   /db_xref="GeneID:4947255"
FT                   /translation="MKLRETNLVSLKKIAEDKSQDAIGIKKVTHYMLDPRAIRIEPGFN
FT                   ARDMVNMSERTRAHIDQMKVAIRAGTVMPAMKVRVSGDTIYVVEGHCRLTAYMELIAEG
FT                   LEILLVPVEQFNGNDEDRDFEVLNSASQLHLTRLEQGRIYKRRVAFGWSVAQIAARAFK
FT                   SASFVEQNLMLANADSDVQRLLEADKVSVKVALDAIRKHGDKAGAKLAARIESEGGAKL
FT                   TGASLTRALPSKVVRNVTAAVSDLFGDTQSMWAARIRECSDSGAVQMMVPVSVMRALLD
FT                   AHEAATHASAPAKEAA"
FT                   /protein_id="YP_001109641.1"
FT   misc_feature    35711..35953
FT                   /note="KorB domain; Region: KorB; pfam08535"
FT                   /db_xref="CDD:149550"
FT                   /locus_tag="Bcep1808_7720"
FT   gene            36157..36558
FT                   /db_xref="GeneID:4947256"
FT                   /locus_tag="Bcep1808_7721"
FT   CDS_pept        36157..36558
FT                   /locus_tag="Bcep1808_7721"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287475"
FT                   /db_xref="GeneID:4947256"
FT                   /translation="MSTERVNTGEYFTIEQASAHAAEFCRKHPAWIRVCDMPDTEEVNR
FT                   ALYVHWDELSKRAQDYWGSEYAYNEFATKRCKVKQGVMTGKGELYDSIIQAPLFHNVMC
FT                   MYRVGVSRAREWSAQRAKEREEERAKWSK"
FT                   /protein_id="YP_001109642.1"
FT   gene            36555..36986
FT                   /db_xref="GeneID:4947257"
FT                   /locus_tag="Bcep1808_7722"
FT   CDS_pept        36555..36986
FT                   /locus_tag="Bcep1808_7722"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287476"
FT                   /db_xref="GeneID:4947257"
FT                   /translation="MTLPPPIVPVEDRSAWQCPSHGAGTPLRLFGSTLHCVLCGEQCEP
FT                   RPSVIAAQRHAARVVPTVGTVRGAPPARNGCYDRPASAPPYFAQDGYEEAVDQGWGTFH
FT                   RTTRYIEVEHVMSEDCQYSEHTVDPKCAGCRWNKQEASK"
FT                   /protein_id="YP_001109643.1"
FT   gene            37900..38577
FT                   /db_xref="GeneID:4947258"
FT                   /locus_tag="Bcep1808_7723"
FT   CDS_pept        37900..38577
FT                   /locus_tag="Bcep1808_7723"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0021 hypothetical protein"
FT                   /db_xref="GI:134287477"
FT                   /db_xref="GeneID:4947258"
FT                   /translation="MPIYLFAHTKGGVTKTTTAINMAAMRAADGRRVLLVDSDSGQSAT
FT                   GFVNTRKLKGLPDIPHVSLVSYLTDDEGWYRIDGDILKLAKSGRYDDILIDAGGEGHGS
FT                   PEIRAALTVADKVVTPCGTSSVDTVRLAPMNSMIGEARTLNPKLKAFLFASRASTNARS
FT                   SDVIEFYKDVAKFRNYTVMESVIRARDCYTKWEKTGEAVFEQKRGIKAAMQEMADLYKE
FT                   VFA"
FT                   /protein_id="YP_001109644.1"
FT   misc_feature    37906..38346
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7723"
FT   misc_feature    37927..38571
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="Bcep1808_7723"
FT   misc_feature    37927..37947
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7723"
FT   misc_feature    order(37945..37947,38185..38187)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7723"
FT   gene            38574..39071
FT                   /db_xref="GeneID:4947259"
FT                   /locus_tag="Bcep1808_7724"
FT   CDS_pept        38574..39071
FT                   /locus_tag="Bcep1808_7724"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287478"
FT                   /db_xref="GeneID:4947259"
FT                   /translation="MTDKPLSAAEAKRARELEARRAMFTQGDARPANTDLSTILGPEEG
FT                   AQKGMTTEEPPADTAAPEPAAQEAAEASAMPADTPNPMPTAEKPAKAPKTASPGNRKAE
FT                   RKPWDEYLPTEAKGFTTKFDPELHAKLVWITENVPKMSIQKIVKAAVAEFADKTIAERY
FT                   KP"
FT                   /protein_id="YP_001109645.1"
FT   gene            39068..39412
FT                   /db_xref="GeneID:4947260"
FT                   /locus_tag="Bcep1808_7725"
FT   CDS_pept        39068..39412
FT                   /locus_tag="Bcep1808_7725"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287479"
FT                   /db_xref="GeneID:4947260"
FT                   /translation="MNVRYELKKGVRLSAEDVTIVPVEQPRADAPTRDARQVPLDLKPR
FT                   PERERRPWEDANPRVKTSIRLEMDEVLKLKLDWIKEHFPNSAISAVCRRAVEKEAARLI
FT                   AEWDATHPSA"
FT                   /protein_id="YP_001109646.1"
FT   gene            39959..41167
FT                   /db_xref="GeneID:4947261"
FT                   /locus_tag="Bcep1808_7726"
FT   CDS_pept        39959..41167
FT                   /locus_tag="Bcep1808_7726"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="initiator RepB protein"
FT                   /transl_table="11"
FT                   /note="PFAM: initiator RepB protein; KEGG: rsp:RSP_1425
FT                   plasmid replication initiation protein"
FT                   /db_xref="GI:134287480"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="GeneID:4947261"
FT                   /translation="MGKVIKSKASAVDTRSPELAKLDERELRKHVATIHVSGSLSLVER
FT                   KIVNVLLLHAYDDLLTKREHTMSVRFLCEAIGWDSSNDHKKLAEAAENIMRNIVTVNMF
FT                   SDGSEEWKKTALVSSVGVKNGRVTYAYIEWLAERLARPEVFAAIDIKIQRRFKSGYALA
FT                   LYENCIRFKGVGQTRYAPVDTWKEILGATGKMYEEYRHFSNHVLKTAIKEINDVADIDV
FT                   DLRVKKDGRRIVEIQFGVKEKAQAELPFEGDPKEEQTREELQRIGIGANTIKRILAKNP
FT                   SRAWLAAKVTRERETAGKIKDSAAGYFMSIFESDSVLELPAEPPKPEQKEPARPSAEEL
FT                   EKDRKADAARKATAALTEEKRAELRAAYIANNPDAAYNEETGRWNKAAHTTGYRAFERA
FT                   QSV"
FT                   /protein_id="YP_001109647.1"
FT   misc_feature    40028..40672
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:174750"
FT                   /locus_tag="Bcep1808_7726"
FT   gene            complement(41198..41848)
FT                   /db_xref="GeneID:4947262"
FT                   /locus_tag="Bcep1808_7727"
FT   CDS_pept        complement(41198..41848)
FT                   /locus_tag="Bcep1808_7727"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287481"
FT                   /db_xref="GeneID:4947262"
FT                   /translation="MSGYVKLAIAALLLAAVGALGYFVLHWYDGQLSASYQAGQLAERT
FT                   VWQQKEVARTAFESAATQKRAEDNAAKQAKIDANNLQVQQDHEKAVSSLRQRIAALDAA
FT                   AREYGGLRIPTTVCTAAASAGSGSVPAGTQAASPGRYDAWIAATVALPDDTQRHLRASA
FT                   HEADAIVEDFRTVQEWAVKHGFMPAPPDYVPPPILADPPMKADTPQAASAATT"
FT                   /protein_id="YP_001109648.1"
FT   sig_peptide     complement(41783..41848)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.836 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7727"
FT                   /product="hypothetical protein"
FT   gene            complement(41845..42174)
FT                   /db_xref="GeneID:4947263"
FT                   /locus_tag="Bcep1808_7728"
FT   CDS_pept        complement(41845..42174)
FT                   /locus_tag="Bcep1808_7728"
FT                   /gene_family="HOG000263393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287482"
FT                   /db_xref="GeneID:4947263"
FT                   /translation="MSEVTQVHVERETLSVEVNIPGHEARTTTALFSHSKKQLIEREGG
FT                   RCWISGATAEESGHPLEAHHYPTAKNDGIHDMPFPLWVAKRYGVEGYVFSSTTTIHHFE
FT                   GDGHE"
FT                   /protein_id="YP_001109649.1"
FT   gene            complement(42171..42812)
FT                   /db_xref="GeneID:4947264"
FT                   /locus_tag="Bcep1808_7729"
FT   CDS_pept        complement(42171..42812)
FT                   /locus_tag="Bcep1808_7729"
FT                   /gene_family="HOG000123106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase, family 19; KEGG:
FT                   pau:PA14_08160 putative lytic enzyme"
FT                   /db_xref="GI:134287483"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="GeneID:4947264"
FT                   /translation="MTVVTASQLQRIMPLAARIIPAFVDPLNAAMQQWGITTEQRVEMF
FT                   LAQFAHETGQLSRLVENLNYSAQGLANTWPNRYSTTGKAAGAPNTLAMRLNRNPVAIAN
FT                   NVYADRLGNGNEASGDGWKYRGRGGFQITGKANYVACLMALHLDVIEHPELLEQPEHAC
FT                   QSAAWFWNAHNLNQLADSGNFAGTTKVINGGSIGANERLGLWQIAKEVIV"
FT                   /protein_id="YP_001109650.1"
FT   misc_feature    complement(42231..42767)
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:176812"
FT                   /locus_tag="Bcep1808_7729"
FT   misc_feature    complement(42657..42659)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29558"
FT                   /locus_tag="Bcep1808_7729"
FT   gene            complement(42809..43195)
FT                   /db_xref="GeneID:4947265"
FT                   /locus_tag="Bcep1808_7730"
FT   CDS_pept        complement(42809..43195)
FT                   /locus_tag="Bcep1808_7730"
FT                   /gene_family="HOG000263394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287484"
FT                   /db_xref="GeneID:4947265"
FT                   /translation="MFIWLMLFWSVAAYAAQATFVHDLSDIPPVAVAISCLLSIIGGAA
FT                   FTAQKIADPAVTIVSPVKTIIRDVLNSIVAGLLVFCIGSYFNWAAVAQAGLITLAGYGG
FT                   SRVLEPVLSALIDRLSKFVGGGAQ"
FT                   /protein_id="YP_001109651.1"
FT   sig_peptide     complement(43148..43195)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.747 at
FT                   residue 16"
FT                   /locus_tag="Bcep1808_7730"
FT                   /product="hypothetical protein"
FT   gene            complement(43204..43617)
FT                   /db_xref="GeneID:4947266"
FT                   /locus_tag="Bcep1808_7731"
FT   CDS_pept        complement(43204..43617)
FT                   /locus_tag="Bcep1808_7731"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287485"
FT                   /db_xref="GeneID:4947266"
FT                   /translation="MCLASAVFRLYVCGVAVMMWFIAYFEERSMSALLMRTDGGALILW
FT                   MMLACGLVGIADVLINDTGLFRFRIEAARTHRHFGFSGLAFCYVCQIFIAALSVKSPWM
FT                   AAYSLWNALLVVAFSLIDAHQRSKDATCLQACN"
FT                   /protein_id="YP_001109652.1"
FT   gene            complement(43899..44657)
FT                   /db_xref="GeneID:4947267"
FT                   /locus_tag="Bcep1808_7732"
FT   CDS_pept        complement(43899..44657)
FT                   /locus_tag="Bcep1808_7732"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287486"
FT                   /db_xref="GeneID:4947267"
FT                   /translation="MIVFSPLSTRRLDVTLHELGIGDEIALCYLPDKAHEKALTAFLQC
FT                   AIKAASTPSPKHIADPRAWTVSERLLVLAHYTTHTASDGPNYAVTEAGKLFDYLDMSRD
FT                   LPGALPTFDACGDQWTVHPLIGAEAEALETLQLESDLNGHSFWLMGLLAAQLKRPGETA
FT                   PDAVANPTEYIDWLRTRHAVMRALPGSVTSELFAKYRDAQAQAMQFFRVWFDGEGIIVL
FT                   PKEAGDPLSPARFLVLACLSELALSLTGKS"
FT                   /protein_id="YP_001109653.1"
FT   gene            complement(44654..45538)
FT                   /db_xref="GeneID:4947268"
FT                   /locus_tag="Bcep1808_7733"
FT   CDS_pept        complement(44654..45538)
FT                   /locus_tag="Bcep1808_7733"
FT                   /gene_family="HOG000229542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0937 hypothetical protein"
FT                   /db_xref="GI:134287487"
FT                   /db_xref="GeneID:4947268"
FT                   /translation="MSIFDSIASTLPSSVGSSFSLDRAAQSVQRLLTTRVLKSDWTGLN
FT                   PNLLAKFYPLKRTSDGWTQSNDVRQLSAADNFTVDDGYEVWCPITDGQSEMSLNWHSPF
FT                   EGAGAESKAPTVSSMLQSGSLSPAVQAIGEQTGATSATDSASAALASAEGRVGITKLNS
FT                   TQVFQGMPPVKLSMMLHFRALIDPVTEVKAPISMLKQWAVPQYLAADGVLANAIKNGSK
FT                   DGIVQTIFPSMAPQIIGMRYGDMTYEPLVIESVSDPITGPRDVDGVMISCSVNVTLATL
FT                   TAIDRRDIQRIYA"
FT                   /protein_id="YP_001109654.1"
FT   sig_peptide     complement(45461..45538)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.284 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7733"
FT                   /product="hypothetical protein"
FT   gene            complement(45616..46323)
FT                   /db_xref="GeneID:4947269"
FT                   /locus_tag="Bcep1808_7734"
FT   CDS_pept        complement(45616..46323)
FT                   /locus_tag="Bcep1808_7734"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287488"
FT                   /db_xref="GeneID:4947269"
FT                   /translation="MIDYKHKMRTLLTRKPEVVLDSAADEEEGSAAADYASADIRMKAA
FT                   SILQEFAGTSTDDLADGESLADRLLMLVVGIIDSDKDGELSDDEQAAADALLESMWDYL
FT                   LDKGVSDEDCNALLNDWDADAAARVRDLLADSGVSGDDDAALDDLDAFAFDTDAEQSVF
FT                   DSAGELITDAVYRKKVVVRAGKKVRINKRISGAVRLSAKQKVAVRKMIRKSHSAAAMMR
FT                   RMKSLRIRKRAGL"
FT                   /protein_id="YP_001109655.1"
FT   gene            complement(46340..47959)
FT                   /db_xref="GeneID:4947270"
FT                   /locus_tag="Bcep1808_7735"
FT   CDS_pept        complement(46340..47959)
FT                   /locus_tag="Bcep1808_7735"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287489"
FT                   /db_xref="GeneID:4947270"
FT                   /translation="MFYSHTRSLGAQSGVQLNPLKDNTDGFSAGNGDQVVGIVGRFKRG
FT                   RIDAPFVVDRGTLKSKLGAPESLRVSALNEAYVQLYEAVNNGAVSAVVQRLAPAAAARS
FT                   FAVLKIDDVSGASTFSVSPTAPTANYLLYLDDLECFNDGVLLEVNAKKATSAGAPAPSK
FT                   IVTIRVKEPNGNVRYEVTGSLDQTAVDEYGNDYFIGSKFAELTDLITVSVSATAAVATN
FT                   ADCYGRNTDGTDKFVASSNLVLFSEGGTAYASTDYDAAISKLENGTLDFGYLISGGSQA
FT                   VALLSKLAALCVRANRHFVLDVPGSLTPDAAQTFVSQLGLDTHYVSIYWAPLNTNDPVN
FT                   GGKAIIGLGGFQAGQRCARNAQTNSYGLAPKNYPIAGKDWPINRTGVVQLYTPSDVQKS
FT                   DLALAKINPVILERYTGGSKYVFVDSLTAAQVTTSYRKLISVAEMSASLDDMVVKYGKE
FT                   CLQLPMDIAIKRMTAFLKFTLTAMRASNWLVASNDPVLGDAGWTFTVTRNAQRPADRMD
FT                   VNYGTHYDGVNRATYVQQTLSQ"
FT                   /protein_id="YP_001109656.1"
FT   gene            complement(47987..48274)
FT                   /db_xref="GeneID:4947271"
FT                   /locus_tag="Bcep1808_7736"
FT   CDS_pept        complement(47987..48274)
FT                   /locus_tag="Bcep1808_7736"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287490"
FT                   /db_xref="GeneID:4947271"
FT                   /translation="METPNEETKATAKAAPSKKAATAKPAFPREMTLVNETAMPYVVAR
FT                   THVAPGESKPVTVANEDELARHETDIAHLLFLNDSYKDAEVKPLRIVDAD"
FT                   /protein_id="YP_001109657.1"
FT   gene            complement(48363..49994)
FT                   /db_xref="GeneID:4947272"
FT                   /locus_tag="Bcep1808_7737"
FT   CDS_pept        complement(48363..49994)
FT                   /locus_tag="Bcep1808_7737"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287491"
FT                   /db_xref="GeneID:4947272"
FT                   /translation="MSGTPSKYTVEHQHELERFVRSAAAAHTNGMVLDSASAASAAFES
FT                   IKSESGATPRVLDELLGKASEKDEPAIVQALFDGARDYQTEHGFAPSGDLLLSAVDQAY
FT                   SLYDSANNSHHDQISLVPNAPVVAILGSMAEACPFAGYLPADRGSNEARLIIVSHQAGS
FT                   NWGDYTQGDLMDGIASGGSYLGAARTLELSAPNDTAAYKFTFQAQKGAGAALNLLRGRS
FT                   IVYVNGQIAAVEISNGPSTAASVPIVGSIVLAGTTYNLTGTVKPATGEVSITPDTPFPA
FT                   GTVVNCEAFVDFEIEPSVTPKMAVQAMVYQMFAAPYRAVFQSTPETRSQFANEVGVDPS
FT                   AEAMMVVRNQYAMERHYNAINKAKMVGRFNNTAQYDFQYAEQILQKTRAQIWQDFQAVL
FT                   GVVSQKMAEQTADHGVTHLYVTKAVMAQFRSMPSDLFQPSGLTDRAGIYRIGRLFGQYD
FT                   VYYTPKGLNEAADGSSAEILCVGRSSQTARCPIIFGDASAPIFEPLGMATDLKQGYGFN
FT                   ARSFTNLNPHAMSAAGCALIQAINLK"
FT                   /protein_id="YP_001109658.1"
FT   gene            complement(50117..50599)
FT                   /db_xref="GeneID:4947273"
FT                   /locus_tag="Bcep1808_7738"
FT   CDS_pept        complement(50117..50599)
FT                   /locus_tag="Bcep1808_7738"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287492"
FT                   /db_xref="GeneID:4947273"
FT                   /translation="MKNLIFDIYNLSHKDKAIAAAKRAFARAGAQVTSVDVDAKTKKTL
FT                   GVEYREVQFGFADSQTIRFGVNATGDVAQVKLNGKAVPLKNPDDHGAAIEELSALMVKG
FT                   RSKFQAALAKAKVALPPGIRTAAPKLEQVLRDKIAAIDEAISEATMRRDELKALAA"
FT                   /protein_id="YP_001109659.1"
FT   gene            complement(50608..51237)
FT                   /db_xref="GeneID:4947274"
FT                   /locus_tag="Bcep1808_7739"
FT   CDS_pept        complement(50608..51237)
FT                   /locus_tag="Bcep1808_7739"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_1868 phage baseplate assembly protein
FT                   V"
FT                   /db_xref="GI:134287493"
FT                   /db_xref="GeneID:4947274"
FT                   /translation="MNAFNLGGVLLALMPAEVASIDRERRIARVRIPGLTDGAAELPEA
FT                   EFCNPVGDKSEHTEIRIKVDDRVWIAFNGGDPRYPVIMGYRPKNQENGTDWRRFEHGNF
FT                   QFSADGGMFEVIAASQVHIKTPLLEIEADQTHVTGTMTVEKLLTFNGGMTGKGGAGGGA
FT                   AMTVTGDMSVTGGANFTNDVKSGNISVQGHHHTAQGSNAPTTRSQA"
FT                   /protein_id="YP_001109660.1"
FT   gene            complement(51234..52109)
FT                   /db_xref="GeneID:4947275"
FT                   /locus_tag="Bcep1808_7740"
FT   CDS_pept        complement(51234..52109)
FT                   /locus_tag="Bcep1808_7740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287494"
FT                   /db_xref="GeneID:4947275"
FT                   /translation="MFDVNGLRGDLIISADLRYDLAPIPLTFEANIRLTQQTAADYRDG
FT                   SVIKVNEIPFRIVKAVPTRNVAVQGKEPLSAVHITAFPDSVVEVARPRRTAVIFQNASL
FT                   SGIYRACGASAPLVGDFAISRYACFVGNVPTFGIARVLQEESAVVMWRKAKLQAMNLRD
FT                   LMAQTPIDKLDIDGAEDVKSDFLESDEVPVYVSVGPNGKFLSGARRNDTQSVAFSPRKD
FT                   ARSLNFMGRVLVRRKVITTKANPAVRAGDVANISGTPLVVMTAAHHMQNGTDGGGTEQY
FT                   TRLWLGSPTQ"
FT                   /protein_id="YP_001109661.1"
FT   gene            complement(52110..52364)
FT                   /db_xref="GeneID:4947276"
FT                   /locus_tag="Bcep1808_7741"
FT   CDS_pept        complement(52110..52364)
FT                   /locus_tag="Bcep1808_7741"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287495"
FT                   /db_xref="GeneID:4947276"
FT                   /translation="MTQKTPNGIDLLTHVTGLTKEDVTAIHAKAEANRSRLESCARHAF
FT                   EPVEPGKLFSRHRCTHCGGEADSVGAHWYARGLAHGGAA"
FT                   /protein_id="YP_001109662.1"
FT   gene            complement(52367..52882)
FT                   /db_xref="GeneID:4947277"
FT                   /locus_tag="Bcep1808_7742"
FT   CDS_pept        complement(52367..52882)
FT                   /locus_tag="Bcep1808_7742"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287496"
FT                   /db_xref="GeneID:4947277"
FT                   /translation="MTLQELAASCSWAFGLVIDEAEQTKQAINATRFYLGWGAVASMEP
FT                   VEPDDPPPQVLYDPLLGWYGGIYGGQYISVVDGTHPPYTPPATDTDPPPVPEGLSADTD
FT                   ITNSEWALIKPLYMLYIERENARALEASRGLGVDVYGRDVSQIEQDIRQYETQDLPRLA
FT                   FEQDAQTI"
FT                   /protein_id="YP_001109663.1"
FT   gene            complement(52891..53382)
FT                   /db_xref="GeneID:4947278"
FT                   /locus_tag="Bcep1808_7743"
FT   CDS_pept        complement(52891..53382)
FT                   /locus_tag="Bcep1808_7743"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287497"
FT                   /db_xref="GeneID:4947278"
FT                   /translation="MTVSTGAYLQQHYNQIKSLGDKSVSSDAQFVIEGFEDLRLLTKQF
FT                   PWPTLTSAGEIEIAGPLGMTQFQPQQVKIAQQGQMQFYETRRGDMQAFLEKIIASGGRF
FT                   NAKVYEGTMDKYQRACNIVDCFLQLDNPDRDWENRSQVTTISGTLFFHYFGDHEAGNTP
FT                   "
FT                   /protein_id="YP_001109664.1"
FT   gene            complement(53522..53947)
FT                   /db_xref="GeneID:4947279"
FT                   /locus_tag="Bcep1808_7744"
FT   CDS_pept        complement(53522..53947)
FT                   /locus_tag="Bcep1808_7744"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287498"
FT                   /db_xref="GeneID:4947279"
FT                   /translation="MKRFVIAALLASLAAPAFADTDDLDRGVRDAVTAFRSGSDADALV
FT                   TRAQLCYSGVDTHGGRDKSAGDQLDYCFAFEMTSARLLNKAGRVPHDSPKYFSNQEIAT
FT                   RAAYNLERARVLSLPEEFNPYIITRAKYVGGKIKDLS"
FT                   /protein_id="YP_001109665.1"
FT   sig_peptide     complement(53888..53947)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_7744"
FT                   /product="hypothetical protein"
FT   gene            complement(54007..56871)
FT                   /db_xref="GeneID:4947280"
FT                   /locus_tag="Bcep1808_7745"
FT   CDS_pept        complement(54007..56871)
FT                   /locus_tag="Bcep1808_7745"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bpm:BURPS1710b_1566 hypothetical protein"
FT                   /db_xref="GI:134287499"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947280"
FT                   /translation="MIKADSQGFLIADKALDHSDLTSGLNGIRSDTGAILALLQHGAKT
FT                   GLLRRQKVPNPNSGASSLQAASPRARANARNTSGAPSTASVPLPRVNASTAAWDRARDE
FT                   RGRFVARAPATESVMPMRAPTLAPDAASPASTDGRAPRRPRAAQPAPSTDLTPVTQAVN
FT                   SLTRAQAAQAAQAARESRAQASAKNQGKDEAAAARAANQTRDARGRFGSGGASDGGDSR
FT                   SLFSKLKGLFSRPSAPDMGDFDKVDPTIEAAHEMGKMLGGPLGTLGNLGRSIAGRFGGK
FT                   DGAIPWYRRIFTELRLTRRQHSDFGIAEQRTLKEIERKTGVAEGGGKGGLFGLLGGGMS
FT                   KLLGGMGGGIMRLFVGGGGLLKLLGRGALGLGKLGLRRLPLLGALFAGGSALASMFGPG
FT                   DPNKSDEENRKDRFTGAGSGIGALLGGGIGMLLGGPVGAVVGGVLGDKVGELVGAWLAT
FT                   VDWSKVADTITGAWKSTVGFFKDSWKTVTDKLGEISKTVSDAWKSIVDGAKAFLKDKFG
FT                   IDVDAIVQKGKEVAGAAVDQAKKAAEPVVNVAKTGAEKAKEIGKAAVDYGKERVEKMAA
FT                   PIARAGGAVMDWGEGIYSKLNKGYRRKQSFDGVKGGDALAKYGTYTDDEAAKIKELKAS
FT                   GANTSANLPGGMQPEIRDKIITASQKNGLDPKTMLEFAAMESGGNANAISSTGAVGIFQ
FT                   FTGSTASGVGIKDRFNADQNIQGGMQLANANAAQLTKAGLPVTAANLYMMHQLGPGAAK
FT                   EIIQGAKDGKNISQLSGNTQKAVSLNYGKGSTTAAEYLAKNSAALEARGKSVVGDMSNL
FT                   SVPATALASAKPADKATAVASNAPTKPVAPASPSPSPSPATSVQPGVPPALASTTVAVA
FT                   ASPAPVVPPPVVTAAAPPSPPRVSIAAASVPAPSNVPPAAQASIPVPMNSAGPMEVHVS
FT                   NDQPVGQDLRDRRLSMIATGGIAA"
FT                   /protein_id="YP_001109666.1"
FT   misc_feature    complement(<54718..54909)
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:176812"
FT                   /locus_tag="Bcep1808_7745"
FT   gene            complement(56874..57719)
FT                   /db_xref="GeneID:4947281"
FT                   /locus_tag="Bcep1808_7746"
FT   CDS_pept        complement(56874..57719)
FT                   /locus_tag="Bcep1808_7746"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0938 hypothetical protein"
FT                   /db_xref="GI:134287500"
FT                   /db_xref="GeneID:4947281"
FT                   /translation="MSIFDEVTQRVSSQIASRVGRLVSGFSAVGAGRALLQTAVGKIAP
FT                   KASGPLNKALNGDYLGAGLDALRQTKIGQKIEQTLNGKLISDLLFKSNRNQLLGGITPY
FT                   EAQQICAEVQATQYAKKNLFFVEILDFYPDQGGTQGQSSGLFNLFATNISIGPLTISGE
FT                   GRAIGAGVMDVIHGSERTEMRITTLDDSYGSIKRWFQTRCDLLAHSDGTFGVPADYLVQ
FT                   VRILHAAINDDVMQRYGGYEEKYIMRCGSLETELNRAEDGMQEIQMSFVQFDSFMFDQT
FT                   "
FT                   /protein_id="YP_001109667.1"
FT   gene            complement(57722..59341)
FT                   /db_xref="GeneID:4947282"
FT                   /locus_tag="Bcep1808_7747"
FT   CDS_pept        complement(57722..59341)
FT                   /locus_tag="Bcep1808_7747"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287501"
FT                   /db_xref="GeneID:4947282"
FT                   /translation="MPTPDEPRGKSKGFLSKLFGSRAENNLITETEQADAFADGMTISM
FT                   LLGNAKRPARNRQQLYYKWMEMSGDPIISTAMRLHVTAALGGHETSGDVVFIETAPGAK
FT                   EDKKKSAIAAEISTNLAPIFNRIAYTVGFNGAAFGDAYGRIYTDGRNGVVDVYVDELVH
FT                   PSMITPYERGNQTVGFVAASGPKSSDRLSLHQMARMKMPRMVYIPQVRAVEKAIKLALK
FT                   EDDINKLPLMPSLVGGSFLDGAESPFDQLTTALISLTGQRVLDSIDESMITMNQDGMTK
FT                   QQRDDVMRNITKILKASKARAEAAVRSGKPFLERIYHIIPTFGEKQLTALNGSLTNGQG
FT                   RGPSGSVSIEDVLFYAKLLSGALGIDLSMIGFAELLSGGLGDGGFFRSSAQSAERSRLL
FT                   RVALTDFFNSIIDVHTFHKYGEVFSKDERPWHVNFYGTISALESERQHTKTEAMNSAAI
FT                   MVQTLAQLRDLGLDEKAMHEILTKIMLLDEDQADLIVKGMPKPADEAPDDGGGFGGGGG
FT                   FGGGGGSRFGGGKPGSGNADGE"
FT                   /protein_id="YP_001109668.1"
FT   gene            complement(59666..59812)
FT                   /db_xref="GeneID:4947283"
FT                   /locus_tag="Bcep1808_7748"
FT   CDS_pept        complement(59666..59812)
FT                   /locus_tag="Bcep1808_7748"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287502"
FT                   /db_xref="GeneID:4947283"
FT                   /translation="MKKIKLDGRLYRKREKEVRELYAPKIVPCKTCGSPRHAQFKCYYC
FT                   ERE"
FT                   /protein_id="YP_001109669.1"
FT   gene            complement(59857..60183)
FT                   /db_xref="GeneID:4947284"
FT                   /locus_tag="Bcep1808_7749"
FT   CDS_pept        complement(59857..60183)
FT                   /locus_tag="Bcep1808_7749"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287503"
FT                   /db_xref="GeneID:4947284"
FT                   /translation="MSNFPMKWEICCRCKGEGKHDHPAFSNGITSSEWADWPQDERDTY
FT                   FAGGYDVRCDDCNGTGKVQVVDEEAMTAEQRREWGAGEEERREDAETARYLAAERRAEM
FT                   RMGC"
FT                   /protein_id="YP_001109670.1"
FT   gene            60563..60841
FT                   /db_xref="GeneID:4947285"
FT                   /locus_tag="Bcep1808_7750"
FT   CDS_pept        60563..60841
FT                   /locus_tag="Bcep1808_7750"
FT                   /gene_family="HOG000218368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF497; KEGG:
FT                   bte:BTH_II1040 pANL56"
FT                   /db_xref="GI:134287504"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="GeneID:4947285"
FT                   /translation="MEITFDPAKDATNKRKHGCSLADAARFDWDTLIYEVDSRFDYGET
FT                   RYRGLGYIGDRLHQVGFTFEGEAFRAISLRKANRREVRAYEQGNAST"
FT                   /protein_id="YP_001109671.1"
FT   misc_feature    60575..60808
FT                   /note="Protein of unknown function (DUF497); Region:
FT                   DUF497; cl01108"
FT                   /db_xref="CDD:154200"
FT                   /locus_tag="Bcep1808_7750"
FT   gene            60816..61124
FT                   /db_xref="GeneID:4947286"
FT                   /locus_tag="Bcep1808_7751"
FT   CDS_pept        60816..61124
FT                   /locus_tag="Bcep1808_7751"
FT                   /gene_family="HOG000132471" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_II1041 pANL12"
FT                   /db_xref="GI:134287505"
FT                   /db_xref="GeneID:4947286"
FT                   /translation="MNKVTHQRKHPAISDAEEAAIQRGIAADPDAAEIPAENIKAMRPF
FT                   SELVAKKRMGRPPSENPKEQVTMRYDSDVLAAFRATGAGWQTRMNEALRTYLKEHAL"
FT                   /protein_id="YP_001109672.1"
FT   misc_feature    <60966..61115
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3514"
FT                   /db_xref="CDD:33317"
FT                   /locus_tag="Bcep1808_7751"
FT   gene            complement(61223..61618)
FT                   /db_xref="GeneID:4947287"
FT                   /locus_tag="Bcep1808_7752"
FT   CDS_pept        complement(61223..61618)
FT                   /locus_tag="Bcep1808_7752"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287506"
FT                   /db_xref="GeneID:4947287"
FT                   /translation="MTITAFKMDPAYLQAKQAEYQQQVGADKALLPIFVAQTAKVLTRD
FT                   KKQYLRYGPYWWAVKRILIEQGVGVGTYQEPIWANEYACEMPELTLIAAWEFSDDSSGT
FT                   WGVQTREYDLTDDITLLLYDPDMEEQK"
FT                   /protein_id="YP_001109673.1"
FT   gene            complement(61673..68494)
FT                   /db_xref="GeneID:4947288"
FT                   /locus_tag="Bcep1808_7753"
FT   CDS_pept        complement(61673..68494)
FT                   /locus_tag="Bcep1808_7753"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNF2-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNF2-related protein; N-6 DNA methylase;
FT                   SMART: DEAD-like helicases-like; KEGG: aau:AAur_pTC20002
FT                   putative helicase"
FT                   /db_xref="GI:134287507"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:4947288"
FT                   /translation="MTLLILDDASNVASDLQRLRLAGEAAKLITERAALSTETADVMRA
FT                   LQIGKRLREIAMALGLRAATPAPAPTPVSGRTEPTGEFYPEEGKRTLGQRQKDNNAAIA
FT                   LMREIKATGRAVTDADRAILAKYSGSGGGLTAADGLTGSPHEYYTPKAIASAMWDLLGE
FT                   LGFAGGSVLDPSAGGGVFTATRPKTAVMTQVELDETSGTINGLINDGPTVNTTVSPFEA
FT                   IAASTPDEIYDAVITNVPFGNNAMRGGNEKKDARFQKANLQEYFVLRTLQKLKPGGLAA
FT                   FIVPKSVVSGTGAKERKLRLNASLMAEFVGGYRLPNSIFTTAAADVTTDLIVFRKFSRA
FT                   TAQKVEELQAQNPALLSESRVLWDEFLSGKYFVGAGHKYILGEEGTTNGKYGEVAAVIN
FT                   DDTIANIAKMIRRFGPSHIDWEKLDAAETAPILYKDGDVIRASGQTLHMKDGEWVALDS
FT                   KLAADAEMVGIATKVQNPLDAVNNGVTWEQASSYVDYATNNGDYGNIPDWLLATRKALD
FT                   TMPGDNQPWWEAVAAGMAAMNLMQDADSVEPLNYVTTYPVLSAQLAKVQSYGNKTFAKG
FT                   SRLIKDALLSIRSVRYKGEFTAFWRGEIQANMEAVALTPTQLYEKVKYEAEDETGYVPV
FT                   EKLREAFSDFDPLTSDEWCVSADGQSVTSAADYYTGSYATFLAQANADLDAATDPDVRA
FT                   KIVRQIEAAKERINVVDVSKMTFSLFTPHVTNLQKLEFLKQYVSKDIFLTTDANGREVF
FT                   DIKQQKPGSYASAEDMATYKAMQRFVKGYLKNQNITTQSKQSDVEADPEREAALVQRIK
FT                   GIADAAKAQFDAWARANEEIQVSLHNKLNSPDALRFIEEPDGTPLDIPNLNTTTFRPHP
FT                   YQYAAARKYARHFSGVLGFDVGLGKTLTSLATVQYTQAIGVKKKTVFVVPNSTLTNWKK
FT                   EAGKAYLDTSDCLFVGIVQGKDGKDKVDNAQVKADLGMIRENRHGKIFMTLEAFKLIPL
FT                   REETLDAYVTYLTENDDAYLLAEEDENKKRANIAADSKAAKAKSLGEKSGALPYFEDMG
FT                   IDSLVLDEAHNYKNSKMTSSEFKGAKYLADPSKSQRGMDMQAKAWYVRGLTPRNDGVLS
FT                   LTATPVTNSPLEVYSMLTLALGEREVNNMYGVTGADSFMAGACDIEERDEENIVGRVRP
FT                   VRVFTGLQNAGLLRRLLQTSALIKTAEDVKADGINISVPEYEEIATGVDIGEEAFARIM
FT                   DYKDEYLDAVEAMKGGSATPEQKLAGSPFNLIRKMTRVINDPELDSGIFVFKTDPSQAD
FT                   GAQKAIDAFNKKNIVEERDYDDPNADPADVKTKIVKDTETGDAIAKFLVTVRARMASGG
FT                   AIELLSVDFASQDVLLKLLEKEGIEPGINVSPKLAAVIENVKAEAATPRHMGRAKQIIF
FT                   CDELSLHHKIRIAVANAIGLSQSKVKIVNAVSVDVAGMQDVQDGYNADGDENKYEIVIA
FT                   NKKAEVGINLQKGTQAIHHMTIGWTPDSIHQRNGRGVRQGNPVDSVNVYHYDADGTFDA
FT                   YKRKLVGIKADWIGSLMKGDSSKIKIEGDMSSSDYEMLANAVGDASAMDRINEEIALRN
FT                   KRQRAATSRTTQLQSVRIIEAQMKWLGRFGADAKGDERQGFAAWVNSKITVVTGTRDKI
FT                   DALQERLNETKSDLMAARLSKQIRELSGLLESQVAVLAGLTTGPKHLPQTRNGYATITD
FT                   AEKETAAYANYRKDLNIARRMMDEAAVSFNNRTDDGYAAEALDKFRAGDAQIINGALVA
FT                   VGTLVEHQNALLVVQKPTRYGDTGLLGFNPADRSTTDLFRLTGAKFIDRGGEGWTDAVS
FT                   RAVAADVATIEANTDGFSADSDNLYSMMVSDVRDAMPVAIPSSSLWRDSFAFKTPMFPY
FT                   ALEPNAAGGALIERIKAEQAAAITERRDRYVTVSDLRLIGPATDLSTKARAAAVQAYCL
FT                   THNVRATGQDLTSIDSHLTLQEVVSSLGLDDAFFAALPDGVASCKTPEELDAWALAWFN
FT                   TQTAWLEVGDLSNALGFDMRRYREQQSKIDDGRERWISVGSDARTALGGPARAALQRAI
FT                   EGGLFVDEILATAARHSYATYMPTTFLADGVSRKLAETLFEEGDHIELKVGVDEVRAAL
FT                   MVPKSARLYVETWADAINMAMALFSGSWASMVGWAKVAKAARAADTAGTDVKGILALLE
FT                   QQPGVISARIATDDYFFPGDKWTRGSFRYEAGKYVNLALVQGGAASNKIAVKGAEGLQG
FT                   RTFNSSNKAFRIAVESGQTFSNGSPVASLESLLNHLGLSMADYQA"
FT                   /protein_id="YP_001109674.1"
FT   misc_feature    complement(<67487..68059)
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Bcep1808_7753"
FT   misc_feature    complement(<65702..65896)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bcep1808_7753"
FT   misc_feature    complement(64187..>65368)
FT                   /note="Superfamily II DNA/RNA helicases, SNF2 family
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]; Region: HepA; COG0553"
FT                   /db_xref="CDD:30899"
FT                   /locus_tag="Bcep1808_7753"
FT   gene            complement(68580..70904)
FT                   /db_xref="GeneID:4947289"
FT                   /locus_tag="Bcep1808_7754"
FT   CDS_pept        complement(68580..70904)
FT                   /locus_tag="Bcep1808_7754"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_2383 hypothetical protein"
FT                   /db_xref="GI:134287508"
FT                   /db_xref="GeneID:4947289"
FT                   /translation="MTTPVENPAVIENLRVLFDDARGFDLDTVMLSGDVLAGVDALDVA
FT                   RAADDALAELQAAETLMALLKRLMTPARGVILQNRDRSTPAMIAQMNAIASAPDYYRVA
FT                   PTKEFASGTPIVFGNGDLLPSKIAFGRNDKAVAADGRRFVVQYAVVEADDLLTSNAADG
FT                   IANADYTNGVPGKLRAIAGNGRLAGLKAAYQRSTTDDYRVELAQDDMTGLAPGALDAFT
FT                   APILVRVMRAEDVTENIGDISNQRGTSDLSPVEQAQNDAKRIDLADIDVADDGKPTEAA
FT                   ALAFIAAMPESERNNLMDGKHPGQKAYDRLMATVFWKAYDAPELVRLYAQSVDSEIKTI
FT                   LGGMASAAAELARLDGAGDLDIRGVVTEAASLAVNAKRQGVKLADFAKQTDMTLSLDTM
FT                   EVVRMFVENIRSAKKIGERLRAAARFAYEEFTKEDSDMFGAVEKATRPQVLDRLKADPV
FT                   DPTMSLFDSVDPLRALELSGSLLEKVEALTAAGDDDPLAVLTLSDEILAIIRELEGAPA
FT                   NSDLPAATAHSAQYESYRRAIEEAKAAGTLTTMPGLLEQIRADERLNDGEADELLALAT
FT                   EGKPAGEEAPVVPDPVVPGTLSDATMQTYITAAADSIAALRRIDVYRVLNGLAADNVDG
FT                   VTRSDLATWIAMNRPDLVKEVTDVMAEEYAADGWTLPEDTEDGEWRAKQADQPLPPGPV
FT                   VVPPVVPDPGPAPTVNPKRADDLAFFEAVAAEKVDMWDDQLADKLEAMIAAYGGDDEMR
FT                   EAWTRAVNAYTNFMVNAMKGV"
FT                   /protein_id="YP_001109675.1"
FT   gene            complement(70901..73573)
FT                   /db_xref="GeneID:4947290"
FT                   /locus_tag="Bcep1808_7755"
FT   CDS_pept        complement(70901..73573)
FT                   /locus_tag="Bcep1808_7755"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1721 hypothetical protein"
FT                   /db_xref="GI:134287509"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="GeneID:4947290"
FT                   /translation="MTSYLTIEQAAHEGAYGHNALAHPSPAMQDAGNYKKGRTSVRGFP
FT                   VVIENPRGTLRQWRAADGTSGANLMRFHYGYFQGVKGADGDELDVYLGPAPESNTAFVV
FT                   NQFLRGAFDEHKVMLGFPDQRTAEAGYLSNFDSGWQGMNSCVPCSLAQLKWWMTYGDMS
FT                   KPLTPDQLPYEERNDMQKVIWDSANAPVGTTLAQLLYRIRAHDGRDSLMFDPLTAADIL
FT                   ADSDGVLALDALVVPYARLEPRMAILKKVMDRAVEGLSVASFQITEPFSQKGTTNVAAV
FT                   FELSDGQTLSIFFHNPDVTPKKIMPGDDLISWKWMLNKKDVTIAVAPERGRDLNVRNVA
FT                   LRVMSLAAKNSSRFASTNAKRAERMASIDGLQKEFAEKEATLETLTTEIQQLEAIVAAK
FT                   PTAAPEPAAAPVEPVEPAAVVETQPKPVIDPETPVAPAIDPEAPAEPEAPAVVAQEAPA
FT                   ANPVVTEQESAELEARAAALRPQIEALSDSELAMMAATAPLSIGGFDDLVTGKDATGDK
FT                   RARLIDHIMASHPDDIEASLTRWRENYAPAASSKPDLTYRKVDDMFTMFYPETPAGETA
FT                   WNQMAEHTDGTGKVLHAQVESTIQQLREAGYTVEPAVAPDQGIDDVLAELDALDTPGTP
FT                   AAPKPQGEPALEAAGFKNITSNVWARSMTADDGRFVRVNINVAEGGYFVRKSIGAPGIT
FT                   GAGQDLGQFDTAEAAIAAAQAEFDAFTSAPIEPTYPGADVLEANGFRHGADNVWTRSES
FT                   NADGVRLALSAYIQTDGTYALRKAIIGLTEAGAVEDVGTYATPGELVDAAVEEITAFLS
FT                   PTVAPTPEPETPATNPDAVYMQSIIDGSADLSDAAIPARLMQIHADNAENADMQALFKQ
FT                   AVNAYSAFAVAKARAKLAA"
FT                   /protein_id="YP_001109676.1"
FT   gene            73696..74169
FT                   /db_xref="GeneID:4947291"
FT                   /locus_tag="Bcep1808_7756"
FT   CDS_pept        73696..74169
FT                   /locus_tag="Bcep1808_7756"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287510"
FT                   /db_xref="GeneID:4947291"
FT                   /translation="MATKKGTKFSFTTAEGKVETRTSPRAYTHVVVGRRDYVKERAHLE
FT                   ANRATIEKQERRNWEFYRQCAQTPVGEKRETKDIYPNDERNVEMGQKVLDRAPTADAFV
FT                   AEYMARQEANIPAGDFGPEIVLQWSQSARAALAAVSKWSQWHTQVRVVELKSE"
FT                   /protein_id="YP_001109677.1"
FT   gene            74218..74553
FT                   /db_xref="GeneID:4947292"
FT                   /locus_tag="Bcep1808_7757"
FT   CDS_pept        74218..74553
FT                   /locus_tag="Bcep1808_7757"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287511"
FT                   /db_xref="GeneID:4947292"
FT                   /translation="MKLKFSKKVQSLILPTEGEAAGTEPFAGSAPIQALIREQWAQGGL
FT                   AKDGSIQIEVGPEYAAVLRGHAVARLTALEASLAACTTDEERKPFFGENSAWRALQKQI
FT                   DAEAVPA"
FT                   /protein_id="YP_001109678.1"
FT   gene            74623..75153
FT                   /db_xref="GeneID:4947293"
FT                   /locus_tag="Bcep1808_7758"
FT   CDS_pept        74623..75153
FT                   /locus_tag="Bcep1808_7758"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287512"
FT                   /db_xref="GeneID:4947293"
FT                   /translation="MELKSNAPEIKWIIQHAPVNDFARSLDTCLLRTGTLTQPMLDAVR
FT                   RNLSASVVDTAGVERIVTAFNNALESGLKQPKMYLGDFTFKLATRGANKGAIFVTEGGA
FT                   YLGKVAGGKFMGTRDCSDEQKAEILKVCADPKAAAETFGKETGRCSCCGRELTDPVSIA
FT                   NCIGPICAERYGF"
FT                   /protein_id="YP_001109679.1"
FT   gene            75157..75720
FT                   /db_xref="GeneID:4947294"
FT                   /locus_tag="Bcep1808_7759"
FT   CDS_pept        75157..75720
FT                   /locus_tag="Bcep1808_7759"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287513"
FT                   /db_xref="GeneID:4947294"
FT                   /translation="MKLRVNRNIYGNWNAYEGSRKTELGMSEFDALDWASERLLKGDCV
FT                   LSEKSDVTMSDVEAHRARLARPARRSVAGATKERCAVDCDAPQDDARRGESGQEHDDRN
FT                   PVQACAGTEVPDGARAQCELAKMTPDPFTDTERLDFLIEELAQVERFKGKYRVADHYGP
FT                   LCDWQSTPREAINAAMNNKAKGVR"
FT                   /protein_id="YP_001109680.1"
FT   gene            75720..76049
FT                   /db_xref="GeneID:4947295"
FT                   /locus_tag="Bcep1808_7760"
FT   CDS_pept        75720..76049
FT                   /locus_tag="Bcep1808_7760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287514"
FT                   /db_xref="GeneID:4947295"
FT                   /translation="MNEQEFKQAQETARRACASGTYTGGFSIENKGGDIRPFVVYGWGE
FT                   YPESSVLAGQTMKQFIDSFDTEEQARALYPQAEAGTHGRSAHNSVSHLPGEDDPVPGGM
FT                   YHDGI"
FT                   /protein_id="YP_001109681.1"
FT   gene            76098..76418
FT                   /db_xref="GeneID:4947296"
FT                   /locus_tag="Bcep1808_7761"
FT   CDS_pept        76098..76418
FT                   /locus_tag="Bcep1808_7761"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287515"
FT                   /db_xref="GeneID:4947296"
FT                   /translation="MSQPRGEILLDDGEYFVEHNVNYPPERGNGFLMRRCATSMTAPEG
FT                   AECVGGYDLKPDGKWHADIHAPLDEDTDSDCRALGMFDNRLDAIGTLWQRRREAYCRHP
FT                   RY"
FT                   /protein_id="YP_001109682.1"
FT   gene            76423..76782
FT                   /db_xref="GeneID:4947297"
FT                   /locus_tag="Bcep1808_7762"
FT   CDS_pept        76423..76782
FT                   /locus_tag="Bcep1808_7762"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287516"
FT                   /db_xref="GeneID:4947297"
FT                   /translation="MHRHFDTIERELRAAIDAAGGDNSALLDRLDRLMNDVRGARFAAR
FT                   FALFGKAMKPGGEPEREIDGVEPPSREFEHDDTVRTKEGYLARVAHYDRAGRVVVNVLF
FT                   EAAEYKESELKRVEL"
FT                   /protein_id="YP_001109683.1"
FT   gene            76779..77069
FT                   /db_xref="GeneID:4947298"
FT                   /locus_tag="Bcep1808_7763"
FT   CDS_pept        76779..77069
FT                   /locus_tag="Bcep1808_7763"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287517"
FT                   /db_xref="GeneID:4947298"
FT                   /translation="MTKIAVAAKRAGPGRPTNVERGLPPRPTAAQRRANSDAEKIARGE
FT                   QRINTWIAADAAAALAAITGSDQSRGAIREAIGLALIAYAQTLPTKRKKNG"
FT                   /protein_id="YP_001109684.1"
FT   gene            77062..77412
FT                   /db_xref="GeneID:4947299"
FT                   /locus_tag="Bcep1808_7764"
FT   CDS_pept        77062..77412
FT                   /locus_tag="Bcep1808_7764"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287518"
FT                   /db_xref="GeneID:4947299"
FT                   /translation="MDSFWNTGVSTNASNTAAPMTAADLPAMLAQMRGITDRAAEDDRQ
FT                   QADVLRALALKHGFDLDAGDLMIAPQSFDLHIPLALKDRVRVSSLATSIMFINRTYVVD
FT                   PLIAPPSLFPRR"
FT                   /protein_id="YP_001109685.1"
FT   gene            complement(77392..77904)
FT                   /db_xref="GeneID:4947300"
FT                   /locus_tag="Bcep1808_7765"
FT   CDS_pept        complement(77392..77904)
FT                   /locus_tag="Bcep1808_7765"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287519"
FT                   /db_xref="GeneID:4947300"
FT                   /translation="MINEIPVAISQASRTVVLKHPNSMDCTLYRKVFTRTAPGDETMGG
FT                   LPTLGGLGVLSPEDEAEFEYQAVGAAKILITSRYEQPLDLSDRRDSLPPDTVMQEALIE
FT                   ALSGPDGAPPTYGPKKYDLVGVEPGGGVLIGFEIVGMTSSVGLYPYTTKWIIAPRDELH
FT                   DLTPWKE"
FT                   /protein_id="YP_001109686.1"
FT   gene            complement(77901..78941)
FT                   /db_xref="GeneID:4947301"
FT                   /locus_tag="Bcep1808_7766"
FT   CDS_pept        complement(77901..78941)
FT                   /locus_tag="Bcep1808_7766"
FT                   /gene_family="HOG000229539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0933 hypothetical protein"
FT                   /db_xref="GI:134287520"
FT                   /db_xref="GeneID:4947301"
FT                   /translation="MPKRALTSHLIERATTRLGSAKREAAERAQFDLERRQAATTILQP
FT                   HEVSGEYDAGRLLTTTRRGGVHNPITLSDLRAFQSNITRLKKQYKGGITAQSVIDLSLP
FT                   VDRERANKEIRMAVPVSLRGGLVHFITNAGPDSDATRHHVHVEFLDFQAAVGASPNDPK
FT                   KIGKLVTSGRTLFDCDCGRHTFWYRYIATVGKYNYGRGETGFPKIRNPNLKGVACKHVL
FT                   RVMHVVQRDLNVQAKIAAQVIKAREVLDARKLKTEKTKVAELREMADAQHKKRTSSTNL
FT                   KTSEKKAHEAALRKARSDMKKTAVEKTKPKPKANQKEIERNAKNLLQLGAITQEMYEQI
FT                   VKGAQK"
FT                   /protein_id="YP_001109687.1"
FT   misc_feature    complement(<77970..>78239)
FT                   /note="MAEBL; Provisional; Region: PTZ00121"
FT                   /db_xref="CDD:173412"
FT                   /locus_tag="Bcep1808_7766"
FT   gene            complement(78907..79224)
FT                   /db_xref="GeneID:4947302"
FT                   /locus_tag="Bcep1808_7767"
FT   CDS_pept        complement(78907..79224)
FT                   /locus_tag="Bcep1808_7767"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287521"
FT                   /db_xref="GeneID:4947302"
FT                   /translation="MYSPVVTAAYVKAVRKFAVQTPDWANAIRYFTKPDERYDLTLIAQ
FT                   RVYGDRNEFMAIFAAAGLDTLEQPVPEQQLVLPTATQLMTIKRQTGYLTDAEARAYQSL
FT                   N"
FT                   /protein_id="YP_001109688.1"
FT   gene            complement(79231..79566)
FT                   /db_xref="GeneID:4947303"
FT                   /locus_tag="Bcep1808_7768"
FT   CDS_pept        complement(79231..79566)
FT                   /locus_tag="Bcep1808_7768"
FT                   /gene_family="HOG000263395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287522"
FT                   /db_xref="GeneID:4947303"
FT                   /translation="MLKKSLLVEANGVPASVHRVSSVTVGYVGGNTTAQVESFYNEDSL
FT                   AKSRAALTSSSITVQGLPAPGQDARDFVESELIKPVPDGVTSSDTLKQYSSDQYVFSGA
FT                   AVIANPA"
FT                   /protein_id="YP_001109689.1"
FT   gene            complement(79684..80016)
FT                   /db_xref="GeneID:4947304"
FT                   /locus_tag="Bcep1808_7769"
FT   CDS_pept        complement(79684..80016)
FT                   /locus_tag="Bcep1808_7769"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287523"
FT                   /db_xref="GeneID:4947304"
FT                   /translation="MAIKKTIELAGTGALAEYHVLRSAQVNGSGDVTVTVASYFTVEAF
FT                   AAGKSPVELLRHPIVIRGIPADGEEPMKFAESMLVATAPPGAADLPLNEQPFPNRYLFA
FT                   GGAIVE"
FT                   /protein_id="YP_001109690.1"
FT   gene            complement(80027..80467)
FT                   /db_xref="GeneID:4947305"
FT                   /locus_tag="Bcep1808_7770"
FT   CDS_pept        complement(80027..80467)
FT                   /locus_tag="Bcep1808_7770"
FT                   /gene_family="HOG000263396" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287524"
FT                   /db_xref="GeneID:4947305"
FT                   /translation="MSTVNFMLHVEQAAFILSKKFPSLVRCKDYWVSHPVHEKTYEQRL
FT                   TAWVPIWEPTDIPQPTPADLLAWWPDYADEYALAEETTSARQKRDDLLKQVDPMVERAA
FT                   DAGDADFEAALRKYRQALRDVPAQAGFPFNVTWPTLPAKSAE"
FT                   /protein_id="YP_001109691.1"
FT   gene            complement(80467..84531)
FT                   /db_xref="GeneID:4947306"
FT                   /locus_tag="Bcep1808_7771"
FT   CDS_pept        complement(80467..84531)
FT                   /locus_tag="Bcep1808_7771"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_II1333 phage-related tail fiber
FT                   protein"
FT                   /db_xref="GI:134287525"
FT                   /db_xref="GeneID:4947306"
FT                   /translation="MASTPVLNPKITAAGNALLPTDTQPGLSATLTHVAIGTGLYDPVV
FT                   DANGRATQTALVNEVARYAISSGSKPDNYSVQIGTTITDTDMNGASPNGKSIGEIGFYA
FT                   GTTLFAVWSRATGGALFIKSENLDVPFAYTLDVSVLPVGSVNITVSTDTAGMAALILQH
FT                   EAKLDPHPGYVLKKRGMGEYDPLTIYNAGAHIVGPDGKTYRSLVDNNVGNTPASYPAKW
FT                   ERWAFSTGELAAEFVPVRTGVQANGSNTLGMVRITNPDAAYFASDSNPLTGAFKIVLPT
FT                   GAYNALVRMRVEIHESATGKSITLLIAGYASGINWSNQTVAILGERADRDLAVRFGNDG
FT                   SKPIVWIGELTSTWSFPRVYVSEVMVSYNADGGSVARWMAGWSISAVTVFNSVTATMTG
FT                   NLVFGQSDIPRVAGLQAALDLKAPLDSAQMTGTPSITNTPTATTAQLALKGASGALNNE
FT                   GKLRLYGTFGTGSSDTGTRLIASLRAGFNAGSWGKEYLNFWINNGSSNDGQSDASQQLV
FT                   MSLVSGGRVLVNASSDDGSTALQVNGSVRAANYNINSQSVGDSGIFGFTNANGPAVAAY
FT                   GSGTSGAGALVLRTAGAERARVSSGGRLLIGTTTDDGSNLLQVAGNVSLVGAGPTINFN
FT                   NGGPAIWSPASKTLAFTNGNGEVARLTSGGRVLIGTTSDDGSSLLQVAGNTYFYGVSYF
FT                   GQTSSKAWINADANAYYLYGQGNALVGSAGSSGYLGLVSANAERLRVTASGRILIGTTA
FT                   DNGGDLLQVAGTVRGINGVGALIAANGGGTGQTSIILSRDGGPADQKKWEVMHGGDGTF
FT                   SIRTVNDAYSAAQNALWVTRGTGSTVGNMVLLQNGGRVLVGTLADDGANMLQVAGTGMF
FT                   ANNVSAYSSANDTQFTLSASNYAGGISLEAYNKANTTKKNIALAPWGGRVQVGSIPDDG
FT                   SSLLQVGGNGRFSGEVQSTAGIQFRAVFGNYASMLRNDGTNVYLLQTASGDQYGSWNAF
FT                   RPFSWGLSDGAVRIDQTGAGTTFGGNATFSGSKITINRTSGEGEIWLGQNDGYYYANAS
FT                   EAGWYSPTKGVFAYNFAAANIRVGNNYVWHAGNVTPLDKNVGGTVTGNVAFNGQVTMNA
FT                   GLATIASGTTYSALAISANGYTPRIQTAQASSMIGFVNGANTAYNLQVFDGGNVTTRDW
FT                   IGVGGSAYASGTNATITPDGNIWGTQWGNQWLRSFLDATYVHKSGDTMTGRLTLANGSW
FT                   QADIGLAAGDGWSTYLRARKGGGIELINSAYNSVPAFFEDNGNLHIGSSTFQTDGNIWM
FT                   GWYGGYLSAALGSKANAGSRVQWDSGVNNFGTIDRLNGALPAPWVVCGLSGPGNGTANA
FT                   IVVYGVLLRNQ"
FT                   /protein_id="YP_001109692.1"
FT   misc_feature    complement(80899..>81252)
FT                   /note="tail fiber protein; Region: PHA00430"
FT                   /db_xref="CDD:164803"
FT                   /locus_tag="Bcep1808_7771"
FT   gene            complement(84604..85098)
FT                   /db_xref="GeneID:4947307"
FT                   /locus_tag="Bcep1808_7772"
FT   CDS_pept        complement(84604..85098)
FT                   /locus_tag="Bcep1808_7772"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287526"
FT                   /db_xref="GeneID:4947307"
FT                   /translation="MSEPIRVQAIISGYQGAAVNLLGALDPKTGLFIVAKEQGIDERSD
FT                   GALVVSNSTRMEDRDRLFDEDKLQRAIQLFFSLKGQGLLELLAAVTKHDPATRIESDGM
FT                   SERGTRYRLAPEMSNGNIAVLAMIEAADMALAANTTIDTADDIAQMYGDLDGIDGDWAT
FT                   I"
FT                   /protein_id="YP_001109693.1"
FT   gene            complement(85095..85826)
FT                   /db_xref="GeneID:4947308"
FT                   /locus_tag="Bcep1808_7773"
FT   CDS_pept        complement(85095..85826)
FT                   /locus_tag="Bcep1808_7773"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287527"
FT                   /db_xref="GeneID:4947308"
FT                   /translation="MSLLTPLEIGLGGYMRRFYGQLVADTSSMQEYTARGLSKAMVWVP
FT                   GRMIDQIEEMLKEYRKNENDPGPGLSSRLPIVFVAMSKDFMPAPPDWGIAVGSRVDVMN
FT                   PDDPEQRAFKVRTSFNEYRAQIVIVAAEKHSAHSIAMQFNLFANGDDGGGGRRFTFDVP
FT                   FAGMAHQFRATLEQIDLGAVSVPVDVKDLTVCTVDLSVRAHVPLFEAPKDGEPNDGKPA
FT                   PAGYPVVTEVTSEQVFEGEGL"
FT                   /protein_id="YP_001109694.1"
FT   gene            complement(85828..86679)
FT                   /db_xref="GeneID:4947309"
FT                   /locus_tag="Bcep1808_7774"
FT   CDS_pept        complement(85828..86679)
FT                   /locus_tag="Bcep1808_7774"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287528"
FT                   /db_xref="GeneID:4947309"
FT                   /translation="MGKKTGKIVYNVHERGREHVGKERLFDLRALASLVNGDAVQEKVR
FT                   NRDLLGYYGHSIRVKFGIEPPEWAMVNGKQIFFEPAVVTTYLCADENGNIEHETEFLDT
FT                   EPGKMAARLHDSKAGGFSSAIQAVPNGLAHVPKKFGGFDYVHEPNYTTNRGYVFDSASG
FT                   ELDMNELVFDSVMTDMHHQQAAMNLIFDSLQADHTLAMQALERLREENEELLSLLSAAR
FT                   PGVVLDSAREHQAPTLTGRRATADFERRANSFASASLVSLDTLKEGDENAGAAYARKYF
FT                   GA"
FT                   /protein_id="YP_001109695.1"
FT   gene            complement(86692..88095)
FT                   /db_xref="GeneID:4947310"
FT                   /locus_tag="Bcep1808_7775"
FT   CDS_pept        complement(86692..88095)
FT                   /locus_tag="Bcep1808_7775"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287529"
FT                   /db_xref="GeneID:4947310"
FT                   /translation="MSDLIPVDSPSLQPLQQSFERDQLESELKAVFLAVFESMIRANER
FT                   RLNLYGMPHLGDAELVERALKDSGLAIVKRDVTRSSFLLQAARARNPRRGMIFLKQYLQ
FT                   AVWPNVWLVEPLWHPLATSANYPADRTPLGTKTLTNGVSAVYDMASNPEGLPTVYKTDW
FT                   QGKTQLYTTPRTNSLTYSGPIDNAAWVKTLMTATANAAVAPDGTQTAAKIADSDTSNAA
FT                   HSVQHSSVSSQNAADWNTWSIYVQAVERRYVVLRLIASGASSNYCAAYFDLLTGNSAVV
FT                   NAGKATGAKATITSLGVNGWWRVSVSGIPNPNVASQGIAAFIGAPPSFGNTTVYAGVVG
FT                   QGINAWGGQLEAGGAPTRYIGTTGAAVTVTDYTVNANGVAHFSDGVTADAPLTHFRTGR
FT                   IRVTLPVSSDNGLGLLEIAKAFRSTLAPRLMLELRLSTLFENKGAAGGLALANGAKAIM
FT                   PLMAIGKIS"
FT                   /protein_id="YP_001109696.1"
SQ   Sequence 88096 BP; 16598 A; 27148 C; 27196 G; 17154 T; 0 other;
     GCTTAGAAAC TCCACATGCC GTCGTTGTAC GTCGCCTGCG TCACGTTGAC GGTAAGCGAC        60
     GCCTCCGACA CGTAGCGGTA CTGTTCGGGC AGCGTGACGG GGAGCGCGGC AAGTGACACC       120
     TGAAGGTCCG AGCCGTCGTC TTGCAGGGCC ACGACGTTAG TTTTCAGGGC GTCCGACAGC       180
     TTCTTGTTGT TCATCGCCAT CATGCCCTTG GCAGCGGCCT GCGAATCCTT GCCGTACAGG       240
     CGATAGACCA CGTCGCGGAT TTTCGCCTCA ACGTCACCCA CATCATGCAC GACAGAGACT       300
     TGCGCGTTGA TCGTCAGCGG CAGTTCGGTC GGGACGGCAT TGACGAAAAT AGCTGAGTAC       360
     GAGTCATCGG CGAGCTTGAT GATGCGGCGG ATTTCGCCCT GAAGCCACGT CGTATCAACG       420
     CCGTCCATGA GGGCCGACAC GAACAGCTTG TTGATGTTCG CCACGCTCGG GCCGCGCACG       480
     GACTCCTCGA CCTGTTCATT CCAGACCGAG AGAAAGCGCA GCGGGAACAC GTTGCGGCGG       540
     ATCAGAAAAT CGAAGTTGCC GAGATAGACG GCGGACGAAT CGTAGGTGCT CGGATACTTC       600
     GCATACTCGC GCAGCGTTTC GATATCCAGC GGGTCGGCCC CGGCGAAGAT GACCGACGCG       660
     AGCTTGAGCG TCGCAATCCG GTCCGCGCTC GATACCGATG ACTCGAACGT AAAAGAGGCA       720
     TCGACCGAAA GCACGTTCGC GCCGAATGTC TCCTCGACCG TGAAGTCAAT CTGCGTGCCG       780
     TTCGAGGGCT GAACGCCGAC AACATTAGCC CATCCAAACT TGACCCAAAG CCGCCGCTGC       840
     TCGTCCGTTT CGAGCGAATA GCCTGCCGCA CCCGCGGCAA GGTTCTGGAA TTCCGGCGTG       900
     TACGGATAGG GCACACCGCC GATGCTCACG TAAATGCCGC TGATGACCTG CTCGGTGTCG       960
     CTGTTGGGCG GAATCTGCAC GCCATAGAAG GCGACTGAGT TCGATACCGT GTGCGAGAAG      1020
     GTACGCGTCG TTACCTGCTT GACGTTGACG GTTGCGGTCT GTCCCGCGGG GATGCTCGCC      1080
     TGTGTTTCGG TCACGTAGAC GCGGCCGTTC TGGTCGATGA CGTTGCGCCC TACGGCGATA      1140
     TTGAGCGTCG TCACATCGTT GTTCGTGACC GTGAGCGCGA GGCGCGGCGG GCGCGCAAAC      1200
     GGCAGGATGC CTTTCATGCT CGCATCGGCG AGCACGGTCG TATCCCGCGC CTTGATGAAC      1260
     GGCTCCATGC TCTCTGTGTC GATCTGCTGC GAGAGCATCG CGAGCATGGT TGCCATCGCA      1320
     TTCAGTTGCG CGAGCAGGCG AGGGTCGCCA GCCTGATAGT ACTGCGCGGC GAGCGGTTGG      1380
     TTCGATACCT CCGCGGCAAT GGCCGTCATG AAGTCATCGC GCGAATACGA CATTACTTGC      1440
     CTCCAATATC GACTGTCTGC CCGGACAGGT CGATGAAGTA CCGGCGTTGA TCCGGCCCAG      1500
     TGTCTTGCGA GTAAAGATTG ACCGAGCCGC GCGGCATGGC CGCGAGCAGT GGCACATCGG      1560
     TTTTGAGCTT CGCGATGACC GCATCCGCGC CGCCAGTGCG CAGCGGCGTT TGCAGCAGGT      1620
     CGGGGAAGTT CGAGCCGTAG TCCGAGCCGA GATAGCCGTT CACTGGCGTT TCGAGCCAGT      1680
     GCGAAACCAT GTCCTGCGCG TCGGCGGTCG TGATCTTTGT ATCCATGCGC CTGATGGTAC      1740
     GGGGCCGCGC GGCGGCCATA GGCGTTTCGT TTTCCCGCCC CTCTAAATAT AGACATTTCT      1800
     ATTGCATGTA GCCTGAATCG ATATTAGTAT TTCGATATTC CAGAGTGACA CGGGGCGTCT      1860
     GTCGATGGCC GGGCAATTGA AGTTCATATG TCGCAAGTGC GGCGCGATGC ACGAGCGGCG      1920
     CAATCAGGCC GTCGAATGCT GCATGGCGGG CGAAGCACTC ACGGCAGAGG AGCTTGAGGC      1980
     CATCGGACAG CAGCGGCTTT TCGATGACGC GCCGACCGCA CCGGCACTCG CGCCGCTGGA      2040
     ATGCGAGCCG GGCGGCCCGC AATTGCGGCT TTTCTGAGAG GCAAGCGCAT GAATTTCGAC      2100
     CTGAAAAAGC CCTGCAAAGA CTGTCCGTTT CGCAGCGATA TCACGTTCCA CCTCAACACG      2160
     GAACGTGTCG AGGAAATCTG CGACGCCATC ACGCGAAAGC AGCAGACGTT CGCCTGCCAC      2220
     AAAACGACGC AACACGACGA CGAAACCGGC GATCACATTC CGCACGACAA AGAGCAGCAC      2280
     TGCGCGGGCG CGCTGATCCT GCTCGAACGG ATGAATAAGC CGAACCAGAT GATGCGCATC      2340
     GCCGAACGGC TGCGCTACTA CGACCGCCAA GCGCTGCACA TGGACGCGCC GGTATTCGAG      2400
     ACACCCGAGG CGATGATCGC CCACTTTCGA GCGCTGAACG ATGAATGAAG CCAAACAAAA      2460
     GCCGCTGAAG GCGTATCAGG TTGATCACTA CGAGGGGCCG TGTGAAGGCT CCGCGCTTGT      2520
     GTTCGCGAAG TCGAACGCGG CGGCGCGCAC CGAGGGCGCG AGCGAACTGG GCCTTGGTTG      2580
     GGATGACGTT TCAGCACATC GCTCGGCGCA ATTCGATCAT TACGCCCCCG GCCCGGTGCC      2640
     GATCATGGCG CTGATTGACG GCGGATGGAC GTTCCATTGC CATTTGCACG AGTGCCAGTC      2700
     TCCGATTACG CGCGAGCACC ACAACGACGA CGGCGACGAG GTTGACACCG CGGAGCGCGC      2760
     CATCGTGCGC GGGCGGAAGG TGTTCTGCGA TGCCTCGTGC GCGGCAATGC ACGACGCCTC      2820
     CAAGCGCCGC CGCGCCGCCG CCGAGGCTGC GCTTATCGAA CTCGTCGAGG CGAAGTTTCC      2880
     CGGCTGCACG ATTACGCGCA TTCACATTTG CCACGACCGT CTCGAACCGA CCGAACCGAA      2940
     CCACGGAATC ATGTGTAGCG CGGAATTCAA GTTCCCCGGC GCGAAATACG GCGCGACCTA      3000
     TATCTACGGC GAGGGCAACG TGGCGCGTGT CGCGCAATAC GACCTCGAAG CATTCAAATC      3060
     TATCTACCAG TGAGAACCAT CATGGCCACC CTGAAAATAA AGCGCCTGCA CCCGGACGCG      3120
     GTGATCCCCA AGTTCGCGAC GGAAGGCGCG GCCTGTTTTG ACCTCGTCGC TATCGACGTG      3180
     GACAACGCAG TTGCGCACCC GAACGACAGA CAGGCGGCGA TTGTCCGCAC TGGCTTGGCT      3240
     GTTGAAATCC CGCCCGGCTA CGTGATGAAA ATCTATTCGC GCAGCGGCCA CGGCTTCAGG      3300
     GACGCCGTGC GACTCTCGAA CTGCGTCGGC ATCATCGACC GTGACTATCG CGGAGAAATC      3360
     AAGGTTGCGC TGCGCGCTGA TGGCGGGAAC TACGTCGTCA ACAATGGCGA CCGCGTTGCA      3420
     CAGGCCATGC TCGAACTCGC GCCATCCGTC CAGTTTGCCG AGGTCGAGGA CTTGAGCGAA      3480
     ACGACACGAG GCGAGGGCGG TTTCGGCTCG ACGGGAACCG GCGCGCTGCC CGCCGACACG      3540
     GCGGCTACGG CCGTGCTCGA CACCAACGGC TACGAGCGCG ACGACGAGAG CCTTCAATGC      3600
     GCGCTCGAAC TCGTCGGGTA TGAGGTTCCG CTCGACGTGA TCGGGTATTG GCCGCTCGAA      3660
     ACGTGCATCG CCGTCCATGA CTGGGCGCTC GCCGCGCATT TGAAGGCATC GGATAACGAC      3720
     GTGGTTGTGC CGGAGTGCCC GGCCTCGCTC GCCCGATTCG CTCCCAAAGG CTGCTCCTAC      3780
     ACAATCTGAC CAGGCCATGA ACACGAACCT CGACGCACGG CGCGCCGCGC TGCGCGACGC      3840
     TGAAGGCGTG ATGATCGACG GACCGCGCAT CGCCGCGCCC GGCGCGCGCA TCGATGCAAG      3900
     CGACCTCGCT CAGATGCTTA CCGACGCGAT GCGAGCCTCG CGCATTCCGC GGCTCACCTT      3960
     GCTTGCCAAT GCCGTGCGCG AGGCTCCCGT CGTTGATCTA CTCATTGCGC TCGCGCCGAT      4020
     GGCCGATGCC ATCGCGCGGC ACTATGCCCG CTCAATTCCG GAAACCGCGG CAGAAAGCCC      4080
     CACGACTTCG CGCGATTGAA CGATCAGGAA ATTTATAAAA TCTCGCGCTC GAATGCGCGT      4140
     TTTCGGACCA CACCATGAGT CAAGACCACC AAAACCCCCG CGTTCTCGGC CGCCTTTCCA      4200
     CACTCAACGC CGACCTGCCT ACGTTTCAGG ACCGCGTACA GCCTTGGCTG ATGGAGTGCT      4260
     TTGGCCCGGT GATCGCGGGC GACCGCGAGG AGCGGAACCA TCGCTTTTTC GAGGAGGCCG      4320
     CCGAGCTTGT GCAGGCATGC GGCATGACCG CAAGCGAGGC GTTCCAACTG GTCAATTACG      4380
     TCTGGAACCG GCCCGTCGGC GAGCCGCATC AGGAAACGGG CGGCGTAATG GTCACGCTCG      4440
     CGGCTCTGTG CCTCGCCAAT GGCCTCGACA TGCACGAGGC GGCAGAGACG GAACTGGCAC      4500
     GCGTATGGAC GAAGGTAGAG GCGATCCGCA CTAAGCAAGC GGCGAAGCCG AAGCATTCGC      4560
     CGTTGCCGCA GGCAGTCGAA ACGCAACCGA TCATGCGCTT CAACCTCATT CCGGGCGGTT      4620
     TAATCAACCC CGAGCCGAAC GGCCTGTATG TGCGCTTTGA GGATCATATC CGCGCGCTCA      4680
     ACACGCCGCG CGCAGCCGCA CCGGTACAGA CGGGCGACCG TCTGACCGAC GTGAAGGCGA      4740
     ACGATATCGT AGCGCGCGGT GGCTACAAGG TGACGGGCGC AGTTCTCGCG AACGAGGAGG      4800
     GCAGCCGCTG CATCGTCGAA ATGAGCGCCG TTCGCTGGCT CGACAATCAG GAAATGTGGC      4860
     GTCTGATGCA CCCTGACGCG CAGGCCGCGC AGCCGGTCGC GAGTGTGACT ATCTCGAAGC      4920
     CGGGCGATAG CGTGACGGGC ATCGTATTCA TGGCGCTCAA CGAGCACGGC CGCGCCACGC      4980
     TCGGCAAGGG CAAGCATCAG CTCTATGCGG AGCAGCGCGC CACCACGAAC GCCGATACGC      5040
     TCGTTTCCCT GCTGCGCTCG ATCCGCCCGA ACTTCGGCGA CGTGGGAACG CGAGACGCGG      5100
     ACGTGCGCCG CAAGCAGGGA TACATCGACG AGGCGATTGC GCTGCTCACG ACTGGGCCGG      5160
     GCCTCGCGCC GAGCATCACG CCGAACCTCG AAGGGCTGAA AGCGCGCCTG CTCGCGCCGC      5220
     GCTGGCCGCT GACGCGCAAC GCGGACGGCG CGCTCTATCA CCCCGACATG CCGGTAATGG      5280
     ACGAGGGAAC GGACTATGCG GGCTTCCTGA AAGCGTTCGG CCTCGAATGC TGCTTCACCA      5340
     CGCTCGAATC CGAGGATTCG GACAAGTCGG AGGCGTATCA CGAGGGCCGC ATGACGCTCG      5400
     CCGAATGGAC GCCAGCCTAT CCCGCGCACG AGGAGGGAAC TCAGCCTTTC ACGCTACTCG      5460
     AAGTTTTCGA CACCGAGGAC GGCCCGATGG CGACATTCAT TCGCCCGATG CAGGCCGCGC      5520
     CGCGCCGCCG CAGAACCGCC GCGGAGAACA AGGCTTGAAA CTCGTTGCAC TGATTCTGTT      5580
     GCTAACGGCC GCAGTCGAGT TCGCTTGCGC GGCCGAGTTT CGCACCCTGA TTAACGTCGA      5640
     GGATGCGTGT AACGTCGATG ACGCCGCGGT ATGCACCGAA TCCCTCGCGT GGCTGGATCG      5700
     CGAATGAATT GCACCGCCAT CGACCTGCGG ATAAAGGCGG AGCACATCAT CCGCACTGAC      5760
     CGCATCGAAG CGGGACGCGA CGTGTCGCAC CTGAATTTCG AGCGGCAATA CAAGAGCGCG      5820
     ATGCGCGAAT ACCTCGCGGC CCTTCAACGC ATCAACCAAG TAGCAGGTAT TCTCTTTCCT      5880
     GACTGAGCAT GGATACAAAG CCAACCCCTG AAGTCGCCGC AGAACCGGCA CCCCTATCGC      5940
     TTGCTCGCGT TTCGCAGCGC ACACACGACC GGGCGGCGCG CGTCATCGAG CGCTGTAGAT      6000
     TCCATGTTAC CGGGTACGTG CTCAGTGACG TATGGGATTT GCGCAAGGCC ATTGTTGAGG      6060
     AGGGGGCGGT GCGCTGGCTC CCCAATCGCG AGGACTTCAC TCGCGTAATG GCATGGCAGG      6120
     ACACCAAAGG CCCGAACACG CCGCCCGACG AGGCAATTGG CGACGAGCTT ATCGGCACGG      6180
     CAGCGCAGGC CGTCAGCGTG CCTCCTATCG TGCTTGCTGC GCCAGCCGCC GAGCCATCGC      6240
     GCCCAGTGCT CACCGCGCCG CCGTCTGCAC GCCTGCTCGA ATCGACAGAG GAGGCGCTTG      6300
     GCGTGCTCGC GGGCGAGCTT GGATGCGTTC GCAACGAGGA TATCCCGCAC AACGCGGGCT      6360
     GGTTCGTACC CGGCAAGGCC ACGGCATACG CGAGCGCCCT CGACGCCATC AAAGGGCTTG      6420
     TGTCGAGCCT GAAGCAGGGC GGGACCGTAT TTGATTGCGC TGGTAAGAGC GGTGCGGCCG      6480
     AGAAGTTGCC GAAGAAGGTG GATCAGCCAG TCGCACTCGA AGCGAATCAG GCTGACCTTT      6540
     TTTAACTGCT GTGGGGAGAG CGTGGGCCGA AGTAACGGAT CAGTCTGAAG CAGTAGAATG      6600
     GCGGCGGGGA ACCGAAACCA CGGTTTCATT AGCGCCACGC ATAGCCACCA TAAAACCAAA      6660
     GCCACCACAA AAATAATGAA ACTTTCAACC GATAAAATCC TGAAAAAGGT CGTTCAACTG      6720
     GCTCACACGC TTGCTCCAAC GGGAAAGACC CACCTCGACA TTGGGTCGGG CACTGGCGAG      6780
     CTAATTGCCT TGCTTCGGAA CGCAAATGGC ATGACCTCCC GAGCCTGCGA TTACACCGAC      6840
     GAACTGATGC GACTTCCGGG GCAGAAAGTC GATATCGTCA ACCTCAACGT AGACTCGACG      6900
     CTCCCGTATG ACGGGCAATC GTTCGACGTG GTGACGTGTA CCGAAGTCGT CGAACACCTT      6960
     GAAAACTACC GCTCGCTTGT TCGCGAGGCG TATCGCGTGA CAAAGCCGGG CGGCGTGGCG      7020
     ATCTTTACAA CGCCGAATGT CCTGAACCTG AAATCGCGGC TCCGCTTCAT GTTCTTCGGC      7080
     TTCTGGAACC TGTTCGGCCC GCTGCCGATC ACGCGGAGCG AAAACTTCTC GACGGCTGGG      7140
     CACATCACAC CCGTACCGTA CTTCTACCTC GCGCACGCAC TGCACGAAGC CGGGTTCAAG      7200
     TCCGTCGAGC TGGAAATCGA CAAGGTGCAG CGAAGCGCAA TCCCGCGGCT GTTTGTGTGG      7260
     TGGCCGTTTA TCTCGCTGCT TAGTCTGAGC AGCAAGCGCC GTGAGGTGAA GAAGTACAAG      7320
     ACGGTAGACG CGGGGAACAG CAAGATCGTC GACGACATGA ACACGCTGAA GATGCTCACG      7380
     GGACGCACGA TCATCGTCTC CGCGCGACGC TGAGACACCG CGGCCGAGCT ACGTCGCACG      7440
     ATGATAGTAG GGAGGCCGGT CATCAGGTAA GCAGACGCAG GCGGCATCAG TATGTTGCCG      7500
     GGCGGGTCGT AGACAGGGGG ATGCGCGCCT GACCGGCTAA CTCCAGACAT GCCCGTGCCT      7560
     GCTTACCTGA TGGGCCAATC ACGCCCATAA ATTGTTAGGA CTCCTGCATG ATTTGACATA      7620
     AATACAATTA TCGAACAGCC ACGGGAATCC TCGAAAACGA GGGAGGTAGC GCGAAATTCC      7680
     GCGCCGGGCT TATAGCCCGG AGGGTCCGTC ATTCCCAATC GAGGAATGCA ACAGGCTTCG      7740
     CCCGGCAATC AGGTATCTCC GCAATACCTG CCTCGACTTT CGCGCCGCGG CTTGAGCCAC      7800
     GCATGAGACG GGTCAACTGT AGCTGGCGGC GCGCGAAGAA TGCGGCTGTC GTTTTCCAAA      7860
     CGTATGAAGT TTTTTTGTTC TGCCCCCTTG CGTTAATTTG TGTGAGCGCA TACAGTAATG      7920
     ACTCAGCAGC AAACGAACTA GGAGAAACGA TGCTTGTACG CAAATTGATA ATACGGCCCG      7980
     CTCCGGTGCC CCCTCGGGCA TGCGGAGCGG AAAACGGAAA GACAGGAAGG CGGAATAACC      8040
     GGCCGCGTCT CAGACGCTAT GAGCAGCGCG TACCAGACAT ATAGATTGGC GACGATGCCA      8100
     TGCCGACAAC CAAAGCCGCG CAGCGGCGCT AACTGGGCCG TGCAATGAAG GGGAACAAGG      8160
     GGCTTATGCC CAAACGGATA ATATCGGGCG TCTCACGCAT TGAGGCGCGC CGTGCGATTG      8220
     GGCCGAATGG CGGCACGATC AAATGGGCCG TGTACATCAA CGGCACCATC CTGCGCGAGC      8280
     ACGGTTGCGT CATCAGGCGC AGCACGCAGC ATGAAGCACT CGAATATGGG AACGCCTATG      8340
     TGGCGCGCAA TGTGAATTCA TGAAAGACAG AAGGAGCCGC ATTATGACCA CCGATAAGAG      8400
     CCGCGCTGAT GCGCTGACGG GCGACAAGCG TCAAGCACTC GGCGAAGCAT TGACCGAATA      8460
     CTTTGCCGAA CTGGATCGCG ACATCGGGAT CGATACGCCC GACCGAATTC TGTCCTTGAT      8520
     CGACTATCAC GATGAGCGCT TCATCTACGA CCTGATCGAC CGCGTGATCG TCCCGACTAT      8580
     CGCCGCATCC CCTGTCGAGC AGCACGAAGC AGCGCCGGCC GGGATCGAGC CGCCACGGCA      8640
     CATCATCGAC GCGGCAATGG ATGTTGCTCG CGACCAGTAT GGACATGGCG TTACCCGCGC      8700
     CAGCATCGTC GCAATCTGGA AAGCGCTCGG TAGGCCATGG GCCGCCCCGC TCGAAGGCAC      8760
     GGGCAATGGG GCGGATGAGC GGGCGGCCTG CGAGAAAGCG TATCAGGCGA CTGCTAGTAA      8820
     TCGTAGGACC GATGAGCTCA GCTTCGAGGC CGGATGGGAA TGCGCTGTCG AATGGGCGCA      8880
     TGCCCGCGCC CCTCGCACTG AGGTGGCGGG AGCGGTGCCG AACCCCACGG GCGACCAACT      8940
     CCGCGCGGCG GTGAGAAGCG TCGGCAGTCT CGGCACGAAC CATGCCGACG CACCGCACGA      9000
     ATATGTGCTC GCAGGCTGGC GCGCGGCGAT GCGTGCTGCC GCACCCTCCG CAGATGCAGC      9060
     GGCAGCGTCG CAGCCCGTCT CGTGCAAGTG CCGTAGGCTT GGAGACTGGG ACGGCGCGCA      9120
     TCACCCGCTT TGCGACGGAG CAGCACCGCA TCCCGCAGCA GCAGCGGGGC AAGAGGCGGT      9180
     GGAACCGGTG GCGACAGGAC ACGGACTTAG CGGCATCCCG CGCGCAGCAT TCGGCCCACA      9240
     TACCGAGGCC GATCGTATCG ACCATTGCGG CGCGTGCGGC GCTGAGAACG CACCTCAGAA      9300
     AGACGACGTG TGCCCGACCT GTGGTGCGAC CTGCTCGCTC GTCTCGACGT GGGGAGGATT      9360
     CCAGCACGAG CGCTATCGGA ACGGCCAGCG CTACGCGAAC AACGGCCCGC AGTGGTGGGA      9420
     AGACGGCCCG CAGCCTGCCG CCCCGACAAC CGCTACTTCC CCGTCTGCCG AAGGATAAGC      9480
     GCACCGCGCC GATGGCCCAA GCTCTCAAGC TGGTTCCTTC GGCCGCAGTG CGGGCAGAAC      9540
     ACGTAGATGC CGAACGAATC GATTCCGATT TTCTCGGCGT CGAAAGCCCA TTCCTTGTGG      9600
     CACTTGATGC ACAGCCAAGT ATTCACGACG ACCTCCGAAG GCCGGAAGGA CAGGAAATGA      9660
     ACGATAGGAC AAACCCGGTG GAAAGCAAGG CCGCGCAGGC AGCGGAACCG GTCACGCAAT      9720
     GGCAATACCG GACGAAGGTT ACGACCGGCG TGTGGTCGCA CTGGCACAAC TGCAAGGAAG      9780
     CTCAGGCGCA GCGGCTCCGT GAACCGGAAT ATGCGACATA CAACCAAGTA CGCGCGCTCT      9840
     ACGACACCCC GCGGCCTACG GCGCAGGCAG ACTATCGAGG CGAAGATGCC TACGTCACGA      9900
     AACGTCTGTC GGAGGCACTG GCCAGCGTCT ACACAACGCT CATCGGCGAC GACAAGGCGG      9960
     ACGTAGACGA GAACATGAAC GCATTCGAGC GCGTCGAGCG GGCCGCTCAG GTGATCCGCC     10020
     TCGAAGTAGA GCTTTATCGC GGACAGGCAG ACGCTCGGGA GGGGCTGACG GCCGACGACG     10080
     TGAGCGAATT GAAGGGCATG ACGAGCGATC CGCGCCTGTT TGAAGCCGAG CGCGAGGCTA     10140
     TCCGAAAGGC TGTTGCCCTT CTCCAAGGAG CCAACCAGTC ATGACCGAAC GCACCGACGC     10200
     CTACGAAGAA GGGCGAGAAG CATATCGACT CGGGTTCAGC GATGCCGACA ACCCGCATCT     10260
     CAACGGCTCG GACGAATCGA TGGATTGGTT TGATGGGTTC AACGATGAAG AACGCGGAGC     10320
     CAACCATGCC GAATAACAAC GTGCTGACGG CTGGCGAGCG CAACGCGATC GAGCGCGCGA     10380
     TCAGCGAGGT CGAATTGTGC TGCCAGTTCT CGCTGGCAAA CGAGTTGCGC GCCCTTCTCG     10440
     CCGCCCATCC GGGCCAGCCG GAGCCACGCG ACGCAATCGC ACGCTCGAAG CGAATCCTCA     10500
     TGCTGGTCGA TGAGTATCAC GATAACCCGA CGAGCGACAC GCGCACGGCC CTTCGCGTCG     10560
     CGCTGATGGA CGAGTTTCAA CCGGAGCCGC GTGCCGAGGT GGCGGAGGAA CAGCCGAGCC     10620
     TCACGAACCC GCTGACGCCT TACGGCATGC TCGTCCGCGC GCTGCGCGTC GCCGCCAAAA     10680
     CGACGCTGAA CGACATGGCG AAGCATATGC AGTGCGGTCC CGCAGCCCTG TCGGCGGTCG     10740
     AATTCGGCCG CAAACCGCTC ACGGACGCGA TGGTTGCTGA TACGGCGGCG TACTTCTCCA     10800
     GCGTCGGTAT CCATGACACG TTACACGCAT TGAACGCCGC CCGCGCAGGA GACGCATCGT     10860
     GAGCAAATAC GGAAAACTCG CCGCGCCGTC GATAACGGAC GGCATCATCC GGACTTCGCG     10920
     CGGGCGCGCC TACGTGCTCA GTGACTGGCC TGACGGCGGC CGGCCGACCG ATCATTTCGA     10980
     TCAAGGTCGG TGGGCGGACT GCCTGCACGC ATGCCTGTTC GCGGCATCGC TGCGCGGAAT     11040
     CCCCGCGGAT ATCGAGGACG ACGGCCCGGT GCACGAACTC TCGCACCTCG TCTGCGGCAT     11100
     CCCGATCTGC ACCCACAACA CGATGGAGAA TCTTCGCGAG CAGGTACACG AGCTGGAGCT     11160
     TTTCGTATCA GACTTCGTAT CGCGCGCCGG GCTGAATCCC GCTCCGGCAG GGAGAGGAGC     11220
     ATGAGCAAGC GATTCGAGTT CGAGCGGTTC GACGTGCGCG GGTGCGCATG CGATGAATGC     11280
     GATACAGGCG TGACGCCCAG CGCAGAGTTC GATGGTGAAT GGGTCAAGGC GCAAGCCGCG     11340
     CTCGACCGCG AGGCCGTATT GCAGGCGCAG ATTCGCACGC TGGAAGTACA GTTGAAAGAG     11400
     ACGCGCGCAC GCGCACTGGA TGAAGCAGCC GCCGCAATCT CGGACCACCG CCGCGCCGGG     11460
     CGCGAATGGG TTCCAGCGAG CTTTTGGGCG AACGTCACGA ACGAGGCAGC CGCGCGCATC     11520
     CGCGCACTGA AGGAGGCGAA GTGAGAGAAC TGGAACCCTG CCCTACCTGC GGTTCGGGCG     11580
     ACGTCGGCGG CGCGAGCGGC ATCGTGCATT GCTATCGGTG CAAGGCTGAA ATGCGCGCCG     11640
     CCACCACGCC GGAAGCAGCC GAGCGCTGGA ACATTCGCGC GGTTTTCATC CGCCACGGGT     11700
     TCATCATCCC GACGGACAGC GAAGCCATCT ATAGGGCTGC GCGCGCGTTG CTTGAACACG     11760
     ACCGCGAGCG GCGCGGCAAT CCGGGCGAGG ATGCCATGCA GACGGCGGCG CGCGACCTTC     11820
     CCGACGGCTA CGAGCTGCGC GTGTGCCTCG AACGCGGCGC GGGATGGGTA GAGTTTTATG     11880
     CGCCGGATGG CGAAGCAGTC GATCTGGCGG ACGATACCGA TGACGGCATG ACCGGGCGCA     11940
     TCCGCAGCGC GACCCAAGCC GCCATCGAGC ACGCAAAGGA GCGGACATGA GCATCGTCTA     12000
     TACCGCCGAC GTGTTTTGTG ATGGCGACGA CTGCTCGCAA TGGACGAACG GCGTAACTGG     12060
     CGTGAAGCCG CCTGAGAAAT GGCGTGCTCG CGAGCGGGCG CAGCACGAAC GGTGGATTCA     12120
     CGTCGGCGGG AAAGACTACT GCCCCGCATG CGCAAAGGTG CGCGGCCTGC TGCCGGTAAA     12180
     GGATGCAGCG CAATGAAGCG TGAGCCGGTC TACGAGGGCG GGCGGCTGAC CGGACACAAT     12240
     GTCCACTACC CGCCCTCATA CATCACCGTG CGCGACATAC GCGGGTACGA ATCGCTGATT     12300
     CAGGTGAGGC CCGCACGGAC GGTTTTCGAA CCGGTCGAGC GCCAGAGCAG CATGTTTGAC     12360
     GACGAGGAGT GACCATGCCG AAAGGACGGC GGATTTACGG CGTGTTCGCC AACACGTCAT     12420
     ACGAGGGCGG CGATATCGTC TGCTCGTTCG ATAGCGAAGA CGACGCCAAG GCGTTCGCGC     12480
     AGAAGTGCCG CGACTACGAA GAAAAGCGCC CTGCCATGCT CGACGCTGAC GCGACTGACG     12540
     CGGACTGGGA TGCGTACATC AAGCGCAATG CGAACTGGGA GAAGCGGCAC CCCGCGCGCC     12600
     CGTATTTCAT GCGCGATTAC GCCGTTGCTC CATTCCCGCA TCACACGAAG AAGGATTGAA     12660
     TGACCTACAT GGCACGTAAT CAACGCGACA CGCCGCCGCT GAAGGACGGC GAATACTGGG     12720
     CGACCTGTAA AGAGCGCAGC CCGATGGCGG CGATTTTGAA CGGGCATGGC GCAGTCTTCC     12780
     CTCAATCTCG AATGACGGTG CGCGATGGAT GGGCCTATTT CATGAGGGAC GGCAAAGAGG     12840
     TGTGGCGATG CAACGCCCGC TATGCCGCAT TCAATTTCAC GATTCAGGAC GCTTGATGAA     12900
     GAAACCGTAT CTGGTCGAAA TGACCTTCAC GATTGCCGTC ATGGCAAACG ACGAGAATCA     12960
     CGCCGCCGAG GTCGCGGAAG AGCATGCGTG CGAGGCTGTG ACGCATGGTG ACATTCCGCC     13020
     AACCGCCGGC TCGATCGATC TGCTCGACCG GCTAGATAAG CTGCGCGATG GATGGACAGG     13080
     CGACTGCGTG CCCTACGGGG CCGACGACGA CGCAGACTTG AAGATCCTCA TCGCCGAACA     13140
     AACCGGCGGC CCGGCTGGCA CGCTCGACAC TCACACGATT GACATGTTCA AGGAGCAAGT     13200
     AGCGGCATGA AAGTATCCGA AATGAGCGGC GCATCGCTCA ACTACTGGGT TGCTCGCGCG     13260
     GAAGGCGTAG ACCACGCCAT CGCCACGCGC GACGCGATGA ACTACCGCCC ATCGGAAGTC     13320
     TGGTCGCAGG GCGGGCCGAT TATCGATCGC GAGCGGATTA CGGTAAACGC GTGGCAGGAT     13380
     GGGTCCGGCG AATGGACAGC AGACGTTGAG CGCGCAACGG GCCCGATCGC TGCCTACGGC     13440
     GGAAAAACCG CGCTCATCGC CGCGATGCGC GCCTACGTAG CTTCCAAATT CGGCGAGGAG     13500
     GTTCCCGATG CAGGTATCTG AACTGACGGG CGCAATGCTC GATTACTGGG TTGCGCGCGG     13560
     ATGGGAACTG ACGGACCCGG TTATCGGAAG CGATGACGTG TGCCGCGTGC TCGTGAAGCC     13620
     CGCGTTTGAA TCGCAGCCGC GTCGCGTGAA CTACCTGCCG TCGTCCTCGT GGGTGGATGG     13680
     CGGGCCGATC ATTGAACTCG GCCACATATC CGTCCGCTGG ATCGACGATG AGACGCTTTA     13740
     CGGCCAGCCT GTGCCGCCGC ACTGGGTAGC CGAGCACCCG AGCGTCAACT ATGGGATCGA     13800
     GGGCGCTACG GCGCTGGAAG CCGCGATGCG CGTCTACGTC GCCAGCAAGT TCGGCGACAC     13860
     CGTACCCGAC AACGAATAAC CACCGCCCAC CGGGCACAAC CGAGGGAATA CCAATGAGAA     13920
     CGACCATTAC GGCCGCTATG CTGGCCTGTG CCGCGCTGAC CGCGTGCGGG CACCAACCGG     13980
     TAGTCGAGAA CAACGAAATC GGCTACATGA GCCGTCAGGA AGTCTCAGCA GCCATCGCCG     14040
     ACTGCGAGAG CGCCGGGCAG CGCGCGAGCG TGATCTATGC AAAGGCCGAC TGGCGCGGCA     14100
     AAAAGGTTCC GGTGCCGGTC GATGTGCAAT GCGCTCCGCG CGGGCCGGGC AACTATCGTA     14160
     TCGGCCTGCA ACGCGACGAA TAGCCGCCAG CGCGGCATAG CCTTCCGGGC ACTCCCCTGC     14220
     ATAAGGGCAG CGCCATTCTT TATTATTCGA GCGCGGTTTT CACGAGCACG GCGAGGCGCA     14280
     GATATTCGCC GACCCACTTC GGAAATTTCG AGCGGCCGGA CACCCATCGG CTAACAGTCG     14340
     TAGGATCGAC GCCAAGGCGG CGCGCGAACT CGGCTTGCGA CCACCCGAGC ACGGCGAGGG     14400
     AGTGAGATAA ATCAGAAGCT TTCATGACCG CCATCTTAGC AAATTGCCGA TGTTTTTCCC     14460
     GGCATGTATA GGCATTTCAA TATTTCGCCG TTATACTGGC GACGCTTTCA GGCGAGGCGG     14520
     CTAGGCCATG AGCGCATCAT GGGGACGGGC CGGGCATTTC AATGCGCTGA CGCCCGGCAC     14580
     GTTCGCGTTA TCCGCCTCTC TGAAAGCACT CTCAGAACGG CCGTAGCTCA GTCAGGTAGA     14640
     GCGCCCCTCG TATGGGGAGC GGAGCACGCA CACGGGAGCA CCCGTGCTGC TATCTCCGGG     14700
     TATCGGCCGG TACGCGCGTA GGTTCGAATC CTGCCGGCCG TTCTGAGGGT GAATGCGCAG     14760
     GCTGATGCGC GCGCAACGGA TTAGTGCTCA GGGCTTCATA TTCGCCGGCC GTCGGCCGGA     14820
     GGTTCGGACC TAGCCCGCCC GAGGTATCCG CCCCGTGTGG TATTGGAAAT CTAGATAAGG     14880
     AATGCCGGGA TCAGCTCCGG CCACTCTCAC ATCTTCACGC ATGGCGATTG CCCGTAGGTG     14940
     CGAGCGCGCG GAGCACGGCG CGCAGGGCCG AACGCAAGTC GCCATGCTTG AGGGTGAATG     15000
     CACGGGCTGA CGTGCGGCGG ATGGAAGCGA ACCGGCGGCG ACGAATGTCC TAGGCTGTAC     15060
     CGCGCGCGAG CGCGAGCGAA GCGGCTACGA TAAAAAATCA CCGCGCCCCT ATGCCGGAAG     15120
     AATTCAGCAC CGGCCACCCT CGACGATCCG CATCCGTCGG AATCAATCCG AGCCGCATAC     15180
     ACTCCTCCCC CTCCCGCCAC TTCACAATCG CGCTTGCTCG GTTGTGCCAT CCCGCTTCAC     15240
     GGGGTAAATT CGTCAGACGG AAACAGCGGA GCGTCCCGAA TGGCCTCTGT GACAATCGAA     15300
     TTAGGATCTG GAAAGCGCGC GACGCTGACC CGCGCGAGCG GTTCCGCCGG CGCGAACCTG     15360
     TCGGCCGGTC AACGCAGCGA CGTATCCGAA TTGATGCTGC ACTGGCCGAA GTACGAGGGC     15420
     CTGACGGCGA ACGCGCGGGA ATACCTGCGC CAACTGGGCC TAGACGCGCT CCAAGGCGCG     15480
     CCGCTCGATG CGCTCAGGTC CGCCATCGAA GAAGGTCGCG TTGCGGTCGA AATCAGCCGC     15540
     CATGTGGTCG GCGGCGGCGC GTCTGGTGGT CAGCCCTCAA CCCCACCTTT CCCGCGGGCC     15600
     AGCAGGCTCG CCAGCGTGCC GGGAGTGGCC TCGCTGCCGG TGGACAAGCC TCTCCCAAGT     15660
     TGGGCCACGC CGAGCGACGT GTCGGCAGGC GAACTGATAA GCTATTTGGA GAGCGTCGTA     15720
     GGCGGGGCTG GCGCTACCCT TGCCGATTCC GCGTCCGGGC TGGTTGACGG CACGCCGCTC     15780
     GGCGACGCTG CACCGTTCTC GCTGGATGAT TCGCCACTGG GTGACGTACT AAACGTGGCG     15840
     GCCGTGGACC CGTTCCAAGA AGAACAGTGC TTCGCGCGAT ACGAAATCGA CATGGAAATG     15900
     TGCGCGGCGG CCGGCGCAAT GTACAAAGAC CCACGGACCT ACGCGCTATG CTCGCAGCGG     15960
     GCCTTCGACA AATACCAGAC TTGCAGAGGA ATGTGACATG AGCAAACCGC AACGCGCGAC     16020
     CATCGTGTTC TACGACGAGG ACACCGAACA GGTGACGCTG TGCACCGTGT TCCGCAAGGA     16080
     CGTACAGGCC GTCCTCGACC GCGAACTAAA TGCAGGCGTC GCCATCACGA TCCCGCCGCA     16140
     CGCCGAGCCG AACGACGGGT GCGAGATTAC CGACGAGGAC GCGCGCCGAC TCGGCGGTAT     16200
     GGCGCTGCTG ATGCAGGCGG GCGCACACCC CGAATTGCGC GACCGGCTGA AGTTCGCCGA     16260
     AGCTGGTTCC GTTGACTGGT CGCCCGTCCG CCGCCCTGAC GCCTGACACT ACCCGCTACC     16320
     CGCGCCGCCT AGGACGGCGA TTCAACCTTC TGCGCCGCTG CGCGCACGCG CTTTACGGTC     16380
     GCCGGGCTGC ACCCGGCAAG GCGGGCTGCG TCAGAAACAC CGTGGCCGCC GGCCAACAGC     16440
     GCCAGCACAC GCCGATGCAC CGCTTCGTCC GGCTTACGGC CGGCGTAGCG CCCGTCCCGC     16500
     TTCGCAATCG CAATGCCCTG CCGCTGGCGC TCGCGCCGAT CCTCGTAGTC ATCGCGCGCC     16560
     GCCTGCAGGG CGACCTTCAG CAGCATGTCC TGCACCGATT CGAGCACGAC CTTAGCGACG     16620
     CCGCGCGCAT CGGCCGCTAG GTCGGTCAGG TCGACGATGC CCGGCACGGC GAGGCGCGCG     16680
     CCCTTCTCCC GGATCGACGC GACAAGGCGC TCGGCATCAG CCAGAGGCAG GCGGCTGATG     16740
     CGGTCGATCT TCTCCGCGAT GACCACCTCG CCCGGCTGGA GGTCCGCGAT CATGCGTTGC     16800
     AGTTCGGGAC GATCAACGCT CGCGCCTGAA GCCTTCTCGC GGTACACGCC CGCGACGTAG     16860
     TAGCCGGCGG CGCGCGCGCC CTCTACGATG CCTTCCTGCC GCTCGATATC CTGCTGCTCG     16920
     GTGCTAACGC GCAGGTAGAC GCGTGCGACT TTCATTCCAA GTCCTCCTTC ATCGCATCAA     16980
     GCTTGCCAAT CTCGTCATCC ACCCAACCCT GATACCGGGC AACCTCTGCT TTCAGCTCCG     17040
     CAAGGCCATC ATTGCCGTCG TCGGAACTTA GGGCATCCAT CGCCATCGAC ATGCCGACCC     17100
     CATGTAAGCG GAAGTTCTCC AGAATCCGCC TGCGATTGCG CATGAAGTGC AGCTTGAATT     17160
     CATCGAGCAT CGGCACCTTC ATGTCGATAG CATCGCGATT CAACTGCATA ACCATGCGGA     17220
     GCGTTTCAAC TTCAACCTTG ATCGTCATGG AATCCTCGCG CTATCAACGC TTATCGGCGC     17280
     GGGCCTGCTC GACGTCCTCG GCCGTTTCGC CGATCAGGAC GTAGGCAACC GGCCCGCGCG     17340
     CCGAGCCGGG CGAACGGAAG AAAGACGCGC ACGACAGGCC AAGCGCTTCG GCATCGCGCA     17400
     TCAATTGGGT GATCCTTTCC CGCAGAGCGT CGAACGGTTC GCGCTCGCGT AGCTCGCCAG     17460
     CGTCCAGCGT GCCGCCTACC CATTCCTCCC CGGCACCGAG CGCGGCGGCG TGGGCTTCGC     17520
     TATCGAGATA CGCAGCCCAA GCATCGACCG CCTTCCCTGT ATCGCCCGCA CGCTTCATCC     17580
     ACTCTGCTCG ATCGGACTCG GCCAATCCGT TCCACCAGTA CATGCCGGCA TGGGGATCGC     17640
     GATGCGGATC GGCAGGGAAC GCGCCGCCGC CCATCTCGAT ACCGTCGCGA TAGAACTTGA     17700
     CGTTCCAACC GCCACCGGCC TTCTCCAGCC GCTTTGACAC TTCGAAAGTT TGCTCCGACA     17760
     TACTGGCTCC TCGCGGGTCG GTTCATTTGG GTACACCTTA ATGAGCGACT ATGACACGAC     17820
     CGGCTCAAAA TGAAAAGCCC GACTCAAATG AGCCGGGCCT TTTTGAACCA TCCATGTGAG     17880
     CTATCGAGCG CCGCGCTGCT GTGCCTTGAT GCGCGTGTTG ATGTGGGCGT TATTGCGACG     17940
     CTCTCGCCAC CTGTTCTCGC GCCGCAAGTG CGCGACCTCG CTTTCCCGCT CGTAGTCGTA     18000
     GTCGCGCGCC TCTACCTTGA CCGGCTCGGC GTACCTCTCG CGCACGCGCC CGAAGTCATC     18060
     CGCAGTCACG ATGACCGAGC CATCGGCCAG ACTGCGTGCG ATGGCAGCGC CAAGTGCGGC     18120
     CGGACCGAGA ACGATCAGCG TGCGTGTCGT CATGGTCGCG CCCTCATCAC GCCTGCGCGG     18180
     CGAATTGCTG CGAAGCCGCC AGCAAGTCGG CACTCGACAA TTCCGCATTG GCGTCCTGTC     18240
     GCCCGCACGC GGTCGACTCG CTCGCGCCGC CCAGTTGCGC GACCATCGAG CCGTGATGCG     18300
     CAGCAAGCGC TCCATACTCC GCCTGCGCCT TGGCAATCAG GCCGCGCAGG TCGCTGACAG     18360
     CGCGGTTGCG CGACTCGCGC CCCGCCAGAA AAGCCAGCGC GGCGAGGCAG ACGAGAAAGC     18420
     CGAGCACGAG CAGCGCGTCA GGAACCGCCC ATGAATGCGC CTCGTGATAC GAGCCGATAT     18480
     CGCGCCATGC GAACCATGCG AAGAACGCGA GCACGGCCAT AAGCACGGTG CGCCAGCACA     18540
     GCAACATGCC GCAGATGCGC CCGAGCGCGC CGAGCTTGCC GCGAATGTGC TCGTCAGCCT     18600
     CCGCGCTGCG ATAGGTGCGC GCCACGTTGT ACACGAACGC GGCAGCGACT GCCGACCAAA     18660
     AGCCCACCAT CGTCAGCTTG CCGCCGAGCG TGTCGAACAG CCAGCGCGAG CCGAGCGCGA     18720
     TGGCCTCGAC CATTGCGAGA GTGACGCCGA TGGTGAGCGC CCAGTACGTC GAGTGATTGA     18780
     ACAGTTTGCG CATATGGTTC TCCGTTGAAT TTAAGCGCCT AGACGGGCCT CTGGCGGATG     18840
     CCGCGACCTT ACCCCTTGTT ATGCAGCAGC GGCCCGCGCA GGCAGCGACA GGCGGCCCGA     18900
     GTAGCGGCGA ATGAGAACCG CGGTCAGGAT GACGCCACCA GCCAGCGCGA ACGCCACGAG     18960
     TCCAATCACG AGCATCACGA TTGCGCCGCC GTCGTCGTCT TTGCTATCGG ACTTGAACAG     19020
     GTCGCCCACA ACGGAGAACG CCTCGCCGAT TCCGCTGACC GCGTCGACCA TGTTCTTGAC     19080
     CTGCGCGAAC GTGTTGTATG CGGCAATGCC CATGTCCAGA ATGCGACGCG TGCGGAACGC     19140
     GACAATCCAC GACTGGATCG TGAGCACGAG GCCCGTTCCG ATGGCCGGGA CAATCACGAC     19200
     CAGATACCAG AGCGAGGCCG CCGAGCGCGC TGCCGCTGGC GGCAGATGCC CGGTTGCGTA     19260
     TAGCGCATAG CCCGCGACGA AGCCAATCAC GCTGCTGAAG CCAATCGCGG ACTGCGCCGC     19320
     GGCGCACCAC GCCACGAGAC GAATCCATCC GCCCAAAGCC TTCGATTCCT GCCAGATGCC     19380
     GCCGACCGAC CAACAGTTGA GCCAGCTAAT GCCGAAGTTC AACGCGAGTA CCAATGCAAA     19440
     GCCCATCATT CCGCCTCTCC CTTGTTTGCC ACTGCCACGT CTTTTTGCTC CGCCTGCCGG     19500
     ATCAGTTCGC CGAGAAAGGC CGTAAGCCGC TGCTCGAATC CGAAGTTGCC GGAATGCAGC     19560
     ACGTCCATTT GCGCCATCGC TTTGAGTTTC AGCGCATCAG CCTTCCCGAT TTGCTCACGT     19620
     ACAGTCTTTA GTCGCTCCTC CGCGGCCTTG ACGGCCTGCT CAAGATCGGC CTGTTCCTCG     19680
     CGCAGGGCGT TCGCACGGCG CACATGCGCG AGCACGCCCG CGATGCCCTC CTTGTTCGGG     19740
     CGGCCGCTCA CGATTGCGTC TCCGCTACCA GCGGTCGATT GCCAGCCTCA AGCGCACGCA     19800
     CCTTCCCGGC CGCATCGTCC TGCGCACCGA CGGCGATCCC CATGCGCGCA CCCATCAGCC     19860
     GCACGTTGTC CCAAAACGCG CGCGCCGCCT CATCGGGCGT CACATCGTCG CCCAGCTCCA     19920
     CGCGACCGTC TGCGCGAATC GAAAACAGCA CGCGAGGTTG CTCCGCCACT GCACGAATGA     19980
     CCAGAGACGG TTTGAGCGCA TCAGCATTGG CGATTGAGAG CGCACCGCGC TGATACCAGC     20040
     GGAGAGGCGT AGCGTCGGAT TCGCCGCACT CAGCGGGTGC GTCCGGCACA TCGACGACGC     20100
     GCTTTTCGCC CTCCATCCAG CTATCCTCCA TGTTGATCGG CTCCGGGCCG GACACGCACA     20160
     CGGCGCGCTC CTTCACGTCC GACCAGTTCA TGTTGTTCGA CGCCCATTCG GCAGCCTCGG     20220
     ACGGGTCTTT CTCGAACTGC GCAAGAATCC CGCTCAGTGC CGCGTCAGCG TCGCCGCCGA     20280
     AGTCGATTGG CGCGTAGTAG TCGGCGCAGT TGCGCGCGAT GACCTCGACC GGGATATTCC     20340
     ACTTGCTGCC GTCGAGCGCA GTCAGTTGCA GCACTTTCAT GCCTCACCTC CCACCGACAG     20400
     ATGGCGCGGA ATCGGACGCT GGCTCTCGCG CGCCGCGTGC GCCGCATCCA ATGCGCCGTC     20460
     GAGCGTCGAG CATTCGCCCC TCGCCTCCGG CACGTCGGGG AAAGTGACGG TCCAGCGTTT     20520
     GGTGCGCGGG CACTGACGGC CACGCGGCTT GATGACGGTC TTGCGAATCA GGTGCATGTC     20580
     TATGGTTCCG ATGAGTTACT GCTGGTTCTT GGCGGCGCGG TAATCGCGCA TCCGTTTCTT     20640
     GATGGCCTCC GCGTTCTCCT CGTAGTACTT CTTTTTCTTC GCGAGGATTT CCGCGGCGTG     20700
     CCGCTGGTAA TGCCGTTTCA CTGATGCTGC GATGGCGGCG CGCCGCGCGG CCGGGTCCGT     20760
     CTGCATGGCC TTCTTGTAGC TCGCATACGC GCGCCGCCGC TCGCACTCCA CGCACCTACG     20820
     GCTTTTTGTG TTGCGCTCCG CTATGTGCCC GTTACGGCAC GCCTCGCCAG TGAAGTAGCG     20880
     TGTAAGGCCC TGCTCTGCTG CCTGTTCCCG AGTGATGATT GTCGGGGGCG GTTCCTGCAT     20940
     CGAATCCATT GCGTTTTCCT AAGCGGTAAG TCCCATTGAC GCGAGCAGGG CTTGCCGCGC     21000
     GATTTCCTTT TGGTCGCCCG CATCGACGAC GGTTTCCTCG GCGAGGGAGT AATGCGCGTC     21060
     CTCCAGAAAG GCGAACGAGA GCGCATCGAA CACGTCAGGC GACGGGAGGT TTTCTTTCTC     21120
     GCGCATGTCC TCCTTTTTCA TGATCTGGCG GCGCGCCTTC TCGTCCCAAA AATAAGGAAT     21180
     TCGCGATCCC TGCTTGACGA GCTTTTTGAC GAACGACTTC GGCACGTCGG GATTGATGCC     21240
     GAAGCGGCCC TCGGTAATGG CGCGAGCGAA GCCGCAGCAC GCCTGCGCGC GCTGGTTCAC     21300
     GTAGCGGTCC TTGTATTCCT TGGCGAAGTT GGGATTGCCC CAGTTCACCT TGCGGTATTG     21360
     GCTGAAGCCG TCGAGGTCAA GCTGTTTGCA GACGATCAGG CCCATACCGC CCGCGTCGAT     21420
     CATGGCCGTT GCATTGCTGC GCTCGCGCGC GGCATGAACG ATGACGCCGT GCAGCTGCGC     21480
     CGGGTCTTGC GTGTTGGAGT GCAGCGGCAC GCTGATAAGC TGCGCGCGCC GTGCGTCCAT     21540
     CCCGTACTCG CCGCGGCCGA TGACGTGCAG CGCAGGCATA ACCGTTTCGT CGCGCCATCC     21600
     GCCGCCGCCC ACGTCCACCG GGAGCAACCA GCCCCAGTGC TCGTCCGGCT TGATGACCGT     21660
     GCGCCCGACG CATGCCTCGA TGGCCTGCGG CCCCACAAGG TACTTCGACG AGTTCTCCGG     21720
     GAACCGGCCC TGCACCTTGA TCTGATACTC CTCCTCCGTG TATTGCAGCT TCTTTTCGGC     21780
     GATGAACTTG GCCGAAACGA TGGGTGAGAA TTCGGAGTTG AATACGAGGT TGTTCCACGG     21840
     CCCGCCCTCT GCGCGCGAGA GGGCGTGGTG TGTTTCGTAA AAGAAGCCGC TTGAGCGCGT     21900
     CGGCTGCGAC GCCAGACACA TGCGGTTGCG CTCGTCGGTC AGCGAGCCGG TGATAACGCC     21960
     GAAGTTGTCG TCTGGAATGC CCGACGCCTC GTCCGCGAGC CACAGAAGCC AGTCACGGTG     22020
     CGCGCCCGCG AGGTTTTCCG GGCTGCCGCG CGGCGCGGAC TTGGCGATGA CGAACCAGTT     22080
     CAGCTTGTAG CCGCGCACAT ATACGCGCTC GGACTCGATG ACGAAGTACT CCCATATCCA     22140
     CGACTGCGGG CCGTTCGATA TCTTCGTCGA GAGGTCGGCG AATTCTTTCC ACACGCCATC     22200
     CGACACGGTC GAGATTTTCG GCGCGGTCAG GATCGTGTTG GAGAGGTAGT AGCAGAGCAG     22260
     GTGCCACAAG GCGATGATGG CAAAGCCGGA CGTTTTGCCC GTGCCGTGAC CGGACGATAC     22320
     GGACGTGCGC GAGCCTTGCT TGCTCACGCT GTCAAACATC TGGATCTGAT GATGCGTCGG     22380
     CGCTTTCAGC CCGCATACCT CGATGGCAAA GCGCGTGCAG TCATCCGCAT ACCGCTCGAC     22440
     GAACGAGAGG TAGCGCGGGT CTTGCAGCAG CGTGCGCCTA CTCGCCATTA CGCGCCCACT     22500
     CCGCCGTTTT CCATGCCCTC AACGCCTGCT GCTGCGGCGC GGGCCTTCGC CTCCTCCTCC     22560
     GCCTGCTTGG AACGCTCGCG CGCCTTTTCA TAGATCGCGT CGAGGTCGGT CGTGTTGACC     22620
     GCCGTAATGG TTTGATCCAC GACCTGCTCG ATTTGGTCGC GCCAGCCGAT CAGGTTCTTC     22680
     GTCGCGAGCG TGGCGAAACG GGACTCGTAA GCGCCCGCCA TACCGCCCTC CTGAAGCAAT     22740
     GCAGCTTGGA GGTCGCGCGC GCGCGCGTAG GCGTAAGAAA ATTCCGGGTG CCGAAGGGTG     22800
     GGGCCATCCG GTGTATCTAC CGTCGCGTGT GCCCAGTCGT AAAGCGTCTG GCGGGTCACG     22860
     TCGATGGAGT CGGCGAATCG TTCGAGCGTC GGGAAGGTGT TGAGCACCTT GACCATTTCG     22920
     GTTTTGGTGC CGCCCTCGCT CGACGGATCA GGCACAACCA CCGCCTCAGT GCGCTCTACC     22980
     TCAATACGGA AGAACGCAAT CAGGGCGTCG CAGAACTCAG GGCGGTAGAC AGACGGGCGA     23040
     CCGACCGGGC GCTTTACCTC CGGCGTGGCG ACCGTATCGG GCGCTTTAGG TAGCAACTTC     23100
     CCATCGGCGG CTACCTTTCC ATTGGACGGA GCCTTGTCGG CCTTTCTGGC GGGTTTCTTG     23160
     GCCGCGGGTG CGCCCTTGGC TTGCGGCTTG TCGGCCGGGG CCTTGCGCGC GACCTTGCGC     23220
     GGCGCTTTGC CCGGCTCGTG AATGGTCGAG CCACCGGGGC CGCGAACCTC GACCGTCTGC     23280
     CCCTTGGCGT TCGCCTGCGC GATTTCCTCT TTCTGCGCGG TCGTCTTGCC TGCGCGCCGC     23340
     CCGGAAGCCG CGACCGGCGC TTTACTGCGT GTTGCCATTT CGTTTCCTTA GAAAGCCATC     23400
     TTGAATTGCG CGTGGCGCTC GGACAGGTAC GTGATTGCGG GCATGCGGCC CTGCTTCACG     23460
     TCGTCGATGT ACGCCTCTAC GTTCTGGAAG TGCCTGAGCT TGTCGCGGAT CGGCTCGGCG     23520
     AATGCGGATA GCTGCTCTAC GGCGGCGAGC ACCGGCGCGC TGCCGGGCAC GTCATCGAAT     23580
     CCAAATCGGT CGCGCATGAC GGACACGGCT TGATCGACGC GCTCGACGGC CGTGAGCATC     23640
     CGCTGGTATT CGCTGGCGAC GGGATGCGCC TGTTCCGTGT ACTTGACGAT GGCGGTCGTG     23700
     AGGATGGATG CGATGCCCTG CCCTATGTCC TCGATGCCGC GCGCCATCGC GTGCTCGTGC     23760
     GCCACGCGGG CGGACTCATC AACGTGCGGC GTGAGGCCGA GCAGGAAGTC GACCGAGCAC     23820
     GAATAGACGC GCGCGCAATC CATGAGGAAG CGATAGCTGT CGGGCGTCTT GCGCTCGCCG     23880
     GACTCGATCA GGCTCAGCTG CGTGCTGTTC GCGTAACCGA GCTTCTGCGC GGCCTCAACG     23940
     GCGGTCAGCC CTGCCATGAC GCGCGCAACG ATCAGGTTGT AGCGGAGCTT TTCAAGGTCG     24000
     TCCGGCTTGC GTGGGTCGCG CTTGAAGCGC CGGAGCGATT CACGAACGAG CTTGTCGCGC     24060
     TGCCCTTCCG TCATTTCCGG CTTCTTCCGG CTCGCGCTCG TGCCGTAGCC CTTGGGGAGA     24120
     TTTTTGGAAA CTTTCATGAG CAGAATCCCA GTACGCGATT GATGACTTGG TCGAGGTCCG     24180
     CCCGCGTGTA GCGCGTGAGA ACCTTTTGCA GCAGGACATT CGCGACGGCG TTGTAAAGCC     24240
     GCTCGAACTC GTCCTGTTTC ATGGAGGCGA AGCTGATGCT TTGTGCGCGC AGGCGCACGC     24300
     TGCCGTGCAG GTTGGTCGTG ACGACGTAGA ACCCGGCCGC GATGGTCACG TCCTCGCGGA     24360
     AGTGCTCGAA GTCCTTTTGA ACCTCGAAGC CCTTGTATTC GAGAATGGGC GGCTCCCACG     24420
     ACTCGAAACC GAGCGTGAGC AGCGCGAAGA ACTTGCGGTG AAAGCGCGGA TTGCGGACCT     24480
     GCTTGACCTC GCATCGAATG AGCGTGTCGG TCGCATAGCG CTTGAGCAGG TCGGCTTGAG     24540
     CCTCGTCGAG CGGGCGCAAC GTCCCGTCCG CGGCCTTGGT GAGCAGTATT TCCACGGCTC     24600
     AGACCTCGCG GATGATGATG TTGTGGACAG ACTTCATGAG GTGCTTCTTG TCGCGGTAGG     24660
     AGCGCGTGCG AAAGCCCTTG GCGTCCTCGA CGACCTGCTC GCCGGTTGCG CCCTCGACAT     24720
     AGGCGAAGTC AGCGATGTAG CGCAGCGCGG GCTTCTTCCG CGCCTCACCG ATATCGACTG     24780
     CGGGCGCGAG CACGAACACG ACCTGCAAGC GCAGGTCACG GATCAGGCCC GCCAGTTCCA     24840
     TGCGGCGCAA TTCCTGATAG CGCGCCGCCT CGCGCTTGGA GTCGAATTTG ATGGTGCCGA     24900
     CGTAGGTAGG CTTGGCGTTG TACTTGCCGC GGCGCGCGGG CACGTCGTCG GCAGGCTCGG     24960
     CGGGCGCAAC CGCACCACCG GCAACCGTCG TCGAGGTTGC GCCCGGCCGG TTCGCGAGAT     25020
     ACGCGGCAAG CTGCGCCGCG GACCAGCGAA CCACGCCTTT CGAGCCTTTC TTTTTCCCGC     25080
     CTTTCGCCAT CCACGAACCC CAAATGAAAT ATCTATTTGT TGCCGTGGAT TATATAGAGA     25140
     CTTCTATTTC AGGTGGCGAA TTTTTTGTTT AGGAGAATGA GAATTTCCGC CCCTCGCTCA     25200
     GGCGACAAAC CGGCCTTGAC GAGGATCATC GCCGGGTCAT CCGTTGGATG CGAGCAAAGC     25260
     ACGTCATCAA GCGCAGACTC AAGCGCAGCA AGGCGCTTGC GCTCCTCGTC GGCGGCGTTG     25320
     GTGTTGAATC GTCGGTCGTA AAACGTCAGC GTCGATTCGA GCTTGGCAAT GCGCTCGCGC     25380
     AATAGTCGTT CTCGGTTATC GTCCATTTAT AGAAATCTCT ATATTTCAGA GTAAAAATAA     25440
     AGCGCTGATT GAGCGCCGGT CATTGGCTTT TACGCGCCGC CATATAGGCA ATTCGCCGAT     25500
     GGTATTCCGC GGCGATATCG GCTTTCAGCT TTTCGGCCGC CTCGATTCCC TGCTCGGCGC     25560
     GCACCTTATT CATGGCCGCC ACGCGATGCG GTTTCGGGCT GTTCGCGAGC ATGCGCACGG     25620
     TGCAGCATCG GTTCTGTTTC CAGTAGAGGC CAGAGAACGT CTGGCAGCGC TCGCACGGGG     25680
     CCGCGTCGCT CACGCTGATA CCTCGCCTGT CAGTCGTGCG TCGCGCTCGA TGCCATCGAC     25740
     AGGCGGCGGC TCGTCGCGGC GGCGCAATTG ATATTCGAGC GCCGAGCGGC GTGCACCATC     25800
     CTCGAACTCG ATGCCATAGA ACGTGCCGTG CTCGTAGCCC ATCGCGACCG GGTCAACCGA     25860
     TACGTCGCGG TACTGCATCA CGAGGCATTC CATGCCGTTA CGCTCCGGCT CGTGCCGGGC     25920
     CTTTTGAAAG ATCAGGATTT CGCCAATAGC GTACTTGCGG GTCATGCTGC GGCCCTCGGC     25980
     GCGTTGGCAT AGGGCGATGG CGCAAACGTG AACCCGGCGC GGCGCGCCAG TTCAATGCAA     26040
     TCCTCTCGGC GCAATGCACG GTCGGCAAGC ACGCTTGCAA ACGAGCGCGA TGGGAACGCC     26100
     GATTGAATGT CCGCGTGCGC GCGCTGCTCC TCGACCGGCA CGCCCCATAC ATGCACGTCG     26160
     CCCGGCATGT CGAAAGAGAG CCATTTCGCC GACGAGGCGG AAATGACCGG AACGCCGAGA     26220
     TAGCGCGCCG CCTGCTCGAT GAACTCATCC CCGAAAAGGC GATGCGCGAC GACGACGAGC     26280
     GGCAGCGGAT TCGCTTGCGC ATCGTTCTCG CGTATGGCGA GCTTCGCGGC AACGAGGGCG     26340
     CAAGGGTCGA TAGCCAGCCA GCAAACAATG CGGCGATGGT TCATGGTGCG GCTCCTTATT     26400
     TGTGGCTGAT GGGGGTCATT TCCCCGCAGT GTCGGCACTT GGTCCGACTG CGCTCGGCGA     26460
     GGCGCTTCAT TTCCTCCTGA TACCGCGCAA AGTGCGCGTG CCATCGGTTC TCCTTCTGCA     26520
     CGAGCTGCTT GAGCACCCAC ATGGGGTTGA GCTTCTGCTT GCACCTCCCG CATGTGACCT     26580
     CTGCGAGCGT GTCATCCACG AGAAACGGAC CGTTGAAGTG CTGACACTCG GCGACCGGCG     26640
     CGACGAGATA GCGCTCCTCT GGAACAGGTG CCTTGAACGG CGTCCTGAGC TTGACGACGT     26700
     TGTCGACCTC CTCATCGAGC TTGATAGGCG GCAGGATCAT GCGGGCGCTC CTCCAAAGGA     26760
     CTGTTTTTTG AGCAGGTCTT TCACGCCAGC CATTGCCGAG CGTGATGCGT CGGACGGGCC     26820
     GGTACGCGGC GCATCCGCGG GCGGCACGGG GCCAGGTACA GGGATGGGGT CGAGCGGGGT     26880
     GACGGCTTGC GGGCGCGGAA CGGGCGGCGC GCCGCCGTTT TCGATGGCAG CCTGAATGCG     26940
     AGCGTGCCAC GCATCGCGGC TCTCGCTCGG GTGCGCGCGC CCCACGCCGA CCTCATTGGC     27000
     CTTGGCAAGC GCCGCCTCGT CAGACGCACG CCAGTTTCCG CCGCCAGCCC CGCCCTTGCG     27060
     CGCGGCGCGC ATCGGTCCGG CATTGCGCAC CCAGTTTCGC CATGTCGCAG GCCAGTCAGT     27120
     TTTCGTCGCA TCCTTGCCGG ACTTCGCGGT CCAGTAATCG CGGAACTTCT CGGCCTCGAA     27180
     AATCACATGC TGGATCGACC ATGCGCCGCC AGCCCACTCG TCAAGGTTTG CCGCGTAGGT     27240
     TTCGGTCACT GCGACGGTTC GCTGAATCGC TTCGGCAGAC AGTTCCCAGT CTTTCGTCAG     27300
     GCGCGTGCCG CGCCCACTAT CTGCTTTCTT ATTTGCGTTT ACATCTGTAG TGGTTAGAGA     27360
     TGCGGCGGAA TCGCCCCCTG CATTTGGCGA TTTCGCCACA TGAGCATTTG CACTTTTGCC     27420
     CTTTCCATTT TGCGATTTCG CCAATTCGGG AACGTCCTGC AAAAAGGCTT CTTCGTCCAC     27480
     GAATGCATAC CAAAGCGTGC GATCCGTCGC GCGCTCGTTG AAATTACCGG ACTGTATGAC     27540
     GCCTTGCTTC ATGAGGCTCG CGAGCGTGCG ACGGATGCGG TCGCGCGACA GGTACGGGAA     27600
     CTGTTCCGAG AACGCATTGA TGGAGTTGTA GGACCATGTG CGGTCCTCCC GAAAGTTCTC     27660
     ACCGTTCGCC CGATTGCGCA CGATCCAGAA TTTCAGGTTA TTGATGAGCA CGGCCTCCTC     27720
     CAGACCGTAG AGGCGCGCGT GCTCTGTGTC GAACATGTGA TGCACTAGCG CCCTCCGAAC     27780
     GGGCGGGATT GCAGGCGGTT TGCAGACTGG AGCTTGCGCT TGCGCTTGGG CCAGCGGCTT     27840
     TCAGTGGTGG TGCGTGTGCT CATGCTCGTT CCTGTTGCCA TCGGGCGCGA GGCCGGGCGC     27900
     GGTTTGCGCT CCTCGCGTGC TCGCTCCTCG AGTGGCGTTA CCTTTTTGAC GATCGCGCGC     27960
     GCGGCAGCGG CCGTCATCTT CTTTTCGATG GGCTTGTGTG CCGTGACGGG CTTGCGCGCA     28020
     AGCTGCTCGT CGGTCGGCCA CAGGCCCTTG TCTTTCAACT TCTGCGCGGA CTCCGCGCGT     28080
     GCGAGCAATT CCGCCTCGCG CACCTGTTCG AGCGCCAGAT GCGCCGGGCG CTTCGCCTGA     28140
     CCGTCCAAAA CCATGTGGCA GGAGTAGCAG GCGTAGCAGC CGATATGGTC GTAACGCAGC     28200
     AGCTTTTTGC CCTTGGCCTT ACCGCCCTCA ACGTCATTTC CATGCGCCCA TACCGTCGTT     28260
     TCAGGGTCGC GGTTGCAGAC TCCGGGCAAA CGCAGGGCGC AAGTCTCCCC GCGTGCCGAA     28320
     TCGGTGATTT TCGACACGTT GCTTTCTCTC GAATGGGATG GGAAGGGTTA CGACTTGGGC     28380
     TTGGCGATTT CCCGGATGCA GCGGGCGCAC TTGCCGTAGC GCTTAAGGTC GATGGCGGTT     28440
     GCGACCTTGC CGCATCCGCA ACGCCTACGC TTGTGGGTGT AAACGGTCGA TTTCGACGTT     28500
     TCCTCGCGAT ACATCGCGAT GGCGTTCGGA TGCGACGAGG CGATCATTGC AGGGCGGACC     28560
     GGCGTGCGTG TTTGCGAGCT TTTTTCGTCG CCGGATAGCG GCGCGCAAGC CAGACTTGGC     28620
     CCTCCGGCAG CACGAGCACT TCAGACGTGC CCGCGTCGGA CATGACGACC GTGAGGTATT     28680
     CACAGTCGCG GTAGTGTTGG TACGGCATTC CGTCGGCCAT CAGCAAGCCG TCGTCGATCA     28740
     TGGTTTCACG CAAGTCCGCG TGACCCAAGG TCGCACCGAT TTTCTCGATG GTGTAGCAGG     28800
     TCGATACGTC CACCACGCGC GCGCGGCTCG TGAGCGGGCG TGCAATGGTG CGGTGATACG     28860
     TGCGCTGGCC AATGGCCGCG CCGAGCGAAT TGTGGCCGGT AACGCTGTTG ATGCTTTTTA     28920
     TTTGATTCAT CACAGATAAT CCGATAAGTC GTGCTCCCCG AACGGGCACG CGAAACAACT     28980
     TGGTGCGCTG CTACGTGGCC CGTCGCATCA GGCCGCCATC GCCTCCTCTT CGTTCATCAC     29040
     GTCGCCAGCC CTCTGCCTGC GCGTAACCTC GGCGCTCGCC GAAATCAGAT GGCCCGCACC     29100
     AGCTACCTGC ATTTGTGCGG AATGGATTTG ATACGCGCGG CGGATAGCCT GAAGCCCGAC     29160
     CGCATCGAAT CCGAGCGTCT TGCCCGCGCG CTTGCGAAAG TGCGCGCGCA TCAGGGCTTG     29220
     CTGCGCCGCG ATAATGTCCG GCTCGTACTG CTTGCCGAAA TCGAGTTCTT CGGTCGAGCG     29280
     CTCGCACAGC ACGCGCGAGA CGTTCGCCAT GAATCCGAGT TGCCCCAAAT CCTCGGCGTC     29340
     ACCCATACCC TTCGACATGC GGTCAATCGC GACGCCGTAA GCAATGGCGA TATCGCGCTG     29400
     CTGATCGTCG TCGAGCACCA CGTCATAGTT TGCGTTGAGT GCGTTCAGCG TGTGATTGCG     29460
     CTGAATCTTC AGGAAAGAAA TTGCGCGCTG CACTACCGGA GAAAATTTAG GACCACTGTA     29520
     TTTCTTGCGT GGTTTCTTGT TGCCTGCCAT GCCCTTCCCC TTCCTTACTG CACAACCGGG     29580
     ACGCCGTGCT TTGCACACAG CGCCTTGAGG CCATCCACCA TAGCCGCCGA CGTGCGCGGC     29640
     TTCTTCACAT CACCGTGTTC GAGGTAATGC ACATGCGGCT GCGAACAGCC AAGCGCGCTG     29700
     GCTATCTGCT TCTGCGTGAG CTTCGCCTTG GTCCGCAAGG CGCTGATGGT CTTACTTGTG     29760
     TGCATGTTCG GTTACAAGGG TCAGTTGAAA GGCCAATGAA GTATAAACAT ATCTATTGTG     29820
     TCACTCAAGT AACAAAATCG GCATTTCTAT CGTTTGTAGC GATGACGCGC CACGCTTGTA     29880
     TAGAATTTTC GTTCGCTGAC GCCTTTTTTT CTGTCTATAT GCGTGCTATA AGGATGTCTA     29940
     TGTCGCGATA AGCATCCTTA TAAAACAACA TTAGGAAGGA GCCATCCAAT GGCTGCACCA     30000
     GCAGACTCGG TCGGCGCGCG CGTGAGCGCC CGTCGAACCG AGCTAGGTAT CTCTCAGAAA     30060
     GAGCTTGCTC GCCGCGTGGG CCTCACGCAG CCAACAATCT CCGCACTGGA AAAGGGCAAA     30120
     TCCAATACAT CTGGCAGCAT TGCCTCACTC GCCAAGGCGC TTGGCGTGGT GCCCCTGTGG     30180
     CTTGAAACCG GATTGGGCGA CAAGGAACCG GGCGCGCGGG AATACCGGCG TGTACTTGAC     30240
     GACGGAACGC AAACCAGCGT GATTGAATTC GAGGTCACAG TTCTGGCCTC GGATGGCAGT     30300
     TGCGGCGGCG GCGCGCCGGG CCAGACGGTA ATTGCCGACG TGCGGACCAA GGTAGGCCCT     30360
     GTTATCAGGG ATCAACGCTT CTTCGAGCGC ATCGGGGCAA GTCCCGAGCA CGTCTTTGCC     30420
     ATCTTGGGCG ATGGCGATGG CATGGCGCGA TTCATCGAGC ACGGCGACAT GGTCTTTTTC     30480
     AGCAGCGCTG GCTGCGACCG GCTCGTGACA GGCCAAATCT ACGCCTTTGA GACTATCGAC     30540
     GGCCCCCGGA TTAAACGGGT ACATCGGCGC GCTGACGGTC ATGTGATCCT CTCTAACGAT     30600
     AACCCGGACA AGAACCGCTA CCCTGACGAG ATCTACAGCC AAGCCGATGC CGAAGCATTG     30660
     CACTGCTTGG GAGTTTTTCT CTACCGGGAG GGTTGACCTG TAACAATTTG TAAGGCAGCA     30720
     GTATTCCATA TGTCAGACCC GCTTAGGCGG GTCTTTTTTT GCCCACAGAA GCGGACTCCC     30780
     TTCCCTAAAC AGCGCCCAAG TCCGGCCAAA AATAGCAATC CAGCTTTCAT CATACTTAAT     30840
     ACAAAAGAAA GGGCCTGATC GCAAACCCGC GCCACCTTTG AACATTTGTT CGCTATGTGG     30900
     TCGCAATACA CCATTCCATG CAAGCAAATC ATTTCTGATT CCGAAAAAGT CTTTTTTCGT     30960
     GGAAGGGAGC AATCGAAATG CCTGTATAGG CGCGCGGCGC GTTGCGCCTC CGCAACATAG     31020
     GCGTAATCCG CCATCCATCG GCCCCGCTCG CTCCGAAATA TAGATATTTC TATTGCACAG     31080
     AGGGAAAGCA ATCGCTATAG TCTCGACATA GACACTTCTA TATTTGAGGC GTCGCCAACC     31140
     ACCGGGAGCC GGGCCATGAA GTCGTTTCAA GTGATCGTCA AAACCCCCGA TTCGATGACG     31200
     CTGTCCTACC CCGCCATCGG TGCGTGCTCC ATCGACGTGC TCATGGATGC ACTCGAACAG     31260
     CACGGCCTTT GCAAGGTTAC GGTCCGCCCG CTCTAACCCC TCTTTTATGC AGCACAAACC     31320
     CACCACTTTT AGGCCACGCA TAATATGAAC GCACCCACCC CTATCGCTCT GCTCGAACAT     31380
     CCCGCCGCCG AGCCGGCTGT TGTGTCCTCG GTCGATATCG ACGCCATCCT CGAAGGCTCG     31440
     ATTGTTCTAT CGAGCGAGCA GCGCGAAACC CTCAAGATCA GCGAAATCCT CGACGCCGCG     31500
     CCCAAGGGCG AGAAAGGCGA CGCCATCGCG ACCATCACGC CGTTCGCGCT TGGCATGACT     31560
     GGCGAAATGC TCGCGCTGCT GCAAAACACG TATGGCGGCG CAGTGTTCGA CGTGAAAGAC     31620
     CCGGCCGGAA TGAAAGAGGC CAAGGCGACT GTGAGCCGCC TGACCAAGCT GAAAACCAGC     31680
     TTGGAGGAAG CCTATACGGA ATGGAACGCG CCGATTCAGA CCATGACGAA GCTGGCCCGC     31740
     GAGCAGCGCG ACCATGCGAC CGCGGCCATC CTCGCACTGC GCGACCCGAT CAAAGAGCAG     31800
     GTCGACGTTC AGCAAAAAGA ACTCGACCGC ATCAAGAATG AGAAAGCCGT CGCCGAAAGC     31860
     CGCCGCATCG AGACGCATCA GGGCGAACTC ACGAAGCTGC AAAAGCTGCC CGAGCAGTTT     31920
     ATGAGCGCGC CGTCGGCTGA TATCGAGGCG CAAATCCGCG AACTGGATTC GTTCGAATAC     31980
     CTCACGCGCC GCGACTGGGA GGAGTACATG CCCGCGGCAC AAGACGCCGT GCGCGCCGGT     32040
     ATCGAAACGC TCAAGACGCA CCTGACGAAC GCCAAGGCGC GCGAGGAGTT GGCGACGCTT     32100
     CAGGCCAAGG CCGCCGCCGA GCAGGCCGAG CGTGACCGCA CCGCCGCCGC TGAAGCTGCC     32160
     GAGCGCGAGC GCGTCGAGAA GCTGCGCGAG CGCATCAACA ATATCCGCCT CGCGCCGACG     32220
     ACCTGCATCG GCCTGCCCGC AGCGCAGATC GAGCGCACGA TTGGCAAGCT CGACGCCGTC     32280
     GCACTCAACG AGTTCGCGGA GTTCGAGACG GAAGCACGCG AAGCCATCGA AGGCGCGCGC     32340
     TCGAACCTCT CGACGATGCT CGAAGCGGCG AAGGATGCTG AAGAACTGGC GGTGTTCCGC     32400
     GCGCAAAAGC AACGCAACGA GCAGGCTGCA CAGGAGGCCG CAGAACGCGC CGAGCGCGAA     32460
     GCGAAGGAGG CCGCGGAGCG CAAAGAGCGC GAGGCCCGCG AGGAGGCCGA ACGCATCCAG     32520
     CACGAGCGCG ATGAAGCCGC GCGCATCGCC CGCGAGCGCG CCGAAGCGCA CGCCGAATTG     32580
     TTGCTCTCGC TGCTCGTTGA GGCCGCGCCG CACGTCACCG ACATGGACCT GCGCCACCGC     32640
     ATCCACGTCG CCATCGACGC AGCCAAGGGA GAGTAAGCCA TGAACGCACC GACCACACTC     32700
     CCGCCCGAAG TTATTGCGCA GAAGCCGACC GTCGCAGACA TGAACCTGTT CGACGGCGGC     32760
     AACCCGGCGA ACCTTGGCGA AATGTTCGCA GCCCTCGCGC TCGCGCAAGG CGGGTTCGAT     32820
     CCTATCGTCA AAAACCGCGA GGTCACGGTT CAACCGAAAG ACCAATCGAA GCGCGCCTAC     32880
     AAATTCAAGT ACGCGGACCT CGAAGAAATC CGCAGCAAGA CGACGCCGCA CCTGTCGAAA     32940
     AACGGCTTCG CCCTGCTCTC GCTCGTGACG ACGCACACGA CGGGCGGTGT GCATATCCGA     33000
     ACGATCCTCG CGCACAAGAC GGGCGCGCGT ATCGAGTCGG ATATGGACGT GAATCGCATC     33060
     GGCGGCGAAA TCAAGGACTT CGGCGCGACT ATCACGTACC TGCGCCGTTA CGTCGTGAGC     33120
     GCGTTGCTTG GCGTAGCGGC CGATGACGAC CTCGACGAGG ACGGCCAAGA GCCGGGCGCC     33180
     GGTGGCGGAT CGAGCGCGGC CGTCGGCGTT GCCGTCCACA AGGGTCTGAA GGATGCCAAG     33240
     ACGCTCGGAG AACTGGGCAA GATCATGGCG GGCCTGCCGA AAGACGAGAA GGCGAAGTAC     33300
     TCGGCCTATT ACAACCAGCG GCAAGACGAA CTCGAAGCCG AGCAACGGGA CGCGGGCGGC     33360
     AAACCGGCAG GCGGAGACGA TCTGTGATTG TCGTCGAATG CCAACAGGGC ACGCCGGAAT     33420
     GGCTTGCCGC GCGTGCGGGC GTCACCACGG CGAGCAATTA CCGGATCGCC CGCACGCTGG     33480
     CACGCGACGG CCGCACGCCG AGCGATACCG CCCGGCACCT TGCATTTCGG CTCGCCATCG     33540
     AGCGCATTAG CGGCGTGCCG CTCGATGACG ATGCACCGGA GACGTGGCAG ATGAAGCGCG     33600
     GTCAGCTTCT CGAAGACGAC GCGCGGATTC TGCACACGTC TGAAATCGGC CTGCGCGTCA     33660
     AGCCGGTCGG GATCATCCTG ACCGACGACC GAAAGTTTGG TGCGAGCGCT GACGGCTGGA     33720
     TCGAGTGCCC GCGACTGGGG CCGGGCGGCG CGGAATACAA GTGCCTCATC GGGCCGAAGG     33780
     AACTGGAAGC CGTCTATATC GACGATGACC CGTCGAAGTA CATGGATCAG ATTCAGGGAA     33840
     ACCTCTGGCT CTCCGGTCGC AAGTGGTGGG ACTTCTGCGT GTACTGCCCG GCGCTTGAAT     33900
     CCATCAACCT GCACTTCTAC CGGCAGCGCG TCATGCGTGA CGATGACTAC ATCGCGGAGT     33960
     TGGTGGCAGA CCTCTGGAAG TTCGATTGCA TGGTCGAGGA GTTCCGCGAA AAGCTGCTGG     34020
     TCCGGCAGGC GCGCCGAGAA GGCCGTGAGT TTGTAGCCGA GGCTGCCGAC GAGCTTGGAG     34080
     TCGACACCCC TTATTGATTC AAGGCCGCCC GCTCGCGGGC GCGCCCTCCC CTTTTACCGA     34140
     CAACGGATAA CAACATCATC ATGTGGTTCA AGAACCTCAC GCTGTTCAAA CTGACCGACT     34200
     TCGCCATAGA TGCACAGACG CTTTCCGACA AGCTCGCGAA AGCCGCATTC TCGCCCTGCA     34260
     CGGACCTTCA GGAAAAGTCA GTCGGCTTTG TCACGCCGCG CCCCGATAGC CCGCACGTCT     34320
     ATGCGGTCAA CGGCGAATTC CTGATCGCAC TGCGCACGCA AAAGCGCAAC CTGCCCGGCT     34380
     CGGTCGTGAA AGAGGAAGTG GCGCGCCGCG CGGCGGAGTA TGAGAAGGAA TACGGACACA     34440
     AGCCCGGCCG CAAGATGCTG AAGGAACTCA AAGAGCAGTC CATCGACGCG CTCTTGCCGC     34500
     AGGCGTTCAA GACAAGCCGC ACCACGCACG CATGGATTTC GCCCAAGGCG GGCCTGCTCG     34560
     TGATCGACAC GGCATCTACG GCCATCGCCG ACGATTTCAT TGGCGCGCTG CTGCGCGCGA     34620
     TTGAAGTGCC CGTCAAGCTG CATCCGCTCG CAACCAATAC CGCGCCGAGC GCGGCCATGT     34680
     CGAAATGGCT GCTCGACGAA CCGCCCTCGT TTCTCACCAT CGACAGCGAC GCCGTTTTCG     34740
     TGACGACGCA CGGCGGCAAC ATTAAGTATT CGAATACGCC CGTCGAGGGC GACGACGCCA     34800
     AGCGCCAGCT TGAGGCAGGC CAGCGCGTGT CGAGCCTCGC GCTGACGTGG GATGACAAGG     34860
     TTTCGTTCGT GCTCGCAGGC AAGGGAACCA TCAAGCGCGT GAAGGCGCTC GACGTGCTCA     34920
     AGGGCGAGGC CGCCGACAAG GCCGACGAGG ATTCGTTCGC GTCTGATTTC CTGCTGATGG     34980
     CGGGCACGCT CGCGCAGATG GTCGGCGAAC TGGTCGAATC GCTTGGCGGC GAGCGCGAGC     35040
     CGGAACACGA TATCGCCGAC GCAGCCGATG ACAGCGACGA TGAACTGTAC GGCAAGGCCC     35100
     GGCAGATCGT GATCGAGAAC GAGCGCGCGT CTATCTCACT CGTGCAACGC CATTTGCGCA     35160
     TCGGCTATAA CCGCGCCGCG CGACTGCTCG ATTCGCTCGA ATCGCATGGG GTCGTCAGCG     35220
     CGATGGATTC GAGCGGCAAT CGCCGCGTGC TCGCAACGGA GGCAGCATGA AACTGCGCGA     35280
     AACCAATCTC GTCAGCCTGA AGAAGATCGC CGAGGACAAG TCTCAGGACG CCATCGGCAT     35340
     CAAAAAGGTC ACGCACTACA TGCTGGACCC GCGCGCGATC CGCATTGAAC CGGGCTTCAA     35400
     CGCGCGCGAC ATGGTCAACA TGAGCGAGCG CACTCGCGCG CACATCGACC AAATGAAGGT     35460
     CGCGATTCGT GCGGGTACGG TCATGCCCGC AATGAAGGTA CGCGTGTCCG GCGACACCAT     35520
     CTATGTCGTC GAGGGCCACT GCCGCCTGAC CGCGTACATG GAACTGATCG CCGAGGGCCT     35580
     TGAAATCCTG CTCGTTCCGG TCGAGCAGTT CAACGGCAAC GACGAGGACC GCGATTTTGA     35640
     AGTCCTGAAT AGCGCGAGCC AGTTGCACCT GACGCGCCTC GAACAGGGCC GCATCTACAA     35700
     GCGCCGCGTC GCGTTCGGTT GGTCGGTCGC GCAGATCGCC GCACGCGCGT TCAAGTCGGC     35760
     GAGTTTCGTC GAGCAAAACC TGATGCTCGC GAACGCCGAT TCGGACGTGC AACGCCTGCT     35820
     CGAAGCCGAC AAGGTATCGG TCAAGGTCGC ACTGGACGCC ATCCGCAAGC ACGGCGACAA     35880
     GGCTGGCGCG AAGCTCGCCG CCCGCATCGA GTCAGAAGGC GGCGCGAAGC TGACCGGCGC     35940
     GAGCCTCACG CGCGCGCTGC CGTCCAAGGT CGTGCGCAAT GTCACGGCCG CCGTAAGCGA     36000
     CCTTTTCGGC GACACACAGA GCATGTGGGC CGCGCGCATC CGCGAGTGCT CCGATAGTGG     36060
     CGCAGTTCAG ATGATGGTGC CGGTATCAGT CATGCGCGCG CTGCTCGACG CGCACGAGGC     36120
     CGCCACGCAC GCCAGCGCGC CTGCAAAGGA GGCCGCGTGA GCACGGAACG CGTCAACACG     36180
     GGCGAATATT TCACGATAGA GCAGGCAAGC GCGCATGCCG CCGAGTTTTG CCGCAAGCAC     36240
     CCGGCATGGA TTCGTGTGTG CGACATGCCC GACACGGAAG AAGTGAATCG CGCGCTCTAC     36300
     GTCCATTGGG ACGAGTTGAG CAAGCGTGCT CAGGACTACT GGGGCAGCGA GTATGCCTAT     36360
     AACGAATTCG CGACGAAGCG CTGCAAGGTC AAGCAGGGCG TGATGACCGG CAAGGGCGAG     36420
     CTGTACGACA GCATTATCCA AGCGCCCTTG TTCCACAACG TCATGTGCAT GTACCGGGTC     36480
     GGCGTAAGCC GGGCGCGGGA ATGGTCCGCG CAGCGCGCGA AAGAACGTGA GGAGGAGCGT     36540
     GCGAAATGGA GCAAGTGACC CTGCCGCCAC CCATCGTGCC GGTCGAGGAC CGTAGCGCAT     36600
     GGCAATGCCC GTCGCACGGC GCGGGTACGC CGCTACGCCT GTTCGGCTCG ACCCTGCATT     36660
     GCGTGCTATG CGGCGAGCAG TGCGAGCCGC GCCCGTCCGT CATCGCCGCG CAGCGCCACG     36720
     CAGCGCGCGT GGTGCCCACC GTCGGCACGG TTCGCGGCGC ACCACCCGCC CGCAACGGCT     36780
     GCTATGACCG GCCCGCCAGC GCCCCGCCCT ACTTTGCTCA GGACGGGTAC GAGGAGGCGG     36840
     TAGATCAGGG GTGGGGCACT TTCCACCGCA CGACCCGTTA CATCGAGGTC GAGCACGTCA     36900
     TGAGCGAGGA TTGCCAATAC AGCGAGCACA CTGTCGACCC GAAGTGTGCG GGCTGCCGAT     36960
     GGAACAAACA GGAGGCCAGC AAGTGATACG CGTTATCAGC GAACTGCCTA CGTGGGCGCT     37020
     CGCATGGGCA CTCGCCTTCG CCTTTCTCGC CATGCAGGCG CACATGCGCG ACGTTGAGAA     37080
     CCGACCACAC CAGTCTGGCA ACAGAATGCC CTGTGACGAC CGCGCCGATC TGCACTCGAC     37140
     CGGGTCAAAT CAATACCGTA CACGCCTGAC CTATTGCAGC CGAACCCACC CGAGCCTAGC     37200
     CGCGTAAAAC CACCACATAC CCGACCTTAC CTATACAAAC CGCGTAACAC CTATACGATC     37260
     CTGTATTGAC CTAAACTGTT CTGTACAGGT TTGCCACCCC CCCCATCGAA CTGACGCCCT     37320
     TACACCCAAC GCAAAGACGC TCATTTCGAC CCGAATCCGT GTGTTTGGAC AGATTTCGAC     37380
     CGATTCAAGC CAGAATTGGT CAGAAGCCCT TCCCTCACAC GGATTTTTCA TTTGTTCGAG     37440
     CCAGAATCGA ACGCACGAAA CCCGAACAAA CAAAGCCTGA ATTGACAAAA CCGCTAGTGT     37500
     TTCGACTGAT TTTAGTCAAT TTTGACGGAA ACAAGCCTTT ACACGCTCGG TTTTTACAAA     37560
     ATAGGTCCAG TTTTGTCTGT TTCGTACACT CCTCACCCGG CCAGAATCGA CCACACCCAA     37620
     CCAAACCCAC CCAAACCAAA CCTATATTGG TTAGGTGTGT ACTGTACAGG TGTATATAGG     37680
     TGTGTTTTGA CTTGGTTCGG TCGAGTGTCG TTCATTTTCT TCTGGTTTGA CCTGATCTGG     37740
     TCTGACTCAA AGTGTTTCGT ATTGAACACA TCGAACCGAG TTGATCTTAG TCCGGCCAGT     37800
     ACAGGCCACA TCTGACGTTG TGTGAAATGG TCCGTTCAAG TATAAGGATA CTGATACAAT     37860
     TCGCACCGCA TCAGACTCGA ACGATAAGGA CCGGACCGAA TGCCTATCTA CCTGTTCGCC     37920
     CATACCAAGG GCGGCGTCAC CAAGACGACG ACTGCCATCA ACATGGCCGC CATGCGCGCG     37980
     GCCGACGGCC GCCGCGTGCT CCTCGTGGAC AGCGATTCGG GCCAGTCCGC AACCGGCTTC     38040
     GTCAATACGC GCAAGCTCAA GGGCTTGCCC GACATTCCGC ATGTCTCGCT TGTCTCGTAT     38100
     CTGACCGATG ACGAAGGCTG GTATCGCATC GACGGCGACA TTCTGAAGCT CGCGAAGTCG     38160
     GGCAGGTATG ACGACATTCT GATCGACGCG GGCGGGGAAG GGCACGGCTC ACCCGAGATT     38220
     CGCGCTGCGC TCACCGTCGC TGACAAGGTC GTGACGCCGT GCGGAACGTC GAGCGTGGAC     38280
     ACGGTGCGCC TCGCTCCGAT GAACAGCATG ATCGGCGAAG CGCGCACGCT CAATCCGAAG     38340
     CTGAAGGCGT TTCTATTCGC CTCGCGCGCG AGCACGAATG CGCGCTCGTC TGACGTAATC     38400
     GAGTTCTACA AGGACGTGGC GAAGTTCCGC AACTACACGG TCATGGAGTC CGTCATCCGC     38460
     GCCCGCGACT GCTACACGAA GTGGGAAAAA ACCGGCGAGG CCGTTTTCGA GCAGAAGCGC     38520
     GGCATCAAGG CCGCCATGCA GGAAATGGCC GACCTGTACA AAGAGGTGTT CGCATGACCG     38580
     ACAAGCCATT GAGCGCCGCC GAGGCGAAAC GCGCGCGAGA ATTGGAAGCC CGACGGGCCA     38640
     TGTTCACGCA GGGCGATGCG CGCCCGGCAA ATACCGACCT TTCGACCATT CTCGGACCGG     38700
     AGGAGGGCGC GCAGAAGGGC ATGACGACCG AGGAGCCGCC CGCCGATACG GCCGCGCCGG     38760
     AACCAGCCGC GCAGGAGGCC GCAGAAGCGT CCGCCATGCC CGCGGACACC CCGAACCCCA     38820
     TGCCGACGGC AGAAAAGCCC GCCAAGGCCC CAAAAACCGC CTCACCGGGG AACCGGAAAG     38880
     CGGAACGTAA GCCGTGGGAT GAATACCTGC CGACAGAGGC AAAGGGTTTT ACGACCAAAT     38940
     TCGACCCGGA GCTACACGCG AAACTGGTCT GGATTACCGA AAACGTGCCG AAAATGTCGA     39000
     TTCAGAAGAT CGTCAAGGCG GCCGTTGCCG AGTTCGCCGA CAAAACCATC GCGGAGCGAT     39060
     ACAAGCCATG AACGTGCGAT ACGAACTGAA GAAGGGCGTT CGTCTGAGCG CCGAGGACGT     39120
     GACCATCGTG CCGGTGGAGC AGCCGCGTGC CGACGCGCCC ACACGCGATG CACGACAGGT     39180
     GCCGCTCGAC CTGAAGCCGC GGCCCGAGCG CGAGCGCCGA CCGTGGGAGG ACGCAAACCC     39240
     GCGCGTCAAA ACGTCGATCC GCCTCGAAAT GGACGAAGTG CTGAAGCTCA AGCTCGACTG     39300
     GATCAAAGAG CACTTCCCGA ACAGCGCCAT CAGCGCGGTT TGCCGCCGTG CCGTCGAGAA     39360
     AGAGGCCGCG CGCCTAATCG CCGAATGGGA TGCAACGCAT CCGAGCGCCT AAGATAGGAA     39420
     TGTCTATCGC CAAACCCGAC GAGCCTCGCG CCGTCGGGTT TTTTGTTTTT TGGGGGTGTC     39480
     TCTTCTAAAA AGCAACAACA TCCGGTTGTT GACCTTTAGA AAAACAACAC CTTTAAAAAC     39540
     CTTTAGGAGC GCGAGATCCT TGCCTGACAA GGGATTGCCG GGAGATACAG CATACTTTTC     39600
     GGGACCAAAG AGCATAGTTT AGGGGACGGT TCGCCGACCA AAGAGCATAG TCTGCGGGAT     39660
     AGAGCATAGT TCTCGGGATA GGCCATAGCC TCGACCAGAA AACGCACGTA ACTACATGAT     39720
     TTAAAATGAT ATAGATGCTT CTATATGCCG CCCTCCGAGA TGTCAAGAGC ATAGTATTCG     39780
     GGGCATAGAG CATAGTTTGC GGGACGAGCG CACCGCGGAC GCGCCATAGA GCATAGTTTG     39840
     CGGGATGGAG CGCCCACTAG CATAGAGCAT AGTTTGCGGG ATAACTTAAA GCATAGTTCT     39900
     ATCTTGCGGA TATGCTTTAC ACCATCTACA CTTCCCGGCA TCGAAAGAGG GGATTGAGAT     39960
     GGGAAAGGTT ATCAAGAGCA AGGCGTCAGC CGTTGACACT CGCTCGCCCG AACTGGCGAA     40020
     GCTCGACGAG CGCGAGCTAC GAAAGCATGT CGCGACAATC CATGTCAGCG GCAGTCTGTC     40080
     GCTCGTTGAA CGCAAAATCG TCAACGTCCT TTTGCTGCAC GCATACGACG ATCTGCTCAC     40140
     AAAACGCGAG CACACAATGT CGGTGCGGTT CCTTTGCGAG GCCATCGGAT GGGACAGCAG     40200
     CAACGACCAT AAGAAGCTCG CCGAAGCGGC CGAAAACATC ATGCGGAACA TCGTGACCGT     40260
     CAACATGTTT TCCGACGGCA GCGAGGAATG GAAGAAAACC GCGCTCGTGT CGTCTGTTGG     40320
     CGTGAAGAAT GGTCGCGTGA CCTACGCCTA CATCGAATGG CTTGCAGAGC GCCTTGCGCG     40380
     CCCGGAGGTA TTCGCCGCCA TTGATATCAA GATTCAACGC CGGTTCAAGA GCGGCTATGC     40440
     GCTCGCGCTC TACGAGAACT GCATCCGGTT CAAGGGCGTC GGTCAAACCC GGTACGCGCC     40500
     CGTCGATACG TGGAAGGAGA TTCTTGGCGC GACGGGAAAA ATGTACGAGG AGTATCGGCA     40560
     CTTTTCGAAC CACGTTCTGA AAACCGCAAT CAAGGAAATC AACGACGTAG CGGATATCGA     40620
     CGTAGACCTG CGCGTGAAGA AGGATGGCAG GCGGATCGTT GAGATTCAAT TCGGCGTGAA     40680
     AGAGAAGGCG CAGGCCGAAC TCCCATTTGA AGGCGACCCG AAGGAGGAGC AGACGCGCGA     40740
     GGAGTTGCAG CGCATCGGCA TTGGCGCGAA CACCATCAAG CGCATTCTCG CCAAGAACCC     40800
     ATCGCGCGCA TGGCTCGCAG CGAAGGTCAC GCGCGAGCGC GAGACGGCCG GGAAAATCAA     40860
     GGATTCGGCG GCAGGCTATT TCATGAGCAT CTTCGAGAGC GATTCCGTTC TCGAACTGCC     40920
     CGCCGAGCCA CCCAAACCGG AGCAGAAAGA ACCCGCACGA CCATCTGCCG AGGAGCTAGA     40980
     GAAAGACCGG AAAGCGGATG CCGCACGCAA GGCTACAGCG GCACTCACCG AGGAGAAGCG     41040
     GGCCGAACTG CGCGCGGCCT ACATCGCGAA TAATCCGGAC GCGGCATACA ACGAGGAAAC     41100
     CGGGAGGTGG AACAAGGCGG CTCACACGAC CGGGTATCGG GCGTTCGAGC GAGCGCAGAG     41160
     CGTATAAGAC AAGGCCCGCA CGAATGCGGG CCTTTCGTCA GGTTGTCGCC GCGCTGGCGG     41220
     CCTGCGGCGT GTCAGCCTTC ATAGGTGGGT CCGCGAGGAT CGGCGGCGGC ACGTAGTCGG     41280
     GCGGCGCGGG CATAAATCCA TGCTTGACCG CCCATTCCTG CACGGTCCTG AAATCCTCGA     41340
     CTATCGCGTC GGCTTCATGG GCGGAGGCGC GAAGGTGTCG TTGAGTGTCG TCAGGAAGTG     41400
     CGACGGTGGC GGCAATCCAC GCATCATAGC GGCCGGGACT TGCGGCTTGG GTTCCGGCAG     41460
     GCACGCTGCC ACTACCGGCG CTTGCGGCTG CTGTGCAGAC GGTGGTTGGA ATGCGCAGCC     41520
     CGCCGTATTC GCGAGCAGCA GCATCGAGAG CAGCAATACG CTGCCTGAGC GAAGAAACGG     41580
     CTTTTTCATG GTCCTGTTGC ACCTGTAGGT TGTTCGCGTC GATTTTCGCC TGCTTCGCCG     41640
     CGTTGTCCTC GGCACGCTTC TGCGTTGCCG CGGACTCGAA CGCCGTGCGG GCGACTTCTT     41700
     TTTGCTGCCA TACCGTGCGC TCTGCCAGTT GCCCCGCCTG ATACGACGCC GATAGCTGGC     41760
     CGTCGTACCA ATGCAGGACA AAATAGCCAA GCGCGCCGAC TGCCGCGAGC AGCAGCGCGG     41820
     CAATCGCCAA CTTCACATAC CCGCTCATTC GTGTCCGTCT CCTTCAAAGT GATGGATGGT     41880
     GGTGGTGCTC GAAAACACGT AGCCCTCGAC GCCGTAGCGC TTCGCGACCC AAAGCGGAAA     41940
     TGGCATGTCG TGAATGCCGT CGTTCTTCGC CGTAGGGTAG TGGTGCGCTT CGAGCGGATG     42000
     GCCGCTTTCC TCTGCCGTCG CGCCGGAAAT CCAGCAACGC CCGCCCTCGC GCTCTATGAG     42060
     CTGCTTTTTC GAGTGCGAGA AAAGCGCCGT CGTCGTGCGC GCCTCGTGGC CCGGAATGTT     42120
     GACCTCGACC GAGAGCGTTT CGCGCTCGAC GTGGACCTGC GTAACCTCAC TCATACAATC     42180
     ACTTCCTTTG CGATTTGCCA CAGACCAAGG CGCTCGTTCG CGCCAATGCT GCCGCCGTTG     42240
     ATAACCTTGG TCGTACCCGC GAAATTGCCG CTGTCCGCAA GCTGGTTCAG GTTGTGCGCA     42300
     TTCCAGAACC ACGCAGCAGA CTGGCAGGCA TGCTCAGGCT GTTCGAGCAG TTCCGGGTGC     42360
     TCGATAACGT CGAGGTGGAG CGCCATCAAG CAGGCGACGT AATTCGCCTT GCCGGTGATC     42420
     TGAAATCCGC CGCGCCCGCG GTATTTCCAG CCGTCGCCGC TCGCCTCGTT GCCGTTGCCG     42480
     AGTCGGTCGG CATACACGTT GTTTGCGATG GCGACAGGGT TGCGATTCAG GCGCATGGCG     42540
     AGCGTGTTGG GCGCGCCCGC GGCCTTGCCG GTGGTTGAAT AGCGGTTCGG CCAGGTATTC     42600
     GCCAATCCTT GCGCCGAGTA GTTGAGGTTT TCGACAAGGC GCGATAGCTG ACCGGTTTCA     42660
     TGCGCGAACT GCGCGAGGAA CATTTCCACG CGCTGCTCCG TCGTGATTCC CCATTGCTGC     42720
     ATTGCCGCGT TCAGCGGATC GACGAACGCA GGGATGATGC GCGCCGCGAG CGGCATGATC     42780
     CGCTGAAGCT GCGATGCCGT GACGACCGTC ATTGAGCCCC CCCGCCAACA AACTTCGAGA     42840
     GACGGTCAAT CAGAGCGGAC AAGACGGGTT CGAGCACACG CGAGCCACCA TAGCCTGCGA     42900
     GCGTAATCAG CCCTGCCTGC GCGACCGCAG CCCAGTTGAA GTACGAGCCG ATACAGAAAA     42960
     CGAGCAGGCC CGCCACAATC GAATTGAGCA CGTCGCGAAT GATCGTCTTG ACAGGGCTGA     43020
     CAATCGTCAC GGCCGGGTCC GCGATTTTCT GCGCGGTGAA TGCTGCGCCG CCGATGATCG     43080
     ACAGCAGGCA CGAGATTGCA ACCGCGACGG GCGGAATGTC GCTCAGGTCA TGTACGAAAG     43140
     TCGCTTGTGC GGCATAGGCC GCGACCGACC AGAACAGCAT CAGCCAGATA AACACGAGGC     43200
     GCTTTAGTTG CAGGCTTGCA GGCATGTTGC GTCCTTTGAT CGTTGGTGAG CATCAATAAG     43260
     AGAAAAGGCG ACGACCAAAA GGGCGTTCCA GAGCGAGTAC GCAGCCATCC ACGGTGATTT     43320
     GACGGATAGG GCCGCGATGA AAATCTGACA GACGTAGCAG AAGGCGAGGC CGGAGAATCC     43380
     GAAGTGCCGA TGTGTGCGCG CTGCTTCGAT GCGAAAGCGG AACAGGCCGG TGTCGTTGAT     43440
     GAGTACGTCG GCGATGCCAA CTAGCCCGCA CGCGAGCATC ATCCAGAGAA TCAGTGCGCC     43500
     GCCATCGGTG CGCATGAGGA GCGCAGACAT TGACCGCTCC TCGAAATACG CGATAAACCA     43560
     CATCATCACG GCAACGCCGC ACACATACAG ACGGAATACG GCACTTGCCA GACACACTTG     43620
     CGGTCGATTC GTCATTTCCG CGCCCTACAG TCAAAAACTT GGGTGGAAGC GGCTACATGC     43680
     GCCGCTTTGT TAAGACGTTC CCAAGATTGC CGAGAGTGCG AATGATGTTG TCGAGCCGGT     43740
     CACAGATCGC GAGGTACAGC TTGTTCTTTG CCTCGCGCGA TTTTTTCCAG TCCTGATAAG     43800
     CCTTGCTTTC GAAAATCGTT CTGATATCCG ACTGCCGCAT CTGTAGCGCC TTGTGGAAGT     43860
     CGATACCAAA GTTTAAGAAC AGACTCGCGG CCGTCTCGTT ATGATTTTCC AGTGAGCGAG     43920
     AGCGCCAGCT CAGAGAGGCA GGCAAGAACG AGAAATCGCG CGGGCGACAG TGGATCGCCC     43980
     GCCTCCTTTG GCAATACGAT GATGCCCTCA CCATCGAACC AGACCCGGAA AAACTGCATC     44040
     GCCTGCGCCT GCGCATCGCG ATACTTCGCG AACAGTTCCG ACGTGACCGA GCCGGGCAGC     44100
     GCGCGCATGA CGGCGTGGCG CGTGCGCAGC CAATCGATGT ACTCGGTCGG GTTTGCTACT     44160
     GCATCGGGCG CGGTTTCGCC CGGCCGCTTC AGTTGCGCTG CGAGCAGGCC CATGAGCCAG     44220
     AAGCTATGTC CGTTCAGATC GCTTTCTAGT TGCAGCGTTT CGAGCGCTTC GGCCTCCGCT     44280
     CCGATCAGCG GATGAACCGT CCATTGATCG CCGCACGCAT CAAACGTAGG CAGCGCGCCG     44340
     GGCAGGTCGC GCGACATATC GAGGTAGTCG AACAGCTTGC CAGCCTCCGT CACGGCGTAA     44400
     TTCGGGCCGT CGCTCGCGGT GTGCGTCGTG TAGTGCGCGA GCACGAGCAG GCGCTCCGAT     44460
     ACCGTCCACG CGCGCGGGTC CGCGATGTGT TTCGGCGAAG GCGTACTCGC CGCTTTGATT     44520
     GCGCACTGCA GGAATGCCGT AAGCGCCTTT TCGTGCGCCT TGTCGGGCAG GTAGCACAGC     44580
     GCGATTTCAT CGCCAATGCC CAATTCATGT AGCGTCACAT CGAGGCGGCG CGTGCTCAGT     44640
     GGTGAAAACA CGATCATGCG TAGATCCTTT GAATGTCTCG ACGGTCGATA GCCGTCAACG     44700
     TGGCGAGCGT CACGTTCACG CTGCATGAAA TCATCACGCC GTCCACGTCG CGCGGCCCGG     44760
     TAATGGGATC AGAAACAGAT TCGATGACAA GCGGCTCATA GGTCATGTCG CCGTAGCGCA     44820
     TGCCGATGAT TTGCGGGGCC ATCGACGGGA AAATGGTTTG CACGATGCCG TCTTTCGAGC     44880
     CGTTTTTGAT CGCGTTCGCC AACACTCCAT CGGCGGCGAG GTATTGCGGC ACGGCCCATT     44940
     GCTTGAGCAT CGAGATGGGC GCCTTGACCT CTGTAACGGG GTCAATCAGC GCACGAAAAT     45000
     GCAGCATCAT CGACAGCTTG ACGGGCGGCA TACCCTGAAA AACTTGCGTC GAGTTCAGCT     45060
     TGGTAATGCC GACACGGCCC TCCGCCGAGG CGAGCGCTGC GCTTGCCGAA TCCGTGGCGG     45120
     AAGTCGCACC GGTCTGCTCG CCAATGGCCT GCACGGCAGG CGACAGTGAG CCGGATTGCA     45180
     GCATGGACGA AACCGTTGGC GCTTTCGATT CCGCACCCGC GCCCTCGAAC GGCGAATGCC     45240
     AATTCAGCGA CATTTCGCTT TGCCCGTCCG TGATCGGGCA CCAGACCTCG TAGCCGTCAT     45300
     CGACTGTGAA ATTGTCCGCG GCGGAAAGCT GCCTAACGTC ATTGCTTTGC GTCCAGCCGT     45360
     CGGACGTGCG TTTGAGTGGA TAGAACTTCG CGAGCAGGTT TGGATTGAGG CCGGTCCAGT     45420
     CGGATTTCAG CACGCGCGTC GTCAAGAGCC GTTGCACACT CTGCGCGGCA CGGTCGAGAG     45480
     AAAACGAGCT ACCCACCGAA CTAGGCAGCG TGGAGGCAAT GGAGTCGAAA ATCGACATAG     45540
     CGGCGGCAGG GAAGGGGTAG GAGCCGATGC GCGCCCGCGG GCCTTGGCGA GGCCGCGGGC     45600
     GCGGGCGCGA GCCTATTACA GGCCCGCGCG CTTGCGGATG CGCAGCGACT TCATGCGCCG     45660
     CATCATGGCC GCAGCCGAAT GTGACTTGCG GATCATTTTG CGCACCGCGA CTTTTTGTTT     45720
     CGCCGACAGG CGGACCGCGC CGGAAATCCG CTTGTTGATG CGGACTTTCT TACCGGCGCG     45780
     CACGACGACC TTTTTCCGGT AGACGGCATC GGTGATGAGT TCGCCAGCCG AATCGAATAC     45840
     GGATTGCTCC GCGTCGGTAT CGAATGCGAA CGCATCGAGG TCGTCGAGCG CGGCGTCATC     45900
     GTCGCCCGAT ACGCCCGAGT CGGCGAGCAA GTCGCGCACG CGAGCGGCGG CGTCTGCGTC     45960
     CCAGTCGTTG AGCAGCGCGT TGCAATCCTC GTCCGATACG CCCTTGTCCA GCAGGTAATC     46020
     CCACATGGAT TCGAGCAGCG CGTCGGCGGC GGCCTGCTCA TCGTCGGAGA GTTCGCCATC     46080
     CTTGTCTGAG TCGATGATGC CCACCACGAG CATCAGCAGG CGGTCGGCCA GCGATTCGCC     46140
     GTCGGCGAGG TCATCGGTCG ACGTACCTGC GAACTCTTGC AGGATCGAGG CTGCTTTCAT     46200
     GCGGATATCA GCCGAAGCGT AATCGGCCGC CGCGCTGCCT TCTTCCTCGT CGGCCGCACT     46260
     ATCGAGCACG ACTTCCGGCT TGCGCGTGAG CAGCGTGCGC ATCTTGTGCT TGTAGTCGAT     46320
     CATGTTGCGT TTCCCTCCCT TATTGCGACA GGGTTTGTTG AACGTAGGTC GCACGGTTCA     46380
     CGCCGTCATA GTGCGTGCCG TAATTCACGT CCATGCGGTC GGCCGGGCGT TGCGCATTGC     46440
     GCGTGACCGT GAAGGTCCAG CCCGCATCGC CCAACACCGG ATCGTTCGAG GCAACGAGCC     46500
     AGTTCGATGC GCGCATGGCG GTGAGCGTGA ACTTCAGGAA CGCCGTCATG CGCTTGATGG     46560
     CAATGTCCAT CGGCAGTTGC AGGCATTCCT TGCCGTACTT CACGACCATG TCATCGAGGC     46620
     TCGCCGACAT TTCTGCAACA GAAATCAGCT TGCGGTACGA GGTCGTAACC TGCGCAGCCG     46680
     TGAGCGAGTC CACGAACACG TACTTGCTGC CGCCCGTATA GCGTTCGAGA ATGACCGGGT     46740
     TGATCTTCGC GAGCGCGAGG TCGCTCTTTT GAACGTCGCT CGGCGTGTAC AGTTGCACGA     46800
     CACCGGTACG GTTGATCGGC CAGTCCTTAC CCGCAATCGG GTAGTTCTTC GGAGCGAGGC     46860
     CGTACGAGTT CGTCTGCGCA TTGCGCGCGC AGCGCTGACC GGCTTGGAAG CCGCCGAGGC     46920
     CAATGATGGC CTTGCCGCCA TTGACTGGGT CATTCGTATT GAGCGGTGCC CAGTAGATGC     46980
     TGACGTAGTG CGTATCGAGG CCCAGTTGCG ACACGAACGT TTGAGCCGCG TCCGGCGTAA     47040
     GGCTGCCCGG CACGTCGAGC ACGAAATGCC GGTTTGCACG CACGCACAAC GCCGCCAGCT     47100
     TCGAGAGCAG GGCGACAGCC TGCGAGCCGC CGCTAATCAG GTAGCCGAAA TCGAGCGTGC     47160
     CGTTTTCGAG CTTCGAGATA GCCGCGTCGT AATCGGTCGA TGCATACGCG GTGCCGCCTT     47220
     CCGAGAACAG CACGAGGTTG CTCGATGCAA CGAATTTGTC GGTGCCGTCG GTATTGCGGC     47280
     CGTAGCAGTC GGCATTAGTT GCGACAGCCG CGGTAGCGGA GACGGAAACC GTAATCAGGT     47340
     CCGTCAGTTC GGCAAACTTC GATCCGATGA AATAGTCGTT GCCGTATTCA TCGACTGCGG     47400
     TTTGATCGAG TGAGCCTGTC ACTTCGTAGC GCACGTTGCC GTTCGGCTCT TTCACGCGAA     47460
     TCGTGACGAT TTTCGACGGG GCCGGTGCGC CCGCACTCGT CGCTTTCTTC GCGTTGACTT     47520
     CGAGCAGCAC GCCATCGTTA AAGCATTCGA GGTCGTCGAG GTAGAGCAGG TAGTTTGCCG     47580
     TCGGCGCAGT GGGGGACACG CTGAAGGTGC TTGCACCGCT CACGTCGTCG ATCTTGAGCA     47640
     CGGCAAAGGA GCGCGCAGCA GCAGCGGGTG CGAGGCGTTG CACGACCGCC GACACTGCGC     47700
     CGTTATTCAC GGCCTCGTAC AGTTGGACGT ATGCCTCGTT GAGCGCCGAC ACGCGTAGCG     47760
     ATTCAGGCGC GCCGAGCTTG GACTTGAGCG TGCCGCGGTC CACGACAAAC GGCGCGTCGA     47820
     TGCGCCCGCG CTTGAACCGG CCAACGATAC CGACGACCTG ATCGCCATTG CCAGCGGAAA     47880
     AGCCGTCGGT GTTGTCCTTC AGCGGATTGA GTTGAACGCC CGACTGCGCC CCGAGACTAC     47940
     GGGTATGCGA ATAGAACATG AATTTTCCTC TTGTCCCGTT GTGGGATTAG TCCGCATCCA     48000
     CAATGCGCAG CGGCTTGACT TCCGCATCCT TGTAGCTGTC GTTCAGGAAC AGCAGGTGCG     48060
     CGATGTCCGT TTCGTGCCGC GCCAGTTCGT CCTCGTTGGC GACCGTGACC GGCTTGCTTT     48120
     CTCCCGGTGC GACGTGCGTG CGCGCGACGA CATACGGCAT GGCCGTTTCG TTCACGAGCG     48180
     TCATCTCGCG CGGGAAGGCG GGCTTCGCCG TGGCGGCCTT TTTCGAGGGC GCAGCCTTCG     48240
     CGGTTGCCTT GGTTTCTTCG TTCGGAGTTT CCACAGTGAT CCTTTCGGGT GATCTTTGAG     48300
     AAGCGGCGGC ATGGCGTGGT GCCTATGCCG CCGCGAGACT CACGGCGCGG GGCCGTGCGC     48360
     GCTTACTTCA GGTTGATCGC TTGGATCAGC GCGCAACCGG CTGCCGACAT GGCGTGCGGG     48420
     TTCAGGTTCG TGAAGCTGCG GGCGTTGAAG CCATAGCCCT GCTTCAGGTC CGTAGCCATA     48480
     CCGAGCGGCT CGAAAATCGG CGCGCTGGCG TCGCCGAAAA TGATCGGGCA GCGCGCCGTT     48540
     TGCGACGAGC GGCCCACGCA CAGGATTTCA GCCGAGGAGC CGTCGGCGGC TTCGTTCAGG     48600
     CCCTTCGGCG TGTAGTACAC GTCGTACTGG CCGAACAGGC GGCCGATGCG GTAGATACCC     48660
     GCGCGGTCGG TCAGGCCCGA CGGCTGGAAC AGGTCGCTCG GCATCGAGCG GAACTGCGCC     48720
     ATCACGGCCT TGGTGACGTA CAGGTGCGTC ACGCCATGAT CGGCGGTCTG CTCTGCCATC     48780
     TTTTGCGATA CGACGCCCAG CACCGCTTGG AAGTCCTGCC AGATTTGCGC ACGGGTCTTT     48840
     TGCAGGATCT GCTCGGCGTA CTGGAAGTCG TATTGCGCGG TGTTGTTGAA GCGGCCAACC     48900
     ATCTTCGCCT TGTTGATGGC GTTGTAGTGG CGCTCCATCG CGTACTGGTT GCGGACGACC     48960
     ATCATCGCTT CAGCCGACGG GTCAACGCCA ACTTCGTTCG CGAACTGCGA GCGGGTTTCC     49020
     GGCGTGCTCT GGAACACGGC GCGGTACGGT GCGGCGAACA TCTGATAGAC CATCGCCTGC     49080
     ACCGCCATCT TCGGCGTGAC GCTCGGCTCG ATTTCGAAGT CGACGAACGC TTCGCAGTTG     49140
     ACGACAGTGC CGGCGGGGAA GGGTGTATCC GGCGTAATCG ACACTTCGCC GGTTGCGGGC     49200
     TTGACCGTGC CCGTCAGGTT GTAGGTCGTG CCAGCGAGCA CGATGGAGCC GACGATCGGC     49260
     ACGCTTGCGG CCGTGCTCGG ACCGTTGGAG ATTTCGACCG CGGCGATTTG TCCGTTGACG     49320
     TACACGATCG AGCGGCCGCG CAGCAGGTTC AGCGCAGCAC CAGCGCCTTT CTGTGCCTGA     49380
     AACGTGAACT TGTAGGCGGC GGTGTCGTTC GGGGCCGACA GTTCAAGCGT GCGAGCCGCG     49440
     CCGAGGTACG AGCCGCCCGA GGCGATGCCG TCCATCAGGT CGCCTTGGGT GTAATCCCCC     49500
     CAGTTCGAAC CGGCTTGGTG CGACACGATG ATGAGTCGCG CCTCGTTCGA GCCGCGGTCA     49560
     GCAGGCAGAT AGCCTGCGAA CGGGCACGCT TCAGCCATCG AGCCGAGGAT AGCGACGACC     49620
     GGCGCATTCG GCACGAGCGA AATTTGATCG TGGTGGCTGT TGTTTGCCGA GTCGTACAGG     49680
     CTGTATGCCT GATCGACAGC GGACAGCAGC AGGTCGCCCG ACGGTGCGAA GCCATGTTCC     49740
     GTCTGGTAGT CGCGTGCGCC GTCGAACAGC GCCTGCACGA TGGCCGGTTC GTCTTTTTCC     49800
     GACGCCTTGC CGAGCAGTTC GTCGAGCACG CGCGGCGTCG CGCCCGATTC GCTCTTGATC     49860
     GACTCGAATG CAGCGCTCGC GGCCGATGCC GAATCGAGCA CCATGCCGTT GGTGTGGGCG     49920
     GCAGCTGCGC TGCGCACGAA CCGTTCGAGT TCGTGCTGAT GTTCCACGGT GTACTTCGAG     49980
     GGAGTTCCGC TCATTGGTTC ACGTACCTAA TAAAGAGGGT TATCAAACAA GAGCACGGAA     50040
     CTCCGTGCCT TTACTTTGAG ATTTCATTGT CGAGGGCGAA TTTCGGGGGT CTCGCTTTCC     50100
     CTTTTCCTAA CGGAGTTCAG GCAGCGAGCG CCTTCAATTC GTCGCGTCTC ATAGTGGCTT     50160
     CGGAGATTGC TTCGTCGATG GCGGCGATCT TGTCGCGCAG CACCTGTTCG AGCTTGGGCG     50220
     CAGCCGTGCG GATACCGGGC GGAAGCGCGA CCTTGGCTTT GGCGAGCGCT GCCTGAAACT     50280
     TGCTGCGGCC CTTGACCATG AGGGCGGATA GCTCCTCGAT AGCCGCGCCG TGGTCGTCGG     50340
     GGTTCTTCAG CGGGACCGCT TTGCCGTTGA GCTTGACTTG CGCCACGTCG CCGGTAGCGT     50400
     TGACGCCGAA GCGGATCGTC TGGCTATCAG CAAAGCCGAA TTGCACTTCG CGATACTCGA     50460
     CGCCAAGCGT CTTTTTCGTC TTGGCGTCCA CGTCCACAGA GGTCACTTGC GCGCCCGCGC     50520
     GCGCGAAAGC GCGCTTGGCC GCCGCAATGG CCTTGTCTTT GTGGGAGAGG TTGTAAATGT     50580
     CGAAAATCAG GTTTTTCATA GAATTCCTTA TGCTTGCGAT CTTGTTGTCG GCGCGTTCGA     50640
     TCCTTGCGCG GTGTGGTGGT GGCCCTGCAC GCTGATGTTT CCGGACTTCA CGTCGTTGGT     50700
     GAAATTCGCG CCGCCCGTCA CGCTCATATC GCCGGTCACA GTCATGGCCG CACCGCCGCC     50760
     CGCGCCGCCC TTGCCGGTCA TGCCGCCGTT GAACGTGAGC AGCTTTTCAA CCGTCATCGT     50820
     TCCGGTAACG TGCGTCTGAT CGGCCTCTAT TTCGAGGAGC GGCGTCTTGA TATGGACCTG     50880
     CGAGGCGGCG ATGACCTCGA ACATTCCGCC GTCAGCGCTA AACTGAAAGT TTCCGTGCTC     50940
     AAATCTGCGC CAGTCAGTTC CGTTTTCCTG ATTCTTCGGC CGGTAGCCCA TGATTACGGG     51000
     ATAGCGCGGA TCGCCGCCGT TGAACGCAAT CCATACCCGG TCATCGACCT TGATACGGAT     51060
     TTCGGTGTGC TCGCTCTTGT CGCCGACTGG GTTGCAGAAT TCGGCCTCCG GCAATTCGGC     51120
     CGCGCCGTCG GTGAGGCCGG GAATGCGCAC GCGCGCAATG CGCCGCTCGC GGTCGATGCT     51180
     CGCGACTTCG GCTGGCATGA GGGCAAGCAG CACGCCGCCC AAGTTGAAAG CATTCATTGG     51240
     GTCGGACTCC CTAGCCAAAG GCGCGTGTAC TGCTCAGTGC CGCCGCCGTC GGTGCCGTTC     51300
     TGCATGTGGT GCGCCGCGGT CATGACGACC AATGGCGTGC CGCTAATGTT TGCCACGTCG     51360
     CCCGCGCGCA CGGCCGGGTT TGCCTTGGTC GTGATGACCT TGCGCCGCAC GAGAACGCGG     51420
     CCCATGAAGT TGAGCGAGCG CGCATCCTTG CGCGGGCTGA ATGCAACCGA CTGCGTATCG     51480
     TTGCGGCGCG CCCCCGACAG AAATTTGCCG TTCGGCCCGA CCGACACATA GACGGGAACC     51540
     TCGTCTGATT CGAGGAAGTC GCTTTTAACG TCCTCTGCGC CGTCAATATC GAGTTTGTCG     51600
     ATAGGCGTTT GCGCCATGAG GTCGCGCAGG TTCATCGCTT GTAGCTTGGC TTTCCGCCAC     51660
     ATGACGACGG CGGACTCCTC CTGAAGCACG CGCGCAATGC CGAACGTCGG CACGTTGCCA     51720
     ACGAAACACG CATACCGGGA GATTGCGAAG TCGCCCACGA GCGGCGCACT CGCGCCGCAC     51780
     GCGCGATAGA TACCGGAAAG GCTCGCGTTC TGGAAAATCA CGGCCGTCCG GCGCGGCCTC     51840
     GCGACCTCGA CGACACTATC GGGGAACGCA GTGATGTGGA CGGCACTCAG CGGCTCCTTT     51900
     CCCTGCACGG CGACGTTGCG CGTCGGCACG GCCTTGACGA TGCGAAACGG AATCTCGTTG     51960
     ACCTTGATAA CGCTGCCGTC GCGATAGTCG GCGGCCGTCT GCTGTGTGAG GCGAATGTTC     52020
     GCTTCGAACG TCAGCGGGAT CGGCGCGAGG TCATAGCGCA GGTCCGCAGA AATGATGAGG     52080
     TCGCCGCGCA GGCCGTTGAC ATCGAACACT TACGCAGCGC CCCCATGCGC GAGGCCGCGG     52140
     GCATACCAGT GCGCTCCGAC GGAATCGGCC TCGCCGCCGC AATGCGTGCA GCGGTGGCGC     52200
     GAGAACAGCT TGCCCGGCTC AACCGGCTCG AACGCATGGC GCGCGCACGA TTCGAGGCGG     52260
     GAGCGGTTGG CTTCCGCCTT TGCGTGGATC GCAGTTACGT CCTCTTTCGT GAGGCCCGTT     52320
     ACATGCGTAA GCAGGTCGAT ACCGTTCGGT GTCTTTTGCG TCATAGCTAG ATGGTCTGTG     52380
     CGTCCTGTTC GAACGCAAGG CGGGGCAGGT CTTGCGTTTC GTACTGGCGA ATGTCCTGCT     52440
     CGATCTGCGA CACATCGCGT CCGTACACGT CTACGCCAAG CCCGCGCGAT GCTTCGAGCG     52500
     CGCGCGCGTT CTCCCGCTCG ATGTAGAGCA TGTAAAGCGG CTTGATGAGC GCCCATTCGC     52560
     TGTTGGTTAT GTCGGTGTCG GCGGACAGCC CTTCAGGAAC GGGCGGCGGG TCCGTATCGG     52620
     TCGCGGGCGG CGTGTAGGGC GGATGCGTGC CATCGACGAC GGATATGTAC TGCCCGCCAT     52680
     AGATGCCGCC GTACCATCCC AAAAGCGGGT CGTACAGCAC TTGTGGTGGC GGATCGTCAG     52740
     GCTCGACCGG CTCCATGCTC GCGACGGCTC CCCATCCGAG ATAGAAGCGC GTCGCGTTGA     52800
     TGGCTTGCTT GGTTTGTTCG GCCTCGTCGA TGACAAGGCC GAACGCCCAC GAGCAAGACG     52860
     CCGCAAGTTC TTGAAGCGTC ACGGTGCGCC TTACGGGGTG TTACCGGCTT CGTGATCGCC     52920
     GAAGTAGTGG AAGAACAGCG TGCCGCTGAT CGTCGTCACT TGCGAGCGGT TTTCCCAGTC     52980
     GCGGTCCGGG TTGTCGAGTT GCAGGAAGCA ATCGACGATG TTGCAGGCAC GCTGGTACTT     53040
     GTCCATCGTG CCCTCGTACA CCTTCGCATT GAAGCGCCCG CCCGATGCGA TGATCTTTTC     53100
     GAGGAACGCT TGCATGTCGC CCCTGCGCGT CTCGTAGAAC TGCATCTGGC CTTGCTGCGC     53160
     GATCTTGACC TGCTGCGGCT GGAACTGCGT CATGCCGAGC GGGCCAGCGA TTTCGATTTC     53220
     GCCCGCCGAG GTCAGGGTGG GCCACGGGAA TTGCTTGGTC AGAAGCCGCA AATCCTCGAA     53280
     CCCTTCGATG ACGAATTGCG CATCGCTCGA TACGCTCTTG TCGCCAAGGG ACTTGATCTG     53340
     GTTGTAATGC TGCTGGAGAT AAGCGCCGGT CGATACGGTC ATTGGTTCAC CTTAGAGTCT     53400
     GGATTTACTA CCCAATGCAC TCTAATGGCC GTTTTTTTTC GTCCGCGTTG ACCTTTTCCT     53460
     AACGCGAGAG GACGCAAAAA AGCCCGCGCT CGGCGGGCTT GTATAAGGCA GGGAGAGCGG     53520
     ATCAGGAAAG GTCTTTGATC TTCCCGCCGA CGTACTTCGC GCGCGTGATG ATGTACGGGT     53580
     TGAACTCCTC CGGCAGAGAG AGAACCCGTG CACGTTCGAG GTTGTACGCC GCGCGCGTCG     53640
     CGATTTCCTG ATTGCTGAAA TACTTCGGCG AATCGTGTGG CACTCGGCCC GCCTTGTTGA     53700
     GCAGTCTGGC CGAGGTCATC TCGAACGCAA AGCAGTAGTC GAGCTGGTCG CCCGCGCTCT     53760
     TGTCGCGCCC GCCGTGCGTA TCCACGCCCG AATAGCAGAG TTGGGCGCGC GTCACGAGCG     53820
     CATCGGCGTC ACTGCCGCTC CTGAATGCCG TCACAGCGTC TCTCACGCCG CGGTCGAGGT     53880
     CGTCGGTGTC GGCGAACGCC GGGGCGGCGA GCGAGGCGAG CAGGGCGGCA ATTACAAAAC     53940
     GCTTCATGGG GTTCCCCTTG TGTAAGTTTT CCGCAAGTAT GCCATCCCTG ATCTGTTTTC     54000
     CTAGCGTTAC GCAGCAATGC CACCCGTTGC AATCATCGAC AGGCGGCGGT CACGCAAGTC     54060
     TTGGCCGACG GGCTGATCGT TAGACACATG CACCTCCATC GGCCCGGCGC TATTCATCGG     54120
     GACCGGGATC GACGCTTGCG CCGCGGGCGG TACGTTGGAA GGCGCAGGCA CGCTTGCCGC     54180
     CGCAATGCTC ACGCGCGGTG GCGAGGGCGG TGCGGCGGCG GTCACTACCG GAGGCGGCAC     54240
     GACCGGGGCG GGCGAGGCGG CCACGGCCAC AGTCGTCGAC GCGAGCGCGG GCGGCACGCC     54300
     CGGCTGCACG CTGGTAGCGG GCGAGGGCGA GGGCGAGGGC GAGGCGGGCG CGACAGGCTT     54360
     CGTCGGCGCG TTCGAGGCGA CAGCAGTAGC CTTGTCGGCG GGCTTTGCGC TCGCTAAAGC     54420
     GGTCGCGGGC ACGGACAGGT TCGACATATC GCCGACGACT GATTTGCCGC GCGCTTCGAG     54480
     CGCCGCACTG TTTTTCGCAA GGTACTCGGC GGCCGTCGTC GAACCCTTGC CGTAGTTCAG     54540
     CGATACAGCC TTTTGCGTGT TACCAGAAAG TTGCGAAATG TTCTTGCCGT CCTTCGCGCC     54600
     CTGAATGATT TCCTTCGCTG CGCCCGGCCC TAGCTGGTGC ATCATGTACA GGTTCGCCGC     54660
     CGTGACCGGC AGCCCCGCTT TTGTCAGTTG CGCGGCGTTC GCGTTCGCCA GTTGCATCCC     54720
     GCCTTGAATG TTCTGATCCG CGTTGAAGCG GTCTTTGATG CCAACGCCCG AAGCGGTCGA     54780
     GCCAGTAAAT TGAAAGATGC CGACTGCGCC AGTCGAGCTA ATCGCGTTGG CATTGCCGCC     54840
     GCTTTCCATC GCCGCGAATT CGAGCATTGT TTTCGGATCG AGGCCGTTTT TCTGCGATGC     54900
     CGTGATGATT TTGTCGCGGA TTTCAGGCTG CATTCCGCCC GGAAGGTTCG CGCTCGTGTT     54960
     CGCGCCGCTC GCCTTCAGTT CCTTGATCTT GGCAGCCTCG TCGTCCGTAT AGGTGCCGTA     55020
     CTTCGCAAGT GCGTCGCCGC CTTTCACACC GTCGAATGAT TGCTTGCGGC GATATCCCTT     55080
     GTTGAGCTTC GAATAGATGC CTTCGCCCCA ATCCATGACC GCGCCGCCCG CGCGCGCAAT     55140
     CGGCGCGGCC ATCTTCTCGA CGCGCTCTTT GCCGTAGTCC ACGGCAGCCT TGCCGATTTC     55200
     CTTCGCCTTT TCCGCACCAG TCTTGGCGAC ATTGACAACT GGCTCGGCGG CCTTTTTCGC     55260
     TTGATCGACC GCAGCGCCCG CGACTTCTTT GCCCTTCTGC ACGATGGCGT CAACGTCAAT     55320
     ACCAAACTTG TCCTTCAGGA ACGCTTTCGC GCCATCGACG ATGCTTTTCC ACGCATCGCT     55380
     AACCGTCTTG CTGATCTCGC CGAGCTTGTC GGTGACGGTT TTCCACGAGT CTTTGAAGAA     55440
     CCCGACGGTA GACTTCCACG CACCGGTAAT CGTGTCCGCG ACCTTCGACC AATCGACGGT     55500
     CGCAAGCCAT GCGCCGACGA GTTCGCCGAC CTTGTCGCCG AGCACGCCAC CGACAACCGC     55560
     TCCGACAGGT CCGCCTAGCA GCATACCGAT GCCGCCGCCA AGCAGCGCGC CAATGCCGGA     55620
     ACCCGCGCCG GTAAAGCGGT CCTTTCGGTT TTCCTCATCG CTCTTGTTCG GGTCGCCCGG     55680
     CCCGAACATC GAGGCGAGAG CCGAGCCGCC TGCGAACAGT GCGCCGAGTA ACGGCAGGCG     55740
     ACGTAGCCCC AACTTGCCGA GTCCGAGCGC GCCGCGCCCG AGCAACTTGA GCAGTCCGCC     55800
     CCCGCCGACG AACAGCCTCA TGATGCCGCC GCCCATACCG CCGAGCAGCT TCGACATGCC     55860
     GCCGCCGAGC AGGCCAAAAA GCCCGCCCTT GCCGCCGCCT TCCGCTACGC CCGTCTTGCG     55920
     CTCGATTTCC TTCAGCGTGC GTTGCTCCGC AATGCCGAAA TCACTGTGCT GGCGGCGCGT     55980
     GAGGCGCAGT TCCGTAAAGA TGCGGCGATA CCACGGGATA GCGCCATCCT TGCCGCCAAA     56040
     TCTCCCGGCA ATGGACCTGC CGAGGTTGCC GAGCGTGCCG AGCGGCCCGC CGAGCATCTT     56100
     GCCCATTTCA TGTGCGGCCT CGATGGTCGG ATCGACCTTG TCGAAGTCGC CCATGTCCGG     56160
     TGCGCTTGGT CGCGAGAATA GCCCTTTGAG CTTCGAGAAC AGGCTGCGGC TGTCTCCGCC     56220
     ATCGCTTGCG CCGCCCGAGC CGAAACGCCC GCGCGCGTCG CGCGTCTGGT TGGCCGCGCG     56280
     CGCCGCCGCA GCTTCATCTT TGCCCTGATT TTTTGCCGAT GCCTGAGCGC GGGATTCTCT     56340
     CGCGGCCTGC GCGGCTTGTG CGGCCTGCGC GCGGGTGAGC GAATTGACGG CCTGCGTGAC     56400
     CGGCGTGAGG TCGGTCGACG GCGCGGGCTG CGCGGCGCGC GGCCGGCGCG GGGCGCGGCC     56460
     ATCAGTCGAT GCGGGCGAGG CCGCATCCGG CGCGAGCGTC GGCGCGCGCA TGGGCATGAC     56520
     AGACTCGGTC GCAGGCGCGC GCGCGACAAA CCGCCCGCGC TCGTCACGCG CACGGTCCCA     56580
     TGCGGCCGTG CTTGCATTCA CGCGGGGCAA GGGGACCGAG GCCGTGCTCG GTGCGCCCGA     56640
     TGTGTTGCGC GCGTTGGCGC GCGCGCGGGG GGAGGCCGCC TGCAGGCTGC TCGCCCCTGA     56700
     GTTGGGGTTC GGTACTTTCT GGCGGCGCAG TAGGCCCGTC TTGGCTCCAT GTTGCAGCAG     56760
     GGCGAGAATT GCGCCGGTGT CGCTCCTGAT GCCGTTGAGG CCGCTTGTCA GGTCGCTGTG     56820
     ATCGAGCGCC TTGTCGGCAA TCAAGAACCC TTGTGAGTCC GCTTTAATCA TGGTCAGGTC     56880
     TGGTCAAACA TGAACGAGTC GAACTGAACG AACGACATTT GAATTTCCTG CATACCGTCC     56940
     TCCGCCCGGT TCAGTTCGGT TTCGAGGCTG CCGCACCGCA TGATGTACTT CTCCTCGTAA     57000
     CCGCCGTAGC GCTGCATCAC GTCGTCATTG ATGGCGGCGT GAAGAATGCG GACCTGCACG     57060
     AGGTAATCAG CCGGTACGCC GAATGTTCCA TCGGAGTGCG CGAGCAGATC GCAGCGCGTC     57120
     TGGAACCATC GCTTGATCGA ACCGTATGAG TCGTCGAGCG TCGTGATGCG CATTTCTGTG     57180
     CGCTCTGAAC CGTGAATCAC GTCCATCACG CCAGCGCCGA TGGCACGGCC TTCGCCCGAA     57240
     ATCGTGAGCG GGCCAATCGA AATGTTGGTC GCGAACAGGT TGAATAGGCC CGATGACTGG     57300
     CCCTGCGTGC CGCCTTGGTC CGGGTAGAAG TCGAGGATTT CGACGAAAAA CAGGTTCTTT     57360
     TTCGCGTACT GCGTGGCCTG CACTTCAGCG CAAATCTGTT GCGCCTCGTA GGGCGTGATG     57420
     CCGCCGAGCA GTTGGTTGCG ATTGCTCTTG AAAAGCAGGT CTGAAATCAG CTTGCCATTG     57480
     AGCGTTTGCT CGATTTTCTG GCCGATTTTG GTCTGGCGCA GCGCATCGAG GCCCGCGCCG     57540
     AGATAGTCGC CATTCAGCGC CTTGTTGAGC GGACCGGACG CCTTCGGAGC GATCTTGCCG     57600
     ACGGCCGTTT GCAGCAGCGC ACGGCCCGCG CCGACGGCAG AAAATCCCGA CACGAGGCGA     57660
     CCTACCCGAC TCGCGATCTG CGACGAAACG CGCTGCGTGA CCTCGTCAAA AATAGACATA     57720
     CTTACTCCCC GTCGGCATTG CCGCTGCCCG GTTTGCCACC GCCAAAGCGG CTGCCGCCAC     57780
     CGCCACCAAA TCCACCGCCT CCACCAAAGC CGCCGCCATC GTCCGGGGCT TCATCGGCAG     57840
     GCTTCGGCAT TCCCTTGACG ATCAAATCAG CCTGATCCTC GTCGAGCAGC ATGATTTTCG     57900
     TGAGAATCTC GTGCATGGCC TTTTCGTCGA GGCCCAAGTC GCGCAGTTGT GCAAGCGTTT     57960
     GAACCATGAT GGCGGCCGAA TTCATGGCCT CCGTCTTCGT GTGCTGGCGC TCGCTTTCGA     58020
     GGGCGGAAAT CGTGCCGTAG AAGTTGACGT GCCACGGCCT TTCATCCTTG GAGAACACCT     58080
     CGCCATACTT GTGGAAGGTG TGAACGTCGA TGATCGAGTT AAAGAAGTCG GTCAGCGCCA     58140
     CGCGCAGCAG GCGCGAGCGC TCCGCCGATT GCGCTGACGA GCGGAAGAAA CCGCCATCGC     58200
     CCAAGCCGCC AGAGAGCAGT TCTGCAAAGC CGATCATCGA CAGGTCGATA CCGAGCGCGC     58260
     CCGATAGGAG CTTGGCGTAA AACAGCACGT CTTCGATGCT GACCGAGCCG CTAGGCCCGC     58320
     GCCCTTGGCC GTTCGTGAGG CTCCCGTTGA GCGCCGTAAG CTGCTTTTCG CCGAACGTCG     58380
     GGATGATGTG ATAGATGCGT TCGAGGAAGG GCTTTCCGCT GCGAACCGCG GCCTCTGCGC     58440
     GCGCCTTGCT CGCCTTCAGG ATCTTCGTGA TGTTCCTCAT CACGTCGTCC CGTTGCTGCT     58500
     TGGTCATGCC GTCCTGATTC ATCGTAATCA TCGACTCGTC GATGGAGTCG AGGACACGCT     58560
     GGCCGGTCAG GCTGATAAGC GCGGTCGTCA GTTGGTCGAA TGGGCTTTCC GCGCCGTCGA     58620
     GGAACGAGCC ACCTACAAGC GAGGGCATGA GCGGCAGCTT GTTGATATCG TCCTCTTTGA     58680
     GCGCGAGCTT GATGGCCTTT TCCACCGCGC GCACCTGTGG GATATAGACC ATGCGCGGCA     58740
     TTTTCATGCG AGCCATCTGA TGCAGGGAGA GCCTGTCCGA TGACTTCGGG CCGGATGCCG     58800
     CGACAAAGCC GACGGTCTGA TTGCCGCGCT CGTAGGGCGT AATCATCGAC GGATGCACAA     58860
     GTTCATCCAC GTACACATCG ACGACACCGT TTCTGCCGTC GGTATAGATG CGCCCGTATG     58920
     CGTCGCCAAA CGCCGCGCCA TTGAAGCCGA CCGTGTACGC GATACGGTTG AAAATCGGCG     58980
     CGAGGTTCGT GGAGATTTCG GCGGCGATTG CGGACTTTTT CTTGTCCTCC TTCGCACCCG     59040
     GCGCAGTTTC GATGAACACC ACATCGCCCG ACGTTTCGTG ACCGCCGAGC GCGGCCGTTA     59100
     CGTGCAGGCG CATAGCCGTA GAAATGATCG GGTCGCCCGA CATTTCCATC CACTTGTAGT     59160
     AAAGCTGCTG GCGGTTACGA GCGGGGCGCT TCGCGTTGCC GAGCAGCATC GAAATGGTCA     59220
     TGCCGTCGGC GAATGCGTCG GCCTGTTCCG TTTCGGTAAT GAGGTTGTTT TCTGCGCGGC     59280
     TGCCGAACAG CTTCGACAAA AAGCCTTTGG ACTTGCCGCG CGGTTCGTCA GGTGTTGGCA     59340
     TGGCGATAGA CGAGAATAGA TCAGCGTTGA TCTTCGCTGC CGTTCTCGCG CGCGCTCGCT     59400
     TTGCGTTTTC CTCGCGCGCC GCCAAAAGCA AAAAACCCCG AAAGGCGTGT TGCCTTCCGG     59460
     GGTTTCTCGC TCAACTGCAC TTCTACTTGA TCGTGACGGT TTGGGCTGGC CTCCCTTGCC     59520
     GTCGTGCGGG CTTTTGACCT CGCATCGCCG CGCTCACCAC CACAGAAAGC GCGACAACGG     59580
     GTGAGACTAT ACAGGGCACG CCAACGCGAG GGAAGGGCCA ACTATACGAT AGTTGCCGCC     59640
     CCTTATATCT CGGAGTGAAT CGCTCTTATT CGCGCTCGCA GTAGTAGCAC TTGAATTGCG     59700
     CGTGACGCGG GCTGCCGCAC GTCTTGCACG GCACGATTTT CGGCGCGTAC AGTTCGCGCA     59760
     CTTCCTTTTC GCGCTTGCGG TACAGCCGAC CGTCTAGCTT GATTTTCTTC ATGGCCTTAC     59820
     CCGTGAGGCC CGGCTCGGGG CCGGGCCGGG TTGATATCAG CAGCCCATGC GCATTTCTGC     59880
     ACGGCGTTCA GCGGCGAGGT AGCGGGCCGT TTCGGCGTCC TCGCGCCGCT CCTCCTCGCC     59940
     TGCGCCCCAC TCGCGCCTCT GCTCGGCCGT CATGGCTTCC TCGTCCACGA CTTGAACCTT     60000
     TCCAGTACCG TTGCAGTCGT CGCAGCGCAC GTCATAGCCG CCCGCGAAAT ACGTGTCGCG     60060
     CTCGTCTTGC GGCCAATCCG CCCATTCGCT CGACGTGATG CCGTTCGAGA ATGCGGGGTG     60120
     ATCGTGCTTG CCTTCGCCCT TGCAGCGGCA GCAGATTTCC CATTTCATCG GAAAGTTCGA     60180
     CATTGCGTGT GCTCCTTTGC TCGGCGGATT TGAGAGGCCC GGCGCGCGGC CGGGCGAGGT     60240
     TGGTTAGGCA GGGAATTCGG CGCGGCGGGC TTCCTGCTTC GCGAGCGCGG CGAACTGGCT     60300
     GTGCGCCACG TCAGCCGCCG CAATCCGCTG GACGATCTGC ATGAGATCGC TGTAGCTCGG     60360
     GAGTCCAGCG TTTGTCGCGT GGGCGTCTGC GTTCGCGATT GCTTCGATTT GTGCTTCGTT     60420
     CATCGTCGTT CCCATCCTTG TTGCGTTGCG TTTGTATTAA TGTATGCGCT CACGAAAAAT     60480
     AACGCAAGGG GTTGGAACAA AATTTTTGTA GTGTCAAAAA GTACTTGAAT CCCCAACTTT     60540
     CCGACACTAC AATAAGTGCT CTATGGAAAT CACATTCGAC CCGGCGAAAG ACGCCACCAA     60600
     CAAACGAAAG CACGGCTGTT CACTCGCCGA CGCGGCCCGG TTTGACTGGG ACACGTTGAT     60660
     ATACGAGGTT GATAGCCGTT TCGATTACGG CGAAACCCGC TATCGAGGCT TGGGCTACAT     60720
     AGGGGACCGG CTGCATCAGG TCGGTTTCAC GTTCGAGGGC GAGGCATTCC GCGCAATCAG     60780
     CCTGCGCAAG GCAAACCGCA GAGAGGTAAG GGCATATGAA CAAGGTAACG CATCAACGTA     60840
     AGCATCCGGC GATTTCTGAC GCCGAGGAGG CTGCAATCCA GCGCGGCATC GCCGCCGACC     60900
     CGGACGCGGC GGAAATCCCT GCCGAGAACA TCAAGGCCAT GCGCCCGTTC TCGGAACTTG     60960
     TCGCAAAGAA GCGCATGGGA CGGCCGCCGT CGGAGAACCC GAAAGAGCAG GTCACGATGC     61020
     GTTATGACTC GGACGTGCTC GCGGCCTTCC GCGCGACGGG CGCAGGCTGG CAGACGCGCA     61080
     TGAATGAGGC GCTTCGGACC TACCTGAAAG AGCACGCGCT ATAAAAAAGC CCGGCACGAG     61140
     GGCCGGGCGA ATGCAAATCG GGTTGTGTAT CCGCCGCTTG TCGCGGTTCG AGATAGACCA     61200
     CCTCCTTTCA CGTTGCAATG CCTTACTTCT GCTCCTCCAT GTCGGGATCG TAGAGGAGCA     61260
     GGGTGATATC GTCTGTGAGG TCGTATTCGC GCGTCTGCAC GCCCCATGTG CCGCTTGAAT     61320
     CGTCGGAGAA CTCCCACGCC GCGATCAGCG TCAGTTCGGG CATCTCGCAC GCATATTCGT     61380
     TCGCCCAAAT GGGTTCCTGA TACGTGCCGA CGCCCACACC TTGCTCGATC AGAATGCGCT     61440
     TGACCGCCCA CCAATACGGA CCGTAGCGAA GGTATTGCTT CTTGTCGCGC GTGAGCACCT     61500
     TCGCGGTTTG CGCAACGAAA ATCGGCAGTA GTGCCTTGTC CGCGCCGACC TGTTGCTGAT     61560
     ACTCCGCCTG CTTTGCCTGC AAATATGCAG GGTCCATCTT GAAAGCCGTA ATCGTCATGG     61620
     CTCATGTCCT GTGTGAGGGG CCGCCGCTCG ATACCGGGCT GCGGCCCGCC TGTTACGCCT     61680
     GATAGTCCGC CATGCTCAGG CCAAGGTGAT TCAGCAGGCT TTCCAGAGAG GCTACAGGAC     61740
     TGCCGTTGCT GAACGTCTGG CCGCTTTCCA CGGCGATGCG GAACGCCTTG TTGCTGCTGT     61800
     TGAACGTGCG GCCTTGCAGG CCCTCCGCGC CCTTCACGGC GATTTTGTTC GAGGCTGCGC     61860
     CGCCTTGCAC GAGAGCGAGA TTCACATACT TGCCCGCCTC GTAGCGGAAC GAGCCACGCG     61920
     TCCACTTATC GCCCGGAAAG AAATAATCGT CCGTTGCGAT CCGCGCAGAA ATGACACCCG     61980
     GCTGCTGTTC GAGCAACGCC AGAATACCCT TCACATCGGT TCCGGCCGTG TCCGCCGCGC     62040
     GCGCAGCCTT CGCGACCTTC GCCCATCCCA CCATGCTCGC CCACGAGCCG GAGAACAGTG     62100
     CCATTGCCAT ATTGATGGCA TCCGCCCACG TCTCAACGTA CAGCCGTGCC GACTTCGGTA     62160
     CCATGAGCGC AGCGCGCACT TCATCGACGC CCACCTTCAG TTCGATATGG TCGCCTTCTT     62220
     CGAAAAGCGT TTCAGCGAGC TTGCGGCTCA CACCATCGGC GAGGAACGTA GTCGGCATAT     62280
     ACGTCGCATA CGAGTGGCGC GCGGCGGTCG CGAGAATTTC ATCCACGAAC AGCCCGCCCT     62340
     CGATGGCGCG TTGCAGCGCG GCGCGCGCCG GGCCGCCGAG TGCCGTGCGC GCATCCGAGC     62400
     CGACGCTGAT CCAGCGTTCG CGGCCGTCGT CGATCTTGCT TTGCTGCTCA CGATAGCGGC     62460
     GCATGTCAAA GCCGAGCGCG TTCGAGAGGT CGCCCACTTC GAGCCATGCC GTCTGCGTGT     62520
     TGAACCACGC GAGCGCCCAC GCATCCAGTT CCTCCGGCGT CTTGCACGAG GCAACGCCAT     62580
     CGGGCAGGGC GGCAAAGAAT GCGTCATCGA GTCCGAGGCT TGACACGACT TCCTGAAGGG     62640
     TCAGGTGCGA GTCAATCGAG GTCAAGTCCT GCCCGGTCGC GCGCACGTTA TGCGTCAGAC     62700
     AGTAGGCTTG GACGGCGGCG GCGCGAGCCT TCGTGCTCAG GTCCGTTGCC GGGCCGATCA     62760
     GGCGAAGGTC GGAAACCGTC ACGTAGCGGT CACGGCGCTC GGTAATCGCC GCCGCCTGTT     62820
     CAGCCTTGAT GCGCTCGATC AGCGCACCGC CTGCCGCGTT CGGTTCGAGC GCATACGGGA     62880
     ACATCGGGGT CTTGAACGCG AACGAGTCAC GCCAGAGCGA GCTAGACGGA ATCGCAACCG     62940
     GCATGGCGTC GCGCACGTCA GACACCATCA TCGAATACAG GTTGTCGCTA TCGGCACTGA     63000
     AGCCGTCCGT ATTCGCCTCG ATGGTTGCCA CGTCGGCCGC GACCGCTCGG GAGACTGCAT     63060
     CGGTCCATCC TTCGCCGCCG CGGTCGATGA ACTTCGCGCC CGTCAGGCGG AACAGGTCGG     63120
     TCGTCGAGCG ATCAGCCGGG TTGAAGCCGA GCAGGCCCGT ATCGCCGTAG CGTGTCGGCT     63180
     TTTGCACGAC GAGCAGCGCG TTCTGGTGCT CGACGAGCGT GCCGACCGCA ACAAGCGCGC     63240
     CGTTGATGAT CTGCGCATCA CCCGCGCGGA ACTTGTCGAG CGCTTCGGCC GCATAGCCGT     63300
     CGTCGGTCCG GTTGTTGAAC GATACCGCGG CCTCGTCCAT CATGCGCCGC GCGATGTTGA     63360
     GGTCTTTCCG ATAGTTCGCA TACGCGGCCG TTTCCTTTTC CGCATCGGTA ATCGTCGCGT     63420
     ACCCGTTTCG CGTCTGCGGC AGGTGTTTCG GGCCGGTTGT CAGGCCCGCG AGCACGGCCA     63480
     CTTGCGATTC GAGCAGGCCC GACAGTTCGC GAATCTGCTT GCTCAGGCGC GCGGCCATGA     63540
     GGTCAGATTT CGTCTCGTTC AAGCGCTCTT GCAGCGCGTC GATCTTGTCG CGCGTGCCAG     63600
     TGACGACGGT GATTTTCGAG TTCACCCACG CCGCAAAGCC TTGGCGCTCG TCGCCCTTTG     63660
     CATCCGCGCC GAAACGGCCG AGCCACTTCA TTTGCGCCTC GATGATGCGC ACGCTTTGAA     63720
     GTTGGGTCGT GCGGCTCGTC GCGGCGCGCT GGCGCTTGTT GCGCAGCGCG ATTTCCTCAT     63780
     TGATCCGGTC CATCGCCGAA GCGTCGCCGA CCGCGTTGGC GAGCATTTCG TAATCCGACG     63840
     AGGACATATC GCCCTCGATC TTGATCTTCG ACGAATCGCC CTTCATGAGC GAGCCAATCC     63900
     AGTCGGCCTT GATGCCAACG AGCTTGCGTT TGTACGCGTC GAAAGTGCCG TCCGCATCGT     63960
     AGTGGTACAC GTTGACGCTA TCGACCGGGT TGCCTTGGCG AACGCCGCGG CCGTTACGCT     64020
     GGTGAATCGA ATCCGGCGTC CAGCCAATCG TCATATGGTG GATAGCCTGC GTGCCCTTCT     64080
     GCAGGTTGAT GCCGACCTCT GCCTTTTTGT TGGCGATGAC GATTTCGTAC TTGTTCTCGT     64140
     CGCCGTCGGC GTTGTAGCCG TCCTGCACGT CCTGCATACC CGCCACGTCA ACCGATACCG     64200
     CATTGACGAT CTTGACCTTC GATTGCGACA GGCCGATAGC GTTCGCAACC GCGATGCGGA     64260
     TTTTGTGGTG CAGGCTCAGT TCGTCGCAGA AAATGATCTG CTTGGCGCGC CCCATGTGGC     64320
     GCGGCGTGGC GGCTTCCGCC TTTACGTTCT CGATGACCGC GGCGAGCTTA GGGCTTACGT     64380
     TGATGCCCGG CTCGATGCCT TCCTTTTCGA GCAGCTTGAG CAGCACGTCT TGCGAGGCGA     64440
     AATCGACTGA CAACAGTTCG ATTGCGCCGC CCGAGGCCAT GCGCGCGCGC ACGGTCACGA     64500
     GGAACTTGGC GATGGCGTCG CCCGTCTCCG TGTCTTTGAC GATCTTGGTT TTCACGTCAG     64560
     CCGGATCGGC GTTCGGATCG TCGTAATCGC GCTCCTCGAC GATGTTTTTT TTGTTGAATG     64620
     CGTCGATGGC CTTTTGCGCG CCATCCGCCT GCGACGGGTC GGTTTTGAAT ACGAAAATGC     64680
     CCGAATCCAG TTCCGGGTCG TTGATAACCC GCGTCATCTT GCGGATGAGG TTGAACGGGC     64740
     TGCCCGCCAG CTTTTGCTCC GGCGTTGCAC TGCCGCCCTT CATGGCCTCG ACCGCGTCGA     64800
     GGTATTCATC CTTGTAATCC ATGATGCGGG CGAACGCTTC CTCGCCGATA TCGACGCCCG     64860
     TTGCGATTTC CTCGTATTCG GGAACGGAGA TATTGATGCC GTCCGCCTTC ACGTCCTCCG     64920
     CGGTCTTGAT GAGCGCCGAC GTTTGCAGCA GGCGGCGCAG CAGCCCGGCG TTTTGAAGGC     64980
     CCGTAAAGAC GCGGACCGGG CGCACGCGGC CGACGATGTT CTCCTCGTCG CGTTCCTCGA     65040
     TATCGCACGC GCCCGCCATG AACGAGTCCG CGCCCGTCAC GCCGTACATA TTGTTGACTT     65100
     CGCGCTCGCC GAGCGCCAGC GTCAGCATGG AATAGACTTC GAGCGGGCTG TTCGTGACCG     65160
     GCGTTGCAGT GAGCGAGAGC ACGCCGTCAT TGCGGGGCGT GAGGCCGCGC ACGTACCAAG     65220
     CCTTCGCCTG CATATCCATG CCGCGCTGCG ACTTCGACGG GTCCGCGAGG TATTTAGCGC     65280
     CCTTGAACTC CGACGAGGTC ATCTTGGAGT TCTTGTAGTT GTGCGCCTCG TCGAGCACGA     65340
     GCGAATCAAT GCCCATGTCC TCGAAATAGG GGAGTGCGCC CGACTTTTCG CCGAGCGACT     65400
     TCGCCTTGGC CGCCTTCGAG TCCGCCGCGA TGTTCGCGCG CTTCTTGTTC TCGTCCTCCT     65460
     CCGCGAGCAG GTAGGCGTCG TCGTTTTCCG TCAGATAGGT GACGTAGGCG TCGAGCGTTT     65520
     CCTCGCGCAG CGGGATCAGC TTGAACGCTT CGAGCGTCAT GAAGATCTTG CCGTGACGGT     65580
     TCTCGCGAAT CATGCCGAGG TCAGCCTTGA CCTGCGCGTT ATCGACCTTG TCTTTGCCGT     65640
     CTTTGCCCTG CACGATGCCG ACGAAAAGGC AGTCGGACGT GTCGAGGTAT GCCTTACCTG     65700
     CTTCCTTTTT CCAGTTCGTG AGCGTCGAGT TCGGCACGAC AAACACGGTT TTTTTCTTCA     65760
     CGCCGATAGC CTGCGTGTAC TGCACGGTAG CCAGCGAAGT CAGCGTCTTG CCGAGGCCCA     65820
     CGTCAAAGCC GAGCACGCCG CTGAAGTGCC GCGCGTACTT GCGCGCCGCC GCGTACTGGT     65880
     ACGGGTGCGG GCGGAACGTC GTGGTATTGA GGTTCGGAAT GTCAAGTGGC GTGCCGTCCG     65940
     GTTCCTCGAT AAAGCGCAGC GCATCCGGCG AGTTCAGCTT GTTGTGCAGG CTGACTTGGA     66000
     TTTCCTCGTT CGCGCGCGCC CAAGCGTCGA ATTGCGCTTT TGCCGCATCG GCGATGCCCT     66060
     TGATGCGTTG AACCAGTGCG GCCTCGCGTT CCGGGTCAGC CTCTACATCA GACTGCTTCG     66120
     ATTGCGTCGT GATGTTCTGG TTCTTCAGGT AGCCCTTCAC AAAGCGCTGC ATGGCCTTGT     66180
     ATGTCGCCAT GTCCTCCGCG CTCGCGTAGC TGCCCGGCTT CTGCTGCTTG ATATCGAACA     66240
     CTTCCCGGCC GTTCGCGTCC GTCGTCAGGA AAATGTCTTT CGACACGTAC TGCTTCAGGA     66300
     ATTCGAGCTT TTGCAGGTTC GTGACGTGCG GCGTGAACAG GCTGAAGGTC ATTTTCGACA     66360
     CGTCAACCAC GTTGATGCGC TCTTTCGCCG CCTCGATCTG GCGGACGATC TTCGCCCGCA     66420
     CGTCGGGATC GGTCGCCGCG TCGAGGTCCG CATTGGCCTG CGCGAGGAAC GTTGCATAGC     66480
     TGCCGGTGTA GTAGTCCGCC GCGCTCGTGA CGCTCTGGCC GTCGGCGGAA ACGCACCACT     66540
     CGTCGGAAGT CAGCGGGTCG AAGTCCGAGA ATGCCTCGCG CAGCTTTTCG ACTGGCACGT     66600
     ACCCGGTTTC GTCCTCTGCC TCGTACTTAA CCTTTTCGTA CAGTTGCGTC GGCGTGAGCG     66660
     CGACGGCCTC CATGTTGGCC TGAATCTCGC CGCGCCAGAA AGCCGTAAAT TCGCCCTTGT     66720
     AGCGCACGCT GCGAATCGAG AGCAGCGCAT CCTTGATGAG GCGCGAACCC TTGGCAAACG     66780
     TCTTGTTGCC GTAGGACTGC ACCTTGGCGA GTTGTGCGGA AAGGACCGGG TACGTCGTGA     66840
     CGTAGTTGAG CGGCTCGACG CTATCCGCGT CCTGCATCAG GTTCATGGCC GCCATGCCCG     66900
     CGGCAACCGC TTCCCACCAC GGCTGGTTGT CGCCCGGCAT GGTGTCAAGC GCCTTGCGCG     66960
     TGGCGAGCAG CCAGTCAGGA ATGTTGCCGT AGTCGCCGTT GTTGGTCGCG TAATCGACGT     67020
     AGCTCGATGC CTGCTCCCAC GTCACGCCGT TATTGACCGC ATCGAGCGGG TTTTGAACCT     67080
     TCGTGGCGAT GCCGACCATT TCGGCGTCGG CGGCGAGCTT GGAGTCGAGC GCGACCCATT     67140
     CGCCATCCTT CATATGAAGG GTCTGGCCGC TCGCGCGAAT CACGTCGCCA TCTTTGTAGA     67200
     GGATCGGCGC GGTTTCGGCG GCGTCGAGCT TTTCCCAGTC GATATGCGAC GGTCCGAAGC     67260
     GGCGAATCAT CTTTGCGATG TTCGCAATGG TGTCATCGTT GATGACGGCC GCGACCTCGC     67320
     CATACTTGCC ATTGGTCGTG CCTTCCTCGC CGAGGATGTA CTTGTGGCCC GCACCGACGA     67380
     AGTACTTGCC GGACAGAAAT TCATCCCACA GCACGCGCGA TTCGGAGAGC AGGGCGGGGT     67440
     TCTGCGCCTG CAATTCCTCG ACCTTCTGCG CGGTCGCGCG CGAGAACTTG CGGAACACGA     67500
     TGAGGTCGGT CGTTACGTCC GCAGCCGCGG TCGTGAAAAT GCTGTTCGGC AGGCGATAGC     67560
     CGCCGACGAA CTCGGCCATG AGCGACGCAT TCAGGCGCAG CTTTCGTTCT TTCGCGCCCG     67620
     TGCCGGACAC AACCGATTTC GGAACGATGA ACGCAGCGAG GCCGCCCGGC TTGAGCTTTT     67680
     GCAGCGTGCG CAGCACGAAG TACTCTTGCA GGTTCGCTTT CTGAAATCGC GCGTCTTTCT     67740
     TCTCGTTGCC GCCGCGCATC GCGTTGTTGC CGAACGGCAC GTTAGTAATG ACCGCGTCGT     67800
     AAATCTCGTC GGGCGTCGAT GCGGCGATGG CCTCGAACGG CGACACGGTC GTATTGACCG     67860
     TCGGGCCGTC GTTGATGAGG CCGTTGATCG TGCCGCTCGT CTCGTCGAGT TCAACTTGCG     67920
     TCATGACGGC CGTTTTCGGG CGTGTGGCGG TGAATACGCC GCCGCCCGCC GACGGGTCAA     67980
     GCACACTGCC GCCCGCAAAG CCCAGTTCGC CAAGCAAGTC CCACATGGCC GATGCGATGG     68040
     CCTTCGGCGT GTAGTACTCG TGCGGCGAGC CGGTGAGGCC GTCGGCCGCC GTCAGGCCGC     68100
     CGCCGCTGCC CGAATACTTC GCGAGGATGG CGCGGTCCGC GTCCGTCACG GCGCGCCCGG     68160
     TCGCCTTGAT TTCGCGCATG AGCGCGATGG CCGCGTTGTT GTCTTTCTGC CGCTGTCCGA     68220
     GCGTGCGCTT GCCTTCCTCC GGGTAGAACT CGCCGGTCGG TTCGGTGCGG CCAGAAACGG     68280
     GCGTAGGGGC CGGGGCAGGG GTTGCAGCGC GCAGGCCCAA GGCCATCGCG ATTTCACGCA     68340
     GGCGCTTGCC GATTTGCAGC GCGCGCATCA CGTCGGCGGT TTCGGTAGAG AGGGCGGCGC     68400
     GCTCGGTAAT GAGCTTGGCC GCCTCGCCTG CCAATCGCAG GCGTTGCAGG TCAGACGCGA     68460
     CGTTACTCGC GTCGTCGAGG ATTAAGAGTG TCATTGGTCG CCGAGAAAGG GTGTAGTTGG     68520
     CCCGAATCTA AGTATCGAGG CCGACTTGCA CGCACCTTCC CGGCGCTTTT CCTACGGCGT     68580
     TACACGCCCT TCATGGCGTT GACCATGAAA TTCGTATAGG CGTTGACCGC CCGCGTCCAC     68640
     GCCTCGCGCA TCTCGTCGTC GCCGCCGTAG GCCGCAATCA TCGCTTCCAG CTTGTCGGCC     68700
     AGTTGGTCGT CCCACATATC GACCTTTTCG GCCGCGACTG CCTCGAAAAA CGCGAGGTCG     68760
     TCGGCGCGCT TCGGGTTGAC CGTCGGCGCG GGGCCGGGAT CGGGCACGAC AGGAGGCACG     68820
     ACAACCGGGC CGGGCGGCAA GGGCTGGTCG GCCTGCTTCG CGCGCCATTC GCCGTCCTCG     68880
     GTGTCCTCCG GCAGGGTCCA GCCATCGGCG GCGTACTCCT CCGCCATCAC GTCGGTCACT     68940
     TCCTTCACGA GGTCAGGCCG GTTCATCGCG ATCCACGTTG CGAGGTCCGA GCGCGTGACG     69000
     CCGTCCACGT TGTCGGCTGC GAGGCCGTTG AGCACGCGGT ACACGTCGAT GCGGCGCAGT     69060
     GCCGCAATGG AATCCGCCGC GGCGGTGATG TAGGTTTGCA TGGTGGCGTC AGAAAGGGTT     69120
     CCCGGCACCA CAGGATCAGG CACAACCGGC GCTTCCTCGC CAGCGGGTTT TCCTTCGGTC     69180
     GCGAGCGCGA GCAGTTCGTC GGCCTCGCCG TCGTTGAGGC GTTCATCCGC TCGAATCTGT     69240
     TCGAGCAGGC CCGGCATTGT CGTGAGCGTG CCCGCGGCCT TCGCTTCCTC GATGGCGCGG     69300
     CGGTAGCTTT CGTACTGCGC GCTATGCGCG GTCGCCGCGG GTAGGTCCGA GTTCGCGGGC     69360
     GCGCCTTCGA GTTCGCGAAT GATGGCGAGA ATTTCATCGG ACAGCGTGAG CACGGCGAGC     69420
     GGGTCGTCGT CGCCCGCGGC TGTGAGCGCC TCGACCTTTT CGAGCAGGCT GCCGCTCAGT     69480
     TCGAGCGCAC GCAGCGGATC GACCGAATCG AACAGGGACA TGGTCGGGTC AACCGGATCA     69540
     GCCTTCAGTC GGTCGAGTAC TTGGGGGCGG GTTGCTTTCT CCACGGCTCC GAACATATCG     69600
     GAATCCTCCT TCGTGAATTC TTCGTAGGCG AAGCGTGCGG CGGCGCGCAG GCGCTCGCCG     69660
     ATCTTTTTGG CGCTTCGAAT GTTCTCGACG AACATGCGCA CGACCTCCAT CGTGTCGAGC     69720
     GATAGCGTCA TGTCCGTTTG CTTGGCGAAG TCCGCCAGCT TCACGCCTTG GCGCTTCGCA     69780
     TTGACCGCGA GGCTTGCCGC CTCGGTCACG ACGCCGCGGA TATCGAGGTC GCCCGCGCCA     69840
     TCAAGGCGCG CGAGTTCGGC CGCGGCGCTC GCCATGCCGC CAAGGATCGT CTTGATTTCT     69900
     GAATCGACCG ATTGAGCGTA AAGGCGCACT AGCTCGGGTG CGTCATAGGC TTTCCAGAAA     69960
     ACGGTCGCCA TCAACCGGTC ATAGGCTTTC TGGCCCGGAT GCTTGCCGTC CATCAGGTTG     70020
     TTCCGCTCGC TCTCGGGCAT GGCAGCAATG AACGCGAGCG CGGCGGCCTC GGTCGGCTTT     70080
     CCGTCGTCGG CAACGTCGAT ATCGGCGAGG TCGATTCGCT TGGCGTCGTT TTGTGCCTGC     70140
     TCGACAGGCG ACAGGTCAGA AGTGCCGCGC TGGTTCGAGA TATCGCCGAT GTTCTCGGTC     70200
     ACGTCCTCGG CGCGCATGAC GCGCACGAGA ATAGGCGCGG TGAACGCATC GAGTGCGCCG     70260
     GGCGCGAGGC CCGTCATATC GTCCTGCGCC AGCTCGACGC GGTAGTCGTC GGTGGTGCTG     70320
     CGCTGATAGG CCGCCTTCAG GCCCGCGAGG CGGCCGTTAC CGGCGATGGC GCGCAGCTTG     70380
     CCGGGCACGC CATTGGTGTA GTCCGCATTG GCGATGCCGT CGGCCGCGTT GCTTGTGAGC     70440
     AGGTCATCAG CCTCGACAAC CGCGTATTGC ACGACAAAGC GGCGGCCGTC GGCGGCAACG     70500
     GCCTTGTCGT TTCGGCCAAA GGCGATTTTC GAGGGCAACA GGTCGCCATT GCCGAACACA     70560
     ATCGGCGTGC CGCTCGCGAA TTCCTTCGTC GGCGCGACGC GGTAATAGTC CGGTGCGCTC     70620
     GCGATGGCGT TCATCTGCGC GATCATCGCT GGCGTGCTCC GGTCGCGGTT CTGCAGGATC     70680
     ACACCGCGCG CGGGCGTCAT GAGGCGCTTG AGCAGCGCCA TCAGCGTTTC AGCGGCTTGC     70740
     AGTTCCGCGA GAGCATCGTC AGCGGCACGG GCCACGTCGA GCGCATCCAC GCCCGCGAGC     70800
     ACGTCGCCTG ACAGCATGAC GGTATCGAGG TCAAAGCCTC TGGCATCGTC AAAGAGAACC     70860
     CGCAGGTTCT CGATGACGGC CGGGTTTTCA ACGGGAGTCG TCATGCTGCC AGCTTCGCCC     70920
     TTGCCTTCGC GACTGCGAAC GCGCTGTATG CGTTGACGGC CTGCTTGAAC AGGGCTTGCA     70980
     TGTCGGCGTT CTCCGCGTTG TCCGCGTGAA TCTGCATCAG GCGGGCCGGG ATCGCCGCAT     71040
     CGGACAGGTC CGCGCTGCCG TCGATAATCG ATTGCATGTA GACCGCATCC GGGTTCGTAG     71100
     CGGGCGTTTC CGGCTCCGGC GTCGGCGCGA CCGTCGGACT TAGGAACGCT GTAATTTCTT     71160
     CAACAGCGGC ATCGACCAGC TCGCCCGGCG TGGCATAGGT GCCCACGTCC TCAACTGCGC     71220
     CAGCTTCCGT AAGGCCGATG ATTGCCTTGC GCAGCGCGTA GGTGCCGTCT GTCTGAATGT     71280
     AGGCGCTCAG GGCGAGCCGC ACGCCGTCAG CATTGCTTTC CGAACGCGTC CAGACGTTGT     71340
     CAGCGCCGTG CCTGAACCCG TTCGCTTCGA GCACGTCTGC ACCGGGGTAG GTCGGCTCGA     71400
     TTGGAGCGGA AGTGAACGCG TCAAATTCGG CTTGTGCGGC AGCGATGGCG GCCTCTGCCG     71460
     TATCGAACTG GCCTAGGTCT TGACCTGCGC CGGTGATGCC GGGCGCGCCG ATGGACTTGC     71520
     GCACGAAATA CCCGCCCTCG GCGACGTTGA TGTTCACGCG CACGAAACGA CCGTCGTCAG     71580
     CCGTCATGCT GCGCGCCCAT ACGTTCGAAG TGATGTTCTT GAAACCGGCC GCTTCGAGTG     71640
     CGGGTTCGCC CTGCGGTTTC GGCGCGGCGG GGGTGCCCGG TGTGTCGAGT GCGTCGAGTT     71700
     CTGCGAGTAC GTCGTCAATG CCTTGGTCGG GGGCAACGGC AGGCTCGACC GTATAGCCCG     71760
     CCTCACGCAA TTGTTGAATC GTGCTTTCGA CCTGCGCATG CAATACCTTG CCGGTGCCGT     71820
     CGGTATGCTC CGCCATCTGA TTCCACGCCG TCTCGCCTGC GGGCGTTTCC GGGTAGAACA     71880
     TGGTGAACAT ATCATCGACC TTGCGATAGG TGAGGTCGGG CTTGCTGCTG GCGGCTGGCG     71940
     CGTAGTTCTC GCGCCAGCGC GTCAGCGACG CCTCGATATC GTCGGGATGG CTCGCCATGA     72000
     TGTGGTCGAT CAGGCGCGCG CGCTTGTCAC CCGTCGCATC CTTGCCCGTT ACGAGGTCGT     72060
     CAAATCCACC GATGGACAGC GGCGCGGTCG CGGCCATCAT CGCCAGTTCG GAATCGCTCA     72120
     GGGCTTCGAT TTGGGGGCGC AGCGCGGCGG CGCGCGCTTC GAGTTCGGCG CTTTCCTGTT     72180
     CAGTCACAAC CGGGTTTGCG GCGGGCGCTT CCTGCGCGAC GACGGCCGGG GCTTCCGGTT     72240
     CGGCGGGCGC TTCCGGGTCG ATGGCGGGTG CAACAGGCGT TTCCGGATCG ATGACCGGCT     72300
     TCGGCTGAGT CTCGACGACT GCCGCAGGCT CGACGGGCTC AACCGGCGCA GCGGCAGGCT     72360
     CGGGGGCTGC GGTGGGCTTC GCTGCAACGA TGGCCTCAAG CTGCTGAATC TCGGTCGTCA     72420
     GCGTTTCGAG CGTCGCTTCC TTTTCCGCGA ACTCCTTTTG CAGGCCGTCA ATGGACGCCA     72480
     TGCGCTCGGC GCGCTTGGCA TTCGTCGAGG CAAATCGCGA ACTGTTCTTT GCGGCGAGAC     72540
     TCATCACGCG CAGCGCGACA TTGCGCACGT TCAGGTCACG GCCGCGCTCC GGCGCAACGG     72600
     CAATCGTCAC GTCCTTTTTG TTGAGCATCC ATTTCCACGA AATGAGGTCG TCGCCCGGCA     72660
     TGATCTTTTT GGGCGTCACG TCAGGATTGT GGAAAAAGAT CGAGAGCGTC TGACCGTCGG     72720
     ACAGTTCGAA CACGGCGGCA ACGTTGGTCG TGCCCTTTTG CGAGAACGGC TCGGTAATCT     72780
     GAAACGACGC TACGCTCAGA CCTTCAACGG CACGGTCCAT CACCTTTTTC AGGATTGCCA     72840
     TGCGCGGTTC GAGGCGCGCA TACGGCACCA CGAGCGCATC GAGCGCGAGC ACGCCGTCCG     72900
     AGTCCGCGAG AATGTCGGCG GCCGTCAGCG GATCGAACAT GAGGCTGTCG CGCCCGTCGT     72960
     GCGCGCGGAT GCGGTAGAGC AGTTGCGCGA GCGTCGTGCC GACCGGCGCA TTCGCGCTGT     73020
     CCCAAATTAC CTTTTGCATA TCGTTGCGTT CCTCGTAGGG GAGTTGATCC GGCGTAAGCG     73080
     GCTTCGACAT ATCGCCGTAT GTCATCCACC ATTTGAGTTG GGCGAGCGAG CAGGGCACGC     73140
     AGCTATTCAT GCCCTGCCAG CCGCTATCGA AGTTGCTGAG ATACCCGGCT TCCGCGGTGC     73200
     GTTGATCGGG AAAGCCGAGC ATGACCTTGT GCTCGTCGAA AGCGCCGCGC AGGAATTGAT     73260
     TCACGACAAA CGCCGTGTTG GATTCCGGGG CCGGGCCGAG ATACACGTCG AGTTCATCAC     73320
     CGTCCGCGCC CTTGACGCCT TGGAAATAGC CGTAATGGAA CCGCATCAGG TTCGCGCCGC     73380
     TCGTGCCGTC GGCGGCGCGC CACTGGCGCA GCGTGCCGCG CGGGTTCTCA ATGACGACCG     73440
     GGAAGCCGCG CACGCTCGTG CGGCCTTTCT TGTAGTTCCC GGCGTCCTGC ATGGCGGGCG     73500
     ATGGATGCGC GAGCGCGTTA TGCCCGTATG CGCCCTCGTG GGCGGCCTGT TCGATAGTGA     73560
     GATAGGAGGT CATACCGCAT TGTCCCGTCG CGCGTGCGCG CGAGGCCGCG GCCGTTTTCC     73620
     TGTTGAAAAA AACGCTTGAC CTTATTTAAT GTGAGCGCAT ACACTTATCG AAAATCACCA     73680
     CCGATGGGGT TCAGCATGGC GACGAAGAAA GGCACGAAAT TCAGCTTCAC GACGGCAGAG     73740
     GGCAAGGTTG AAACGCGCAC CAGCCCGCGC GCATACACGC ATGTCGTCGT CGGCCGCCGC     73800
     GACTATGTGA AAGAGCGCGC CCACCTCGAA GCGAATCGCG CGACGATTGA GAAGCAAGAG     73860
     CGGCGCAACT GGGAGTTCTA TCGCCAGTGC GCGCAAACGC CGGTTGGCGA GAAGCGCGAG     73920
     ACGAAAGACA TTTACCCGAA CGATGAGCGC AATGTCGAAA TGGGTCAGAA GGTTCTCGAC     73980
     CGCGCTCCGA CCGCCGATGC TTTCGTCGCC GAATACATGG CTCGCCAAGA GGCCAATATT     74040
     CCTGCGGGCG ACTTCGGCCC GGAAATCGTC TTGCAATGGT CGCAGTCGGC GCGCGCTGCG     74100
     CTGGCCGCCG TCAGCAAGTG GTCGCAATGG CACACGCAAG TCCGCGTGGT CGAATTGAAG     74160
     TCCGAGTAAT AAGGAACCCG CCCGGCGCGA GCCGGGCACA TACCATCGAG GTAGACCATG     74220
     AAACTGAAGT TCAGCAAGAA AGTGCAATCC CTGATCCTGC CGACGGAAGG CGAGGCGGCC     74280
     GGTACGGAAC CGTTCGCAGG CAGCGCGCCG ATTCAGGCAC TGATCCGCGA GCAGTGGGCG     74340
     CAAGGCGGTC TCGCGAAAGA TGGCTCGATT CAGATCGAGG TCGGCCCGGA GTATGCCGCT     74400
     GTCCTGCGCG GTCACGCAGT GGCGCGCCTC ACGGCTTTGG AGGCGTCGCT GGCTGCTTGC     74460
     ACGACCGACG AGGAGCGCAA GCCGTTTTTC GGCGAGAACA GCGCATGGCG CGCGCTGCAA     74520
     AAGCAGATCG ACGCCGAGGC CGTACCCGCT TGAAATGGCG CTTGCGGTTA TTAACGTGAG     74580
     CGCATACAAT AATCGCAAGT CAACCGATAC GGGGAGCGCT GCATGGAACT GAAGTCGAAC     74640
     GCGCCGGAAA TCAAATGGAT CATCCAGCAT GCGCCGGTCA ACGACTTCGC GCGCTCCCTT     74700
     GATACCTGCC TGCTGCGGAC CGGCACGCTC ACGCAGCCGA TGCTTGATGC CGTGCGCCGT     74760
     AACCTGAGCG CGTCAGTCGT CGATACCGCG GGCGTCGAGC GCATCGTGAC CGCGTTCAAT     74820
     AACGCGCTCG AAAGCGGCCT GAAGCAGCCG AAAATGTATC TCGGCGATTT CACGTTCAAG     74880
     CTGGCAACGC GCGGCGCTAA CAAGGGCGCG ATTTTCGTGA CGGAAGGCGG CGCGTATCTC     74940
     GGCAAGGTCG CGGGCGGCAA GTTCATGGGT ACGCGCGATT GTTCCGACGA GCAGAAAGCC     75000
     GAAATCCTGA AGGTGTGCGC CGATCCGAAA GCTGCAGCGG AGACATTCGG CAAGGAAACG     75060
     GGCCGCTGCT CGTGCTGTGG TCGCGAACTG ACCGACCCGG TCAGCATTGC AAACTGCATC     75120
     GGCCCGATCT GCGCCGAGCG TTACGGGTTC TAAGCCATGA AACTGCGAGT GAACCGAAAT     75180
     ATCTACGGGA ACTGGAACGC CTATGAGGGT TCCAGAAAAA CCGAGTTGGG CATGTCCGAA     75240
     TTCGACGCGC TCGATTGGGC AAGCGAGCGA TTGCTAAAGG GTGATTGCGT GCTGTCGGAG     75300
     AAATCCGATG TAACCATGTC GGACGTAGAG GCGCATCGTG CGCGCCTCGC GCGCCCGGCG     75360
     CGCAGGAGTG TTGCTGGTGC CACGAAAGAA CGATGCGCTG TCGATTGTGA CGCGCCACAA     75420
     GACGATGCTC GCCGCGGCGA AAGCGGCCAA GAGCACGATG ACCGTAACCC CGTGCAAGCC     75480
     TGCGCCGGAA CCGAAGTTCC GGACGGTGCT CGCGCCCAAT GCGAACTGGC CAAAATGACA     75540
     CCCGATCCTT TCACAGACAC GGAGCGCCTC GATTTTCTGA TCGAGGAGCT TGCGCAGGTC     75600
     GAGCGGTTCA AGGGGAAATA TCGAGTCGCG GACCATTACG GCCCGCTCTG TGACTGGCAA     75660
     AGCACGCCGC GCGAAGCAAT CAACGCAGCC ATGAATAACA AGGCGAAAGG AGTCCGATAA     75720
     TGAACGAACA GGAATTCAAG CAAGCGCAGG AAACCGCGCG CCGCGCGTGC GCGTCGGGCA     75780
     CGTACACGGG CGGCTTTTCC ATCGAGAACA AGGGCGGCGA CATTCGGCCG TTCGTCGTGT     75840
     ACGGGTGGGG CGAGTACCCG GAATCGAGCG TGCTCGCCGG GCAGACGATG AAACAGTTCA     75900
     TCGACTCGTT CGATACCGAG GAGCAGGCCC GTGCCCTGTA TCCGCAAGCG GAGGCGGGCA     75960
     CGCATGGGCG TAGCGCGCAC AACAGCGTAT CGCACCTGCC GGGAGAGGAT GACCCGGTTC     76020
     CGGGTGGCAT GTACCACGAC GGCATTTGAA ACTCACCACG GCCCGCAATG CGGGCCGCAA     76080
     TGCCATTCGG AGGCAACATG AGTCAGCCGC GAGGCGAAAT CCTGCTCGAT GATGGCGAGT     76140
     ACTTCGTCGA GCACAACGTT AACTATCCGC CCGAGCGCGG AAACGGGTTC CTGATGCGCC     76200
     GCTGCGCGAC CTCGATGACC GCGCCGGAAG GGGCCGAATG CGTCGGCGGC TATGACCTGA     76260
     AGCCCGACGG AAAATGGCAC GCCGACATTC ACGCGCCGCT GGACGAAGAT ACCGATTCGG     76320
     ATTGCCGGGC GCTCGGCATG TTCGATAACC GTCTCGACGC CATTGGTACA CTCTGGCAGC     76380
     GCCGCCGTGA GGCGTATTGC AGGCATCCAC GATACTGACT CCATGCACCG ACACTTCGAC     76440
     ACCATCGAGC GCGAGCTACG GGCCGCCATT GACGCCGCAG GTGGCGATAA TAGCGCGCTG     76500
     CTCGACCGGC TTGACCGCCT CATGAACGAC GTGCGCGGCG CGCGGTTTGC CGCGCGCTTT     76560
     GCGCTTTTCG GCAAGGCGAT GAAACCGGGC GGCGAGCCTG AGCGGGAAAT CGATGGTGTT     76620
     GAGCCGCCGT CACGCGAGTT CGAGCACGAC GACACGGTGC GCACGAAAGA AGGGTATCTC     76680
     GCGCGCGTGG CGCATTATGA CCGAGCAGGG CGCGTTGTCG TCAACGTGCT GTTTGAAGCC     76740
     GCGGAATATA AGGAATCAGA GTTGAAGCGA GTAGAGCTAT GACGAAAATC GCAGTCGCAG     76800
     CAAAGAGGGC CGGTCCGGGC CGCCCGACGA ACGTCGAGCG TGGCTTGCCG CCGCGCCCGA     76860
     CGGCCGCGCA ACGCCGCGCG AACTCGGACG CCGAGAAAAT CGCCCGCGGC GAGCAGCGCA     76920
     TCAATACGTG GATCGCCGCG GATGCCGCCG CAGCGCTCGC CGCCATTACG GGCAGCGACC     76980
     AATCCCGCGG CGCGATCCGC GAGGCGATTG GCCTCGCACT GATCGCATAT GCGCAGACCC     77040
     TACCGACCAA GCGCAAAAAG AATGGATAGC TTCTGGAATA CCGGCGTGAG CACGAACGCG     77100
     AGCAATACCG CCGCGCCGAT GACGGCAGCG GACCTACCGG CCATGCTCGC GCAGATGCGC     77160
     GGCATTACGG ATAGGGCAGC GGAGGACGAT CGGCAGCAGG CCGATGTGCT GCGCGCGCTC     77220
     GCGCTCAAAC ATGGCTTTGA CCTCGACGCG GGCGACTTGA TGATCGCGCC GCAATCGTTC     77280
     GACCTGCACA TACCGCTCGC GCTGAAGGAT CGCGTGCGCG TCAGCTCGCT CGCGACCTCA     77340
     ATCATGTTCA TCAATCGCAC CTACGTCGTC GATCCGCTGA TCGCGCCGCC GTCACTCTTT     77400
     CCACGGCGTT AGGTCGTGCA GTTCATCGCG CGGCGCGATG ATCCACTTCG TCGTGTACGG     77460
     GTAGAGTCCG ACACTGCTCG TCATGCCGAC GATTTCAAAG CCAATCAGCA CGCCGCCGCC     77520
     CGGCTCGACG CCCACGAGGT CATACTTCTT CGGGCCATAC GTCGGCGGCG CGCCATCGGG     77580
     GCCGGAAAGG GCCTCAATCA GCGCCTCCTG CATGACCGTA TCGGGCGGCA GCGAATCACG     77640
     GCGGTCCGAG AGGTCTAGCG GCTGCTCATA GCGCGACGTG ATGAGGATTT TTGCCGCGCC     77700
     GACGGCCTGA TACTCGAACT CCGCTTCATC CTCCGGGCTT AGAACGCCAA GCCCGCCCAA     77760
     GGTCGGCAAT CCGCCCATCG TTTCATCGCC CGGCGCGGTG CGCGTGAACA CCTTGCGATA     77820
     GAGCGTGCAA TCCATCGAAT TGGGGTGCTT CAGGACGACG GTGCGCGACG CCTGACTGAT     77880
     CGCGACGGGA ATCTCGTTAA TCATTTCTGT GCGCCTTTCA CAATCTGTTC GTACATTTCC     77940
     TGAGTGATCG CACCCAGTTG CAGCAGGTTT TTCGCGTTCC GCTCGATCTC TTTCTGGTTC     78000
     GCCTTTGGCT TGGGCTTCGT CTTTTCGACG GCGGTCTTTT TCATGTCTGA GCGCGCCTTG     78060
     CGCAGGGCCG CTTCATGCGC CTTTTTCTCG CTCGTCTTGA GATTCGTGCT CGACGTGCGC     78120
     TTTTTGTGCT GCGCATCGGC CATTTCGCGC AGTTCCGCGA CCTTGGTTTT TTCCGTCTTG     78180
     AGCTTGCGCG CATCGAGCAC TTCGCGAGCC TTGATGACCT GCGCGGCGAT TTTCGCCTGA     78240
     ACGTTCAGGT CGCGCTGGAC AACGTGCATC ACGCGCAGGA CGTGCTTGCA CGCGACGCCC     78300
     TTCAGATTCG GGTTGCGGAT TTTCGGGAAC CCCGTTTCGC CTCGCCCATA GTTGTACTTT     78360
     CCGACAGTCG CGATGTAGCG ATACCAGAAC GTATGCCGCC CGCAGTCGCA GTCGAACAGC     78420
     GTGCGGCCGG ACGTGACAAG CTTGCCGATT TTCTTCGGGT CGTTGGGCGA TGCGCCGACG     78480
     GCCGCCTGAA AGTCTAGAAA TTCGACATGG ACATGGTGGC GCGTTGCATC CGAATCCGGC     78540
     CCGGCGTTCG TGATGAAATG CACGAGGCCG CCGCGCAGTG ACACGGGCAC GGCCATGCGG     78600
     ATTTCCTTGT TCGCGCGCTC GCGGTCGACC GGCAATGACA GGTCGATGAC CGACTGCGCG     78660
     GTAATGCCGC CCTTGTACTG CTTTTTCAGG CGCGTGATGT TGCTCTGGAA CGCGCGCAGG     78720
     TCCGATAGCG TGATCGGATT GTGGACGCCG CCGCGACGCG TCGTCGTGAG CAGCCGTCCC     78780
     GCATCGTACT CGCCCGATAC CTCGTGCGGC TGAAGGATCG TCGTCGCGGC TTGGCGGCGT     78840
     TCGAGGTCGA ACTGGGCGCG CTCGGCGGCC TCGCGCTTGG CGGAGCCTAG CCGGGTAGTT     78900
     GCGCGTTCAA TTAAGTGACT GGTAAGCGCG CGCTTCGGCA TCGGTCAAAT ATCCCGTCTG     78960
     TCGTTTGATG GTCATTAGCT GCGTAGCGGT CGGCAGTACA AGCTGCTGCT CGGGCACCGG     79020
     CTGTTCGAGC GTGTCGAGTC CGGCCGCCGC GAAAATCGCC ATGAACTCAT TGCGGTCGCC     79080
     GTAGACGCGC TGCGCAATCA GCGTGAGGTC GTACCGCTCG TCGGGCTTCG TGAAATATCG     79140
     GATGGCATTG GCCCAATCGG GCGTCTGCAC GGCGAATTTA CGGACCGCCT TGACGTAAGC     79200
     AGCGGTAACG ACCGGGCTGT ACATGCGCGA TTAAGCCGGG TTTGCGATGA CCGCAGCGCC     79260
     GGAGAACACA TACTGGTCCG ACGAATATTG CTTCAGCGTA TCGCTGGAGG TCACGCCATC     79320
     CGGAACCGGC TTGATGAGTT CCGATTCGAC GAAATCGCGC GCGTCCTGAC CCGGAGCGGG     79380
     GAGGCCCTGA ACCGTGATCG ACGAGCTTGT CAATGCTGCG CGGCTTTTCG CCAGAGAATC     79440
     TTCGTTGTAG AACGATTCGA CTTGCGCCGT CGTGTTTCCG CCGACGTAAC CGACGGTAAC     79500
     GGACGAGACG CGATGGACCG AAGCGGGTAC GCCGTTCGCC TCGACCAACA GACTCTTTTT     79560
     CAGCATTTAA ATTCTCCTAA TGACGGGTTG CGTTGGATGG CGGCCACGGA TTCAGCCGCA     79620
     CTCGGGAAAT TATCGATAGG CGGGCGGGGC GGGGCGACTC CCGTTTTCCA AACCCGCCAC     79680
     ACATCACTCG ACGATTGCTC CGCCCGCGAA CAGATATCTG TTCGGGAACG GCTGTTCGTT     79740
     GAGCGGCAGA TCGGCCGCAC CGGGCGGGGC CGTTGCGACC AGCATTGATT CGGCGAACTT     79800
     CATCGGCTCC TCACCATCGG CCGGGATGCC GCGAATCACA ATCGGATGCC TCAATAGCTC     79860
     GACCGGAGAC TTGCCCGCCG CGAACGCCTC GACCGTGAAG TAGCTCGCGA CCGTCACCGT     79920
     TACGTCGCCG GACCCATTGA CCTGAGCAGA CCGAAGGACG TGATACTCGG CCAGCGCGCC     79980
     AGTCCCGGCG AGTTCGATGG TCTTCTTGAT TGCCATGCCA TACCCCTCAT TCAGCCGACT     80040
     TGGCCGGGAG GGTCGGCCAT GTCACGTTGA ACGGGAACCC CGCTTGTGCG GGCACGTCAC     80100
     GCAGCGCTTG TCGATACTTA CGCAGCGCGG CTTCAAAATC AGCATCGCCA GCATCAGCCG     80160
     CGCGCTCGAC CATCGGATCA ACTTGCTTGA GCAGATCGTC ACGCTTCTGT CGGGCGCTCG     80220
     TGGTTTCCTC GGCGAGCGCA TATTCGTCAG CGTAGTCCGG CCACCATGCC AACAGATCGG     80280
     CGGGCGTTGG CTGCGGGATA TCGGTCGGCT CCCATATCGG AACCCAAGCC GTCAATCTCT     80340
     GCTCATACGT CTTTTCGTGA ACCGGGTGCG ATACCCAGTA ATCCTTGCAT CGAACGAGGC     80400
     TCGGGAATTT TTTGGACAGA ATGAATGCCG CTTGTTCGAC ATGCAGCATG AAATTAACAG     80460
     TGCTCATTAT TGGTTCCTTA GAAGTACGCC GTAGACCACG ATGGCGTTTG CCGTCCCATT     80520
     GCCCGGACCG CTCAATCCGC ACACGACCCA CGGTGCGGGC AGAGCGCCGT TGAGGCGATC     80580
     GATGGTGCCG AAATTGTTGA CGCCCGAGTC CCATTGGACG CGGGAGCCTG CATTTGCCTT     80640
     GCTGCCGAGC GCAGCACTCA GATAGCCGCC ATACCAACCC ATCCAGATAT TTCCGTCGGT     80700
     CTGGAAGGTG GAACTGCCGA TGTGAAGATT TCCGTTGTCT TCAAAGAAGG CTGGGACGGA     80760
     GTTGTAAGCG CTGTTGATGA GTTCGATGCC ACCACCCTTG CGCGCGCGCA GGTATGTTGA     80820
     CCACCCATCG CCCGCGGCCA AACCAATGTC TGCCTGCCAA GAGCCATTGG CGAGCGTAAG     80880
     GCGGCCCGTC ATCGTGTCGC CGGACTTATG GACATAGGTG GCGTCGAGGA ACGAGCGGAG     80940
     CCATTGGTTG CCCCATTGTG TTCCCCAAAT GTTGCCGTCC GGTGTGATGG TCGCGTTCGT     81000
     GCCGCTCGCA TAGGCCGAGC CACCAACACC AATCCAGTCC CGCGTCGTTA CATTCCCGCC     81060
     ATCAAAGACT TGCAGGTTGT ATGCAGTGTT CGCGCCGTTT ACGAAGCCGA TCATGCTCGA     81120
     CGCTTGCGCC GTCTGGATGC GTGGCGTGTA TCCGTTTGCG CTGATGGCCA GCGCGGAGTA     81180
     GGTGGTCCCG GAGGCGATGG TGGCTAATCC CGCGTTCATG GTTACCTGAC CGTTAAACGC     81240
     GACGTTGCCT GTAACAGTTC CTCCGACATT CTTGTCGAGC GGCGTGACGT TTCCAGCGTG     81300
     CCACACGTAG TTGTTGCCGA CACGGATGTT CGCCGCCGCG AAGTTGTAGG CAAACACACC     81360
     CTTCGTAGGC GAATACCAGC CAGCTTCTGA GGCGTTGGCA TAGTAGTAGC CATCATTCTG     81420
     ACCAAGCCAG ATTTCACCTT CACCGCTGGT GCGGTTTATG GTGATCTTGG AACCGGAGAA     81480
     GGTTGCATTT CCGCCAAAAG TTGTACCCGC CCCGGTCTGG TCAATCCTGA CCGCTCCATC     81540
     TGACAACCCC CACGAGAATG GCCGGAAGGC ATTCCACGAT CCATATTGGT CGCCGCTTGC     81600
     AGTCTGCAAA AGGTAGACGT TCGTGCCATC GTTTCGCAGC ATCGAAGCAT AGTTGCCGAA     81660
     CACTGCTCGA AACTGGATGC CTGCGGTAGA TTGCACTTCG CCTGAGAACC GACCATTGCC     81720
     TCCGACTTGA AGCAAGCTAG ATCCGTCATC GGGAATTGAG CCGACCTGCA CTCGCCCGCC     81780
     CCAAGGGGCG AGAGCGATGT TCTTTTTGGT CGTGTTGGCC TTGTTGTACG CCTCAAGCGA     81840
     GATGCCGCCG GCGTAGTTCG ACGCGGATAA GGTGAACTGC GTGTCATTCG CGCTACTGTA     81900
     GGCCGAGACG TTATTCGCAA ACATTCCCGT ACCGGCTACT TGCAGCATGT TTGCGCCATC     81960
     GTCGGCAAGC GTACCCACGA GAACGCGGCC GCCGTTTTGC AGCAACACCA TATTGCCAAC     82020
     GGTAGACCCG GTTCCGCGCG TCACCCAAAG CGCATTCTGC GCAGCGGAAT ATGCGTCGTT     82080
     TACGGTCCGA ATAGAGAAAG TGCCATCGCC GCCGTGCATT ACCTCCCACT TCTTTTGGTC     82140
     GGCTGGGCCG CCATCCCGCG AGAGGATGAT CGACGTTTGG CCTGTTCCAC CGCCGTTCGC     82200
     GGCAATCAGA GCGCCCACGC CGTTAATACC TCTGACGGTG CCGGCGACCT GAAGGAGATC     82260
     CCCGCCGTTA TCGGCTGTCG TCCCGATCAA GATGCGGCCG GAGGCAGTTA CTCGGAGTCG     82320
     CTCAGCATTG GCCGATACGA GGCCGAGGTA GCCAGAAGAG CCTGCGGAGC CAACAAGTGC     82380
     GTTGCCTTGG CCGTATAGAT AGTACGCGTT CGCGTCAGCG TTAATCCACG CCTTCGATGA     82440
     GGTCTGTCCG AAGTACGAAA CGCCGTAGAA ATACGTGTTG CCAGCCACTT GCAGCAGGCT     82500
     TGACCCATCG TCGGACGTTG TGCCGATCAA GACGCGGCCG CCAGACGTAA GCCGGGCCAC     82560
     TTCACCATTG CCGTTCGTGA ATGCGAGGGT CTTCGACGCA GGGCTCCAAA TTGCGGGGCC     82620
     GCCATTGTTG AAGTTGATGG TCGGGCCTGC CCCGACGAGC GAAACGTTGC CAGCGACTTG     82680
     CAGCAGGTTC GAGCCGTCGT CGGTCGTCGT GCCGATTAGC AGGCGGCCGC CTGAGGACAC     82740
     CCGCGCCCTC TCGGCGCCGG CCGTCCGTAA CACGAGCGCG CCAGCCCCTG ACGTGCCGCT     82800
     GCCATATGCC GCAACGGCAG GGCCATTGGC ATTGGTGAAT CCGAAAATAC CGGAGTCGCC     82860
     CACAGACTGG CTGTTGATGT TGTAGTTTGC AGCGCGCACG CTGCCATTGA CCTGAAGTGC     82920
     AGTCGAGCCG TCGTCGCTTG AGGCGTTAAC AAGAACGCGT CCGCCGGAAA CCAAGCTCAT     82980
     GACGAGCTGC TGGCTCGCGT CGCTCTGCCC GTCGTTGGAC GAGCCGTTGT TGATCCAGAA     83040
     GTTGAGGTAT TCCTTGCCCC ACGAGCCAGC ATTGAAACCC GCGCGGAGCG AGGCAATCAG     83100
     GCGCGTGCCG GTATCGCTCG AGCCAGTGCC GAACGTGCCG TAGAGGCGAA GTTTTCCCTC     83160
     ATTGTTGAGA GCGCCGCTTG CGCCCTTCAG AGCCAGTTGT GCGGTCGTTG CCGTAGGCGT     83220
     ATTGGTGATC GACGGCGTAC CCGTCATCTG TGCGGAGTCG AGCGGCGCTT TCAGGTCGAG     83280
     TGCCGCTTGC AGGCCCGCGA CGCGTGGGAT ATCCGACTGC CCGAAAACGA GGTTCCCCGT     83340
     CATCGTTGCC GTCACGGAGT TGAATACCGT GACAGCCGAA ATCGACCAGC CCGCCATCCA     83400
     GCGCGCTACG CTACCGCCAT CCGCGTTGTA GGACACCATG ACTTCGGAGA CGTAAACGCG     83460
     CGGGAAAGAC CACGTCGAGG TCAATTCGCC GATCCACACG ATAGGCTTGC TGCCATCGTT     83520
     GCCGAAGCGC ACGGCAAGGT CACGGTCAGC GCGCTCGCCG AGAATCGCGA CCGTCTGATT     83580
     CGACCAGTTG ATTCCAGATG CGTAACCGGC GATGAGGAGG GTGATCGACT TGCCGGTTGC     83640
     GCTCTCATGG ATTTCGACGC GCATGCGAAC GAGCGCGTTA TATGCGCCCG TCGGGAGCAC     83700
     GATCTTGAAC GCGCCCGTCA GCGGGTTGCT GTCGGACGCG AAATAGGCCG CATCCGGGTT     83760
     CGTGATGCGG ACCATGCCAA GCGTGTTCGA GCCGTTGGCC TGTACGCCAG TGCGTACCGG     83820
     CACGAACTCG GCGGCCAGTT CGCCCGTCGA GAAGGCCCAA CGCTCCCACT TCGCTGGATA     83880
     GCTCGCAGGC GTGTTGCCGA CGTTGTTATC GACGAGGCTG CGATATGTCT TGCCATCCGG     83940
     CCCGACGATA TGCGCGCCAG CGTTGTAGAT GGTGAGCGGG TCATATTCGC CCATGCCACG     84000
     CTTTTTGAGC ACATAGCCCG GATGCGGGTC CAGCTTGGCC TCGTGCTGGA GAATCAGCGC     84060
     GGCCATGCCC GCCGTGTCGG TCGAAACCGT GATGTTGACC GAGCCAACGG GCAAAACCGA     84120
     CACGTCGAGC GTGTACGCGA AAGGCACGTC GAGGTTTTCG GACTTGATGA AAAGCGCGCC     84180
     GCCCGTCGCA CGGCTCCAGA CCGCAAAAAG CGTGGTGCCC GCGTAGAAGC CGATTTCGCC     84240
     GATGGATTTC CCGTTCGGCG ATGCCCCGTT CATGTCGGTA TCAGTGATCG TCGTGCCAAT     84300
     CTGAACCGAG TAGTTATCCG GCTTGCTGCC GCTCGAAATT GCGTAGCGCG CGACCTCGTT     84360
     GACGAGGGCG GTTTGCGTGG CGCGGCCGTT CGCGTCCACG ACGGGATCAT AGAGGCCCGT     84420
     ACCGATTGCA ACGTGCGTGA GCGTGGCCGA AAGGCCCGGC TGAGTGTCCG TCGGGAGGAG     84480
     GGCGTTGCCC GCAGCGGTGA TCTTCGGATT GAGAACGGGA GTAGAAGCCA TCGTGACCTC     84540
     GAATTGCTAA CTGCTCAATT CTCCCGTCGC GATGGCTGGC GGCGCGCTTG GCTTTTCCTA     84600
     ACGCTAGATG GTCGCCCAGT CGCCGTCGAT CCCGTCGAGG TCGCCGTACA TTTGGGCGAT     84660
     ATCGTCAGCC GTGTCGATGG TCGTATTGGC CGCGAGCGCC ATGTCGGCGG CCTCGATCAT     84720
     CGCGAGCACG GCGATGTTGC CATTCGACAT TTCCGGCGCG AGCCGGTATC GGGTGCCGCG     84780
     CTCGCTCATG CCGTCGGATT CGATGCGCGT TGCCGGATCG TGCTTCGTGA CCGCGGCCAG     84840
     CAGTTCGAGC AGCCCTTGTC CCTTCAGGCT GAAAAAAAGC TGGATCGCGC GCTGTAGCTT     84900
     GTCCTCGTCG AATAGCCGGT CACGGTCCTC CATGCGCGTG CTGTTGGACA CGACAAGCGC     84960
     GCCGTCTGAG CGCTCGTCGA TGCCCTGTTC CTTCGCGACG ATAAAGAGGC CAGTTTTCGG     85020
     GTCGAGCGCG CCGAGCAGGT TGACGGCCGC TCCCTGATAA CCGCTGATGA TGGCCTGCAC     85080
     TCGAATCGGC TCGCTCATAG ACCCTCTCCC TCGAATACCT GCTCGCTCGT GACTTCGGTA     85140
     ACGACCGGAT AGCCAGCGGG CGCGGGCTTG CCGTCGTTCG GCTCACCGTC TTTCGGAGCC     85200
     TCAAACAGTG GCACATGCGC ACGCACGCTT AGGTCAACCG TGCAGACCGT CAAATCCTTG     85260
     ACATCGACCG GCACGGATAC CGCGCCGAGG TCAATCTGTT CGAGCGTGGC GCGGAACTGA     85320
     TGCGCCATGC CTGCGAATGG CACATCGAAC GTGAAGCGCC GCCCGCCGCC GCCGTCATCA     85380
     CCATTGGCGA ATAGGTTGAA CTGCATCGCG ATGCTGTGTG CAGAGTGCTT TTCCGCAGCA     85440
     ACGATGACGA TCTGCGCGCG GTACTCGTTG AAAGAGGTTC GCACCTTGAA TGCGCGCTGC     85500
     TCCGGGTCAT CGGGGTTCAT CACGTCGACA CGCGAGCCGA CGGCGATACC CCAGTCGGGC     85560
     GGCGCGGGCA TGAAGTCTTT CGACATGGCG ACGAACACAA TCGGCAGGCG GGAGGAGAGG     85620
     CCCGGCCCCG GATCGTTTTC GTTCTTGCGG TATTCCTTCA GCATTTCCTC GATCTGGTCG     85680
     ATCATGCGGC CGGGAACCCA CACCATAGCC TTCGAGAGGC CGCGCGCGGT GTATTCCTGC     85740
     ATTGAGGACG TGTCGGCGAC AAGCTGCCCG TAGAAGCGGC GCATATAGCC GCCGAGGCCG     85800
     ATTTCGAGAG GGGTCAGCAG GCTCACATTA CGCTCCGAAG TACTTGCGCG CGTAGGCCGC     85860
     GCCTGCGTTC TCGTCGCCTT CCTTCAGCGT GTCGAGCGAG ACGAGCGAGG CGGATGCAAA     85920
     GCTGTTGGCA CGCCGCTCGA AGTCGGCCGT CGCGCGCCGC CCCGTGAGCG TGGGCGCTTG     85980
     GTGCTCGCGC GCGCTGTCGA GCACGACGCC CGGCCGCGCG GCGGAGAGCA GCGACAACAG     86040
     TTCTTCGTTC TCCTCGCGCA GGCGTTCGAG TGCCTGCATC GCCAGCGTGT GATCTGCCTG     86100
     CAGCGAGTCG AAAATCAGGT TCATCGCCGC TTGCTGGTGG TGCATGTCGG TCATGACCGA     86160
     ATCGAACACG AGTTCATTCA TGTCGAGTTC GCCACTCGCG CTGTCGAACA CATAGCCGCG     86220
     GTTGGTCGTG TAGTTCGGCT CATGCACGTA GTCAAAGCCG CCGAACTTTT TCGGCACATG     86280
     CGCGAGGCCA TTCGGCACGG CCTGAATCGC GCTCGAAAAG CCGCCCGCCT TGCTGTCGTG     86340
     CAGGCGCGCG GCCATCTTGC CCGGCTCGGT ATCGAGGAAC TCGGTTTCGT GCTCGATGTT     86400
     GCCGTTCTCA TCGGCGCACA GGTACGTCGT GACGACGGCC GGTTCGAAGA AAATCTGCTT     86460
     GCCGTTGACC ATCGCCCACT CGGGCGGCTC GATGCCGAAC TTCACGCGGA TGCTGTGGCC     86520
     GTAGTAGCCA AGCAGGTCGC GGTTCCTCAC CTTCTCCTGC ACGGCGTCGC CGTTGACGAG     86580
     TGAGGCGAGC GCGCGCAGGT CGAAAAGGCG TTCCTTGCCG ACGTGCTCGC GCCCGCGCTC     86640
     GTGAACGTTA TAGACAATCT TTCCCGTCTT TTTACCCATG AGATACCCCG GTTAACTGAT     86700
     TTTGCCGATA GCCATAAGCG GCATGATTGC CTTCGCACCG TTGGCGAGGG CGAGGCCACC     86760
     CGCTGCGCCC TTGTTCTCGA ACAGGGTCGA GAGGCGCAGT TCAAGCATGA GGCGCGGCGC     86820
     GAGGGTCGAG CGGAACGCCT TCGCGATTTC GAGCAGCCCA AGGCCGTTAT CCGATGAAAC     86880
     CGGCAGCGTG ACGCGGATGC GGCCGGTACG AAAGTGCGTG AGCGGCGCAT CGGCCGTCAC     86940
     GCCGTCCGAG AAGTGCGCAA CGCCGTTGGC GTTCACCGTG TAGTCCGTGA CGGTCACGGC     87000
     CGCGCCGGTC GTGCCGATAT AGCGCGTGGG CGCGCCGCCC GCCTCAAGCT GCCCGCCCCA     87060
     TGCGTTGATA CCTTGCCCCA CCACGCCCGC ATATACCGTC GTATTACCGA ACGAGGGCGG     87120
     CGCGCCGATG AACGCGGCAA TGCCTTGGCT TGCGACATTC GGATTCGGAA TACCCGACAC     87180
     CGACACGCGC CACCATCCAT TGACGCCCAG CGAGGTAATC GTCGCCTTAG CGCCCGTTGC     87240
     TTTGCCCGCA TTGACGACGG CAGAATTGCC GGTGAGGAGG TCGAAATAGG CCGCGCAATA     87300
     GTTCGACGAC GCGCCGCTCG CGATCAGCCG GAGCACCACA TAGCGCCGCT CGACGGCCTG     87360
     CACGTAGATT GACCATGTAT TCCAGTCGGC CGCGTTCTGG CTGCTCACGC TCGAATGCTG     87420
     AACCGAGTGC GCGGCGTTGC TCGTGTCCGA GTCGGCGATT TTGGCCGCGG TCTGCGTGCC     87480
     ATCCGGCGCA ACTGCCGCGT TCGCCGTTGC CGTCATGAGC GTCTTGACCC ATGCGGCGTT     87540
     GTCGATCGGC CCGGAGTAGG TCAGGGAGTT CGTGCGCGGC GTCGTGTAAA GCTGCGTCTT     87600
     GCCCTGCCAG TCGGTCTTAT AGACTGTCGG CAACCCTTCC GGGTTGGACG CCATGTCATA     87660
     GACCGCGGAC ACGCCATTGG TGAGCGTTTT CGTGCCTAGC GGTGTGCGGT CAGCGGGATA     87720
     GTTCGCCGAG GTCGCGAGCG GATGCCAAAG CGGCTCGACG AGCCAGACAT TCGGCCAGAC     87780
     CGCCTGAAGG TATTGCTTCA GAAAGATCAT GCCGCGGCGC GGGTTGCGTG CGCGCGCCGC     87840
     CTGAAGCAAG AAGCTGGAAC GCGTCACGTC GCGCTTGACG ATGGCGAGGC CAGAATCCTT     87900
     CAGTGCGCGC TCGACGAGTT CCGCATCGCC CAAGTGCGGC ATACCGTACA GGTTCAGGCG     87960
     GCGCTCGTTC GCGCGAATCA TCGACTCGAA CACGGCGAGG AAAACCGCCT TCAGTTCGGA     88020
     TTCGAGCTGG TCGCGCTCGA AACTCTGCTG AAGGGGTTGC AGCGAGGGGG AGTCAACCGG     88080
     GATCAGGTCG GACATG                                                     88096
//

If you have problems or comments...

PBIL Back to PBIL home page