(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_2

ID   BURVG_2; SV 1; empty ; DNA; empty ; PRO; 265616 BP.
XX
AC   NC_009227;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-265616
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of plasmid pBVIE02 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-265616
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-265616
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000618.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..265616
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /plasmid="pBVIE02"
FT                   /db_xref="taxon:269482"
FT   gene            complement(12..1256)
FT                   /db_xref="GeneID:4947582"
FT                   /locus_tag="Bcep1808_7030"
FT   CDS_pept        complement(12..1256)
FT                   /locus_tag="Bcep1808_7030"
FT                   /gene_family="HOG000218158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sarcosine oxidase beta subunit family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bam:Bamb_4546
FT                   sarcosine oxidase, beta subunit family"
FT                   /db_xref="GI:134287531"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="GeneID:4947582"
FT                   /translation="MSRYSIFSLLRNGLSYHEHWERAWRSPEPKKEYDVVIVGGGGHGL
FT                   ATAYYLAKEHGVRNIAVIEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLS
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPEQIKEIVPVINLN
FT                   SRYPVLGASFQRRAGVARHDAVAWGFARGADQLGVDIIQNCQVIGIRREGGAVTGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGVRLPLESHPLQALVSEPIKPIINTVIMSNAVHAY
FT                   ISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIANDAPHPLNAPFSLDRFY
FT                   TGHLIDEHGAAAVAH"
FT                   /protein_id="YP_001109697.1"
FT   misc_feature    complement(39..1250)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Bcep1808_7030"
FT   misc_feature    complement(45..1172)
FT                   /note="Glycine/D-amino acid oxidases (deaminating) [Amino
FT                   acid transport and metabolism]; Region: DadA; COG0665"
FT                   /db_xref="CDD:31009"
FT                   /locus_tag="Bcep1808_7030"
FT   gene            complement(1269..2645)
FT                   /db_xref="GeneID:4947311"
FT                   /locus_tag="Bcep1808_7031"
FT   CDS_pept        complement(1269..2645)
FT                   /locus_tag="Bcep1808_7031"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: rso:RSp0045 probable L-serine dehydratase
FT                   (L-serine deaminase) protein; TIGRFAM: L-serine dehydratase
FT                   1; PFAM: serine dehydratase alpha chain; serine dehydratase
FT                   beta chain"
FT                   /db_xref="GI:134287532"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="GeneID:4947311"
FT                   /translation="MNVSTFDLFKVGIGPSSSHTVGPMIAASRFATRMRESGVLEQVRT
FT                   LRIELYGSLGATGKGHGTDKAVLLGLEGNLPDTVDPDYVEQRLVHIRTARSLDLAGVHR
FT                   IDFDEKTQLAFLRREVLPLHPNGMRFTALDERGAIVDAQAYYSVGGGFVVDDEGERLNG
FT                   RTSVQEVPYPFRTGVDLLRLCGESGLSIADVMLANETTWRNPQAVRAGLLTIRDVMAAS
FT                   IARGCSIEGTLPGPLKVRRRASAVYRQLKAQSEESLRDPLSMIDWINLYAMAVNEENAA
FT                   GGRIVTAPTNGAAGIIPAVLQYYTKFVAGSNDDGVVTFLLTAAAIGLLYKENASISGAE
FT                   VGCQGEVGVACSMAAGALAAVLGGTPEQVENAAEIGMEHNLGMTCDPVGGLVQIPCIER
FT                   NAMGAVKAVNAARMALRGNGKHYVSLDKVIKTMRETGADMKTKYKETSRGGLAVNVIEC
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_001109698.1"
FT   misc_feature    complement(1281..2639)
FT                   /note="L-serine dehydratase, iron-sulfur-dependent, single
FT                   chain form; Region: sda_mono; TIGR00720"
FT                   /db_xref="CDD:129803"
FT                   /locus_tag="Bcep1808_7031"
FT   misc_feature    complement(2205..2615)
FT                   /note="Serine dehydratase beta chain; Region: SDH_beta;
FT                   pfam03315"
FT                   /db_xref="CDD:146115"
FT                   /locus_tag="Bcep1808_7031"
FT   misc_feature    complement(1284..2090)
FT                   /note="Serine dehydratase alpha chain; Region: SDH_alpha;
FT                   cl12120"
FT                   /db_xref="CDD:159780"
FT                   /locus_tag="Bcep1808_7031"
FT   gene            complement(2653..3912)
FT                   /db_xref="GeneID:4947312"
FT                   /locus_tag="Bcep1808_7032"
FT   CDS_pept        complement(2653..3912)
FT                   /locus_tag="Bcep1808_7032"
FT                   /gene_family="HOG000239404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   glycine hydroxymethyltransferase; aminotransferase, class I
FT                   and II; KEGG: psp:PSPPH_4750 serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="GI:134287533"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:4947312"
FT                   /translation="MFSKEQTIAGFDPDLHEAMRLERQRQEAHIELIASENYTSPRVLE
FT                   AQGSVLTNKYAEGYPGKRYYGGCEHVDVVEQLAISRAKALFNADFANVQPHSGSQANAA
FT                   VYLALLTPGDTILGMSLAHGGHLTHGAKVSFSGKVFNAVQYGVDATTGLIDYDEIERLA
FT                   LEHRPKMIVAGFSAYSRVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFAD
FT                   VVTTTTHKTLRGPRGGLILARANEEIEKKLNSMVFPGTQGGPLMHVVAAKAVAFKEALG
FT                   PEFVTYQKQTLANARAMVEVFNARGYDVVSGGTDDHLFLVSLVKKGITGKDADAALGRA
FT                   HITVNKNTVPNDPQSPFVTSGIRIGTPAITTRGFLEADAAHTAQLMCDALDRLGDAQVE
FT                   AAVRTQVAQLCARFPVYLGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001109699.1"
FT   misc_feature    complement(2686..3879)
FT                   /note="Serine-glycine hydroxymethyltransferase (SHMT). This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). SHMT
FT                   carries out interconversion of serine and glycine; it
FT                   catalyzes the transfer of...; Region: SHMT; cd00378"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Bcep1808_7032"
FT   misc_feature    complement(order(3064..3066,3118..3120,3496..3501,
FT                   3604..3606,3625..3627,3670..3672,3694..3699,3751..3753,
FT                   3805..3807,3820..3822,3847..3852,3871..3873,3877..3879))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Bcep1808_7032"
FT   misc_feature    complement(order(2824..2826,3205..3207,3223..3228,
FT                   3301..3303,3310..3312,3385..3387,3535..3537,3616..3621,
FT                   3718..3720,3748..3750,3808..3810))
FT                   /note="glycine-pyridoxal phosphate binding site; other
FT                   site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Bcep1808_7032"
FT   misc_feature    complement(order(2824..2826,3223..3225,3535..3537,
FT                   3808..3810))
FT                   /note="active site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Bcep1808_7032"
FT   misc_feature    complement(order(2872..2874,3142..3144,3532..3534,
FT                   3538..3540,3550..3552,3721..3723,3742..3744))
FT                   /note="folate binding site; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Bcep1808_7032"
FT   gene            complement(3987..5198)
FT                   /db_xref="GeneID:4947313"
FT                   /locus_tag="Bcep1808_7033"
FT   CDS_pept        complement(3987..5198)
FT                   /locus_tag="Bcep1808_7033"
FT                   /gene_family="HOG000251728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="creatinase"
FT                   /transl_table="11"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: ppu:PP_3667
FT                   creatinase"
FT                   /db_xref="GI:134287534"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="GeneID:4947313"
FT                   /translation="MKMENLIRIENGEKVKHTFSDVEYASRQGKLRELMARENIDAVLF
FT                   TSYHNINYYSDFLYCSFGRKYGLVVTPKKVVSISANIDGGQPWRRTVGDYNVVYTDWQR
FT                   DNFFRAVQGEIENKGRVGIEFDHVPVEVMTKLKAALPSVEFVDIGAATMRMRMIKSDEE
FT                   IALIKHGANVCDVGGAALAAAVHEGVPEHEVALASTQTMVREIARRFPDSELMDTWTWF
FT                   QSGINTDGAHNPVTTRKVQKGDILSLNCFSMISGYYTALERTMFFDHCSDEHLRLWKVN
FT                   VEVHEAGLALIKPGVRCCDIAHELNKIYAEYGLLQYRTFGYGHSFGVLSHYYGREAGLE
FT                   LREDIETVLEPNMVVSMEPMIMLPEGLPGAGGYREHDILVIGETDATNITGFPYGPEHN
FT                   IIKA"
FT                   /protein_id="YP_001109700.1"
FT   misc_feature    complement(4017..5144)
FT                   /note="Xaa-Pro aminopeptidase [Amino acid transport and
FT                   metabolism]; Region: PepP; COG0006"
FT                   /db_xref="CDD:30356"
FT                   /locus_tag="Bcep1808_7033"
FT   misc_feature    complement(4725..5120)
FT                   /note="Creatinase/Prolidase N-terminal domain; Region:
FT                   Creatinase_N; pfam01321"
FT                   /db_xref="CDD:144790"
FT                   /locus_tag="Bcep1808_7033"
FT   misc_feature    complement(4026..4709)
FT                   /note="Creatine amidinohydrolase. E.C.3.5.3.3. Hydrolyzes
FT                   creatine to sarcosine and urea; Region: Creatinase;
FT                   cd01090"
FT                   /db_xref="CDD:29975"
FT                   /locus_tag="Bcep1808_7033"
FT   misc_feature    complement(order(4071..4073,4125..4127,4227..4229,
FT                   4419..4421,4452..4454,4503..4505))
FT                   /note="active site"
FT                   /db_xref="CDD:29975"
FT                   /locus_tag="Bcep1808_7033"
FT   gene            complement(5485..6501)
FT                   /db_xref="GeneID:4947314"
FT                   /locus_tag="Bcep1808_7034"
FT   CDS_pept        complement(5485..6501)
FT                   /locus_tag="Bcep1808_7034"
FT                   /gene_family="HOG000063196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: ppu:PP_3665
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="GI:134287535"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:4947314"
FT                   /translation="MSTSPLPRHAEPGRPNGMHDLRVMRYGFLLLDNFSLIALGAAVDP
FT                   LRIANMVVGRRVYDYQLIAAHGDVVQSSDGIRVVPDVALTDNATFDAVFVVGPNPIPCK
FT                   GIGAVIDWLRRQAGNGAALGGLDTGSYFLARAGLLNGYRCTIHWEDQDVLIEQFPKLTV
FT                   SNRLYEVDRDRFTCSGGVAPLDLMVHLLAMPPGSQALAARVLELLVAERRSREYRQRTS
FT                   LRQYIGAEHMKLDEALQIMESNVEETLSVAEIASHLRVSQRQLQRWFHERLGKTPAQAY
FT                   LEIRLLRARQLLYRTAAPLEEVCSRTGFTSTTHFATRYKAQFQISPMADRRRYQNAL"
FT                   /protein_id="YP_001109701.1"
FT   misc_feature    complement(5503..6450)
FT                   /note="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain
FT                   [Transcription]; Region: COG4977"
FT                   /db_xref="CDD:34583"
FT                   /locus_tag="Bcep1808_7034"
FT   misc_feature    complement(5911..6426)
FT                   /note="AraC transcriptional regulators having an N-terminal
FT                   Type 1 glutamine amidotransferase (GATase1)-like domain;
FT                   Region: GATase1_AraC_ArgR_like; cd03136"
FT                   /db_xref="CDD:153230"
FT                   /locus_tag="Bcep1808_7034"
FT   misc_feature    complement(6121..6123)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153230"
FT                   /locus_tag="Bcep1808_7034"
FT   gene            6799..7062
FT                   /db_xref="GeneID:4947315"
FT                   /locus_tag="Bcep1808_7035"
FT   CDS_pept        6799..7062
FT                   /locus_tag="Bcep1808_7035"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bpm:BURPS1710b_A1167 IS407A, transposase OrfA"
FT                   /db_xref="GI:134287536"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4947315"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKNLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT                   /protein_id="YP_001109702.1"
FT   misc_feature    6802..6999
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Bcep1808_7035"
FT   gene            7158..7919
FT                   /db_xref="GeneID:4947316"
FT                   /locus_tag="Bcep1808_7036"
FT   CDS_pept        7158..7919
FT                   /locus_tag="Bcep1808_7036"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bpm:BURPS1710b_1719 IS407A, transposase OrfB"
FT                   /db_xref="GI:134287537"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947316"
FT                   /translation="MLHYDAKPDHENEVLAARLVELAHERRRFGYRRLHALVEREGTHA
FT                   NHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKC
FT                   LTVVDDFTKEAVDIVVDHGISGLYVARALDRAARFRGYPKAVRTDQGPEFTSRALDQWA
FT                   YANGVALKLIQAGKPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQR
FT                   PHSALNYLAPSEFAAKHRATADTPAAFQELV"
FT                   /protein_id="YP_001109703.1"
FT   misc_feature    7230..7889
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: Tra5;
FT                   COG2801"
FT                   /db_xref="CDD:32633"
FT                   /locus_tag="Bcep1808_7036"
FT   misc_feature    7401..7742
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7036"
FT   gene            complement(7964..8056)
FT                   /db_xref="GeneID:4947317"
FT                   /locus_tag="Bcep1808_7037"
FT                   /pseudo
FT   gene            8192..8491
FT                   /db_xref="GeneID:4947318"
FT                   /locus_tag="Bcep1808_7038"
FT   CDS_pept        8192..8491
FT                   /locus_tag="Bcep1808_7038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287538"
FT                   /db_xref="GeneID:4947318"
FT                   /translation="MNNMRMLRRQVRRASLVTTSASVRLARLLLSEPKLFETMFPLLDE
FT                   IGQWLVSSVMQSAAQVRWHSMRRESQERGCSPVKSMEIVASCHQESYGTAAAGM"
FT                   /protein_id="YP_001109704.1"
FT   sig_peptide     8192..8287
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.450 at
FT                   residue 32"
FT                   /locus_tag="Bcep1808_7038"
FT                   /product="hypothetical protein"
FT   gene            complement(8555..8950)
FT                   /db_xref="GeneID:4947319"
FT                   /locus_tag="Bcep1808_7039"
FT   CDS_pept        complement(8555..8950)
FT                   /locus_tag="Bcep1808_7039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmv:BMASAVP1_0039 hypothetical protein"
FT                   /db_xref="GI:134287539"
FT                   /db_xref="GeneID:4947319"
FT                   /translation="MSARAARDLSLANHLTFVACKQGAGNPYLLNELIRFVYLTFYVQE
FT                   AGYGDTALIVYSRAEAALERCMTRAERDGVCQLDADDSPHFEAVLCQADRQIECAPLHY
FT                   LIEARERLERFARSSRQSPLPSASTVL"
FT                   /protein_id="YP_001109705.1"
FT   gene            complement(9219..9662)
FT                   /db_xref="GeneID:4947320"
FT                   /locus_tag="Bcep1808_7040"
FT   CDS_pept        complement(9219..9662)
FT                   /locus_tag="Bcep1808_7040"
FT                   /gene_family="HOG000258676" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B0567 hypothetical protein"
FT                   /db_xref="GI:134287540"
FT                   /db_xref="GeneID:4947320"
FT                   /translation="MKRFIFISLISLVALGAGILPTSVFAGTLDEQFTCKSNAHTFITS
FT                   LINSQLIDPAPIRVEANSVNAFRPAHGRDLAVYGLRVRAVFGFQPGDPTFRPGSGKSSS
FT                   SSVYGAMVFGSSEAVEAQLRQAGSPAVVQQVIPMMLSAIVCEI"
FT                   /protein_id="YP_001109706.1"
FT   sig_peptide     complement(9582..9662)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT                   /locus_tag="Bcep1808_7040"
FT                   /product="hypothetical protein"
FT   gene            10026..10367
FT                   /db_xref="GeneID:4947321"
FT                   /locus_tag="Bcep1808_7041"
FT                   /pseudo
FT   gene            10487..10576
FT                   /db_xref="GeneID:4947322"
FT                   /locus_tag="Bcep1808_7042"
FT                   /pseudo
FT   gene            complement(10613..11449)
FT                   /db_xref="GeneID:4947323"
FT                   /locus_tag="Bcep1808_7043"
FT   CDS_pept        complement(10613..11449)
FT                   /locus_tag="Bcep1808_7043"
FT                   /gene_family="HOG000118817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bte:BTH_I1930 transposase"
FT                   /db_xref="GI:134287541"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947323"
FT                   /translation="MKTVCEVLGVARSGVAAKRTRSSDWQDGRSTRPTDDTELVEEIQA
FT                   HVAHLPTYGYRRIWALLRRSREMVGAPCINHKRVYRVMREHQLLLRRPGVRRDKHRHDG
FT                   RVAVDRSNTRWCSDGFEFRCDDGTPLRVTFALDCCDREAISWAATTGGHSGDVVRDVML
FT                   AAVEQRFGTTQTAQPIEWLTDNGSAYIDHRTRRFARELGLEPLTTPVRSPQSNGMAESF
FT                   VKTMKHNYVAYMDKPDAPTALSRLAAAFEHYNERHPHKALKYRSPREFRRTAASST"
FT                   /protein_id="YP_001109707.1"
FT   misc_feature    complement(10625..11440)
FT                   /note="insertion element IS2 transposase InsD; Reviewed;
FT                   Region: PRK09409"
FT                   /db_xref="CDD:169843"
FT                   /locus_tag="Bcep1808_7043"
FT   misc_feature    complement(10769..11128)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7043"
FT   gene            complement(11446..11844)
FT                   /db_xref="GeneID:4947324"
FT                   /locus_tag="Bcep1808_7044"
FT   CDS_pept        complement(11446..11844)
FT                   /locus_tag="Bcep1808_7044"
FT                   /gene_family="HOG000266654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bch:Bcen2424_6834 transposase IS3/IS911 family protein"
FT                   /db_xref="GI:134287542"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4947324"
FT                   /translation="MQSIPSHYVEPIEILTEPERRRRRTAQEKIAIVQETLAPGASVSA
FT                   VARRHGVNPNQVFGWRKQYQEGSLAAVQAGETVVPASELAAVIKEIKELQRLLGKKTME
FT                   VEILKEAVEWGRSKNLIARSPLLPGDDH"
FT                   /protein_id="YP_001109708.1"
FT   misc_feature    complement(11455..11793)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Bcep1808_7044"
FT   misc_feature    complement(11494..11793)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG2963"
FT                   /db_xref="CDD:32783"
FT                   /locus_tag="Bcep1808_7044"
FT   gene            complement(11989..12951)
FT                   /db_xref="GeneID:4947325"
FT                   /locus_tag="Bcep1808_7045"
FT   CDS_pept        complement(11989..12951)
FT                   /locus_tag="Bcep1808_7045"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ajs:Ajs_2927 transposase, IS4 family protein"
FT                   /db_xref="GI:134287543"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:4947325"
FT                   /translation="MKQTDLGLNLSTKRTRKREFLDEMNRVVPWADLVMLIAPYAPEGK
FT                   RGRPPFALEAMLRIHFLQQWFGLSDPAMEEALHDVPLYREFAGLDNWTMRLPDESTILR
FT                   FRHLLEKHKLAAQILAVVNDILRDKGLMLRAGTVVDATLISAPSSTKNASGERDPEMHQ
FT                   SKKGNQWYFGMKAHIGIDAESGLVHTVRGTSGNISDVLEANSLLHGEETDAFGDAGYQG
FT                   VHKRPDTRPGVNWHVAMKPGKRRILDKSKPLDALIDQVERIKAGIRAKVEHPFRVIKRQ
FT                   FGCTKVRYRGLRKNTVQLTTLFALSNLWMARGTLLDAKA"
FT                   /protein_id="YP_001109709.1"
FT   misc_feature    complement(12583..12813)
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bcep1808_7045"
FT   misc_feature    complement(12001..12777)
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bcep1808_7045"
FT   gene            complement(13001..14383)
FT                   /db_xref="GeneID:4947326"
FT                   /locus_tag="Bcep1808_7046"
FT   CDS_pept        complement(13001..14383)
FT                   /locus_tag="Bcep1808_7046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_1317 hypothetical protein"
FT                   /db_xref="GI:134287544"
FT                   /db_xref="GeneID:4947326"
FT                   /translation="MTRRFDILLTGSAPPVHDPWCWRDDWHAPGESAFSLLAKFQRLNA
FT                   LSCSALAESFASLQGRRTPPQDLDLRDARRFDLPRMRDMLRLRLADIAAAFVMPSGAIQ
FT                   RISSPTLRWCVQCAQQGVHLAVFQYRRVDQCPVHRTPLVERCERCDKPIPYRLRADLFR
FT                   APFNCPSCGNAWWVPAQGLDDIRVGQPYRRRLGKRARHVRLTVQEPTGSEEICCATGGL
FT                   PSTSDELPPVSEYQLPLQEMSWVRFGAGGQAEADDPWPEEATQDKFLGDRDAQEHACYK
FT                   AVRRRIMRMYGRNHRACIKSAARHLIWPLCGGTTTSCCPVALAYLRWRCKWEGVRIPRS
FT                   LLQQPVHGPLGLTVWLSLHAPVAPRAWSREAAHWLTLHALAQACMDSFYAYLEEAQGAG
FT                   ARRMLWLPFPVHDFLRRGIVMRGGASPDDPPQQLCIMPFDPRYGYRSLAWQPGTAKETL
FT                   HK"
FT                   /protein_id="YP_001109710.1"
FT   gene            complement(14380..15372)
FT                   /db_xref="GeneID:4947327"
FT                   /locus_tag="Bcep1808_7047"
FT   CDS_pept        complement(14380..15372)
FT                   /locus_tag="Bcep1808_7047"
FT                   /gene_family="HOG000156850" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_C6245 hypothetical protein"
FT                   /db_xref="GI:134287545"
FT                   /db_xref="GeneID:4947327"
FT                   /translation="MLDTLKRPVDVSEHPLLSQSYIVPTPAIAAMYARIRQCLRRGVTG
FT                   AVIYGHTRWGKTYAVRYCVRLLRHELPRIVVLTLGMPQNPSRSESLFFGMLLDVAQHAR
FT                   PDSGTALQRRLRLYHKLAELVARVSGNTLVIFVDEAQRLELEHYEWLRDVQDELGRRGI
FT                   RMFAFLVGQPGILNRRSAFRQNVDTSQIVARFMIDEMRFAGMQQAADLKMSLAAYDSSI
FT                   FPEGSDWTYTRFFLQRAYDTGFRLGAQQKVLWEAFDAAHRIARFDFPMEIPMEYLARSV
FT                   EIALTRNMEHDSVRFELSRACWDEAVEESSFVAALEALRIIFVDEAGPT"
FT                   /protein_id="YP_001109711.1"
FT   misc_feature    complement(<14896..>15309)
FT                   /note="Uncharacterized ATPase, putative transposase
FT                   [General function prediction only]; Region: COG2842"
FT                   /db_xref="CDD:32670"
FT                   /locus_tag="Bcep1808_7047"
FT   gene            complement(15377..17359)
FT                   /db_xref="GeneID:4947328"
FT                   /locus_tag="Bcep1808_7048"
FT   CDS_pept        complement(15377..17359)
FT                   /locus_tag="Bcep1808_7048"
FT                   /gene_family="HOG000263264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_C6244 hypothetical protein"
FT                   /db_xref="GI:134287546"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="GeneID:4947328"
FT                   /translation="MRAIVFGTLRFDRRSIPAELADVSQWPCADDSALDEPARLLFARR
FT                   VRAMTLFVDGTTALQAIGRETGLRINDLYRLFERCTTPHEDGRIYGCRALLPWLHTRPY
FT                   ERRAQVTTSGTDGASGAFGQLLLRYPEIAHWIERKVAARSRRGTKLEEVHRQIWRLHAG
FT                   FLAQCRQAGIQAHEYPFNRKHLGERSLANYLHKLAGQQFASAARAAGAEQIGHAWQADV
FT                   EEVRKTATYPYEVVEFDGHKLDVRLTLRIDDPFGFETLLVMHRIWVLVLLDVASRAVIG
FT                   YALAPGCEYNRDDVAQALQAALMPHAAREPKIPALSVRPGGGFPSEIIPQTAWACWSTL
FT                   RFDAARAHFAKATLERLTTVVGCATDNGPLGQKNERAFIERFFDQLASHFAHRLPATTG
FT                   RDPRSVERALSDVGGDTSLMMTLDELEDVIDVVLANYNGEPHTGLGGRSPLEAMQFQIA
FT                   RREGLLRTVPEARRSTLCLLQEARIVTIRGNVSRGVRPHVNFEYVRYDSRLLSGMTGLI
FT                   GQQIRVYFNVKDVRHLHAFFMNGAELGVLTAARPWCFTPHSLRVRQEIFALMRQRKLAW
FT                   REGDDPVGAWFAWKKEQARKHAREANDLARMLTDRAKAHAPQPPQQSTATVGKESPAAP
FT                   DIVRPPTPALPKGESTPWLTKIFTY"
FT                   /protein_id="YP_001109712.1"
FT   gene            complement(17356..17997)
FT                   /db_xref="GeneID:4947329"
FT                   /locus_tag="Bcep1808_7049"
FT   CDS_pept        complement(17356..17997)
FT                   /locus_tag="Bcep1808_7049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_C6243 hypothetical protein"
FT                   /db_xref="GI:134287547"
FT                   /db_xref="GeneID:4947329"
FT                   /translation="MRSPRFRRAATDARPYGAHRFDVFGPKVGRRLTLFGRRVFQLWLR
FT                   LESNPQVVTYCERPLLVPEARGTRAADFWVCTDQGEQLHLVLRSSEATLVEQGISLYPA
FT                   LDAWSQAHSMTVRTILPDELDDPEPLCQNRLTMLNYLAANTVPARDEICRAILIACIRG
FT                   LTLAKLEQRFASIDPVLVRTAAFALLLKGGLDCPTIASRPLGPDSCLETK"
FT                   /protein_id="YP_001109713.1"
FT   gene            18305..20410
FT                   /db_xref="GeneID:4947330"
FT                   /locus_tag="Bcep1808_7050"
FT   CDS_pept        18305..20410
FT                   /locus_tag="Bcep1808_7050"
FT                   /gene_family="HOG000220306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   rme:Rmet_6086 phage integrase"
FT                   /db_xref="GI:134287548"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4947330"
FT                   /translation="MLPSTSSTCDFQHFLPGDGISNSSFRNLRSKSCIRDPGRSRLNRI
FT                   ITAEPVQFLLHRTLAELADQYLEFGRDARKAAATRTWLVTAFVGAARKRHDFATARLLA
FT                   IRPAALAAPAVPTVPTPSLEDFAAEHDPDGFYTEKELLDLFTAQHASDSADAGATLRRQ
FT                   QRNARLRARQMAALDALARLLVEDPQPEHHVLGWFDTAVALRLADVGIDTIGRLVETIN
FT                   AVGYRWYRSVPRLGEIGARRITAWLEHYGDVDGLRIATNARVHPSERTLPVPALTRAPA
FT                   TGIVPLEYFLIPADLDGSRGANRNPLKNNSGAHNDLQAIDFWLADYENPHTRDKYRAEA
FT                   ERLLLWAIFAKRKPLSSLDVNDARDYINHFLVDPQPAAMWVMERAMPRADPAWRPFRGP
FT                   LSVKSRQDALAALKKCFGDLVAAQYLDHNAFTKIRVFLGTELDAAGNERRVAAKPRIQA
FT                   ERSLTKEAWAFAMRVLDALPDSASAARLRFVLAFAYSTGLRRAELCGAFTDDIVQRYAG
FT                   AELGTIHLLRVVGKGAKERFVPLVPAVLDALGDYLVTRGFPRDPLACPLGTPLIPALLD
FT                   NREIGRVRREAAASGADPDAAVAALTRRDRPVHPDRLYRAVKRFFATATEAAMREDSPH
FT                   ARAFSAASTHWLRHTFVSHALANGMSLESARNFAGHDSLDTTSIYATAELGRQYREAET
FT                   FLSRASK"
FT                   /protein_id="YP_001109714.1"
FT   misc_feature    18857..19120
FT                   /note="Phage integrase protein; Region: DUF3701; pfam12482"
FT                   /db_xref="CDD:152916"
FT                   /locus_tag="Bcep1808_7050"
FT   misc_feature    19292..20380
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Bcep1808_7050"
FT   misc_feature    19685..20350
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Bcep1808_7050"
FT   misc_feature    order(19799..19804,19895..19897,20231..20239,20342..20344)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7050"
FT   misc_feature    order(19799..19801,19895..19897,20237..20239,20246..20248,
FT                   20315..20317,20342..20344)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7050"
FT   misc_feature    order(19799..19801,20237..20239,20246..20248,20315..20317,
FT                   20342..20344)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7050"
FT   gene            20699..20953
FT                   /db_xref="GeneID:4947331"
FT                   /locus_tag="Bcep1808_7051"
FT   CDS_pept        20699..20953
FT                   /locus_tag="Bcep1808_7051"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287549"
FT                   /db_xref="GeneID:4947331"
FT                   /translation="MEIARCACYRSTALLPAHPGISTWRPSQETVDMLLEINKKPSILY
FT                   NAQRFYTHHYDVPLDLHVEIGINPNSNLHVEIGDGNRMP"
FT                   /protein_id="YP_001109715.1"
FT   gene            20971..21654
FT                   /db_xref="GeneID:4947332"
FT                   /locus_tag="Bcep1808_7052"
FT   CDS_pept        20971..21654
FT                   /locus_tag="Bcep1808_7052"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   bxe:Bxe_B3028 putative partition protein ParA"
FT                   /db_xref="GI:134287550"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:4947332"
FT                   /translation="MGLVFAVANQKGGTGKTTTTINLAGAFHAAGYKPLVADADAQNSC
FT                   LRWNAVADDGNPLPFKIVSVASHGKQIGSVITQLAEDSEIVLVDCPPSIESPITARVLM
FT                   VADATIIPTDSSPLDLWSSEGMIRLVEQTRAVQPNGKYAILLNKANPKTQLHKQMKELL
FT                   SESKVHLLSTTIKNREVYKLAAALGRTVFDVKGLRSDAVKPARNEVAALLEELIAFYNT
FT                   EEDAE"
FT                   /protein_id="YP_001109716.1"
FT   misc_feature    20980..21633
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="Bcep1808_7052"
FT   misc_feature    20980..21411
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7052"
FT   misc_feature    21001..21021
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7052"
FT   misc_feature    order(21019..21021,21235..21237)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7052"
FT   gene            21651..22721
FT                   /db_xref="GeneID:4947333"
FT                   /locus_tag="Bcep1808_7053"
FT   CDS_pept        21651..22721
FT                   /locus_tag="Bcep1808_7053"
FT                   /gene_family="HOG000267496" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="parB-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: bur:Bcep18194_C7738
FT                   ParB-like partition protein"
FT                   /db_xref="GI:134287551"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:4947333"
FT                   /translation="MSRKLDLKSKVRVGMHAERSDVDARLKNSGVVETAQSDAAHILEP
FT                   DSRAVSDEKPTPIVDAPIERPGDQRIHILSIADCIGNPYNPRAFYSPQSIDALAATLDR
FT                   EEQLQPIIFTELPEFPGKKIIVDGERRKRALKSLGRTTVLGVYRGNLSPKSLFMLAYRA
FT                   NKERDDQTVFDDAVSWQRLLNEHVYRDQLELAAAVGEDKGVVNKVLLLNTLPMPLLQRM
FT                   VDNADKVKLSHAYNIKLICDKAGEAVAEHWLDQVIAGQASVRKLEQVATSEKTAARGAK
FT                   RTHYESRVKFASPSGFELGELKAFADGRAELNLKGIKGEAQERLIDKLTAVVQSWALEL
FT                   QADDVDVPPRATQSAA"
FT                   /protein_id="YP_001109717.1"
FT   misc_feature    21870..22094
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bcep1808_7053"
FT   misc_feature    21900..>22352
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Bcep1808_7053"
FT   gene            complement(22844..24115)
FT                   /db_xref="GeneID:4947334"
FT                   /locus_tag="Bcep1808_7054"
FT   CDS_pept        complement(22844..24115)
FT                   /locus_tag="Bcep1808_7054"
FT                   /gene_family="HOG000220945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6195 hypothetical protein"
FT                   /db_xref="GI:134287552"
FT                   /db_xref="GeneID:4947334"
FT                   /translation="MQIALFQMPEMPDPFRKAVPAIHIAPKTGPISLQQAKTWNALIKN
FT                   AIEQRKEGERTWFEYSIGDLISDVGLNSKNREFVKATINSLLGFVVNWDQLAAKSEWNA
FT                   SALLAGAKISGGTLKYQFSDNISELLLSPEVYASIDMRIARTFKRGYALTLWENVVRYE
FT                   GVGQTGKMKVNTLRDLLLGMDWGQGSYAEYKIFKSRILVPALREINDVSDHEIVMKEEK
FT                   TGRSVTEVRFFITPKRKSEATSEEDLDVLTAMTKLSVPLSEARKLLGQHGPEAVRQALA
FT                   YTDVRVKKKNAQPLDNVASYFRKALVNGYQLENGRGKPDSSVVSIASSPEQAEDKLLSK
FT                   LLAERAEQARGYFNELDSGEQGDCVNRYNESQVASQLKLVAGKKPKKAAEQAFFHWLAE
FT                   DVWGKPTDRDLLNFVLAGGGANSR"
FT                   /protein_id="YP_001109718.1"
FT   misc_feature    complement(23414..24022)
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:174750"
FT                   /locus_tag="Bcep1808_7054"
FT   gene            complement(25276..25887)
FT                   /db_xref="GeneID:4947335"
FT                   /locus_tag="Bcep1808_7055"
FT   CDS_pept        complement(25276..25887)
FT                   /locus_tag="Bcep1808_7055"
FT                   /gene_family="HOG000263265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287553"
FT                   /db_xref="GeneID:4947335"
FT                   /translation="MNFEYPRCTPIPFDSSNDPTVAKNEVFRCRLIAIARHQDLRRADS
FT                   PPIVMGAFYREQLGLSLWPSQAKLAMDLKVSKAIVARSIQASLLPAEVITAFGGPRGIS
FT                   FRTAETVAALMRELGREVVVRRALTVPSQAAPARVKAILCTGVADIADGITLAFSLGGS
FT                   GRYIRVDSANIEDVVPHLSALERLVNTLLPSLLGLSPKAK"
FT                   /protein_id="YP_001109719.1"
FT   misc_feature    complement(25546..>25797)
FT                   /note="ParB-like partition proteins; Region: parB_part;
FT                   TIGR00180"
FT                   /db_xref="CDD:161748"
FT                   /locus_tag="Bcep1808_7055"
FT   gene            26263..26979
FT                   /db_xref="GeneID:4947336"
FT                   /locus_tag="Bcep1808_7056"
FT   CDS_pept        26263..26979
FT                   /locus_tag="Bcep1808_7056"
FT                   /gene_family="HOG000263266" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6301 hypothetical protein"
FT                   /db_xref="GI:134287554"
FT                   /db_xref="GeneID:4947336"
FT                   /translation="MRFPRLFPRNKKQVALSPAPGHYSNDDPEKIIFDQGTRLRVEANH
FT                   WKTFCFILAIIAGGAVYTRQPPPSVVRSYGVSSDAGGNPLVKQLAAYNPDDQAKRTAIK
FT                   QDVEHWFTIEPVLTDDIRTSRLAKNINAVKAKMVGNAKNQFAAWISEDKPFDQITTNPK
FT                   LVRETRVTNVSLLDDATAVVEFTTSTRQSPAEKPVDIRFALTIRYQIIPPTAEDVLGTN
FT                   PYGLYYPFFTLQKTGA"
FT                   /protein_id="YP_001109720.1"
FT   misc_feature    26359..26967
FT                   /note="VirB8 protein; Region: VirB8; cl01500"
FT                   /db_xref="CDD:174634"
FT                   /locus_tag="Bcep1808_7056"
FT   gene            26976..27851
FT                   /db_xref="GeneID:4947337"
FT                   /locus_tag="Bcep1808_7057"
FT   CDS_pept        26976..27851
FT                   /locus_tag="Bcep1808_7057"
FT                   /gene_family="HOG000263267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbG/VirB9/CagX"
FT                   /transl_table="11"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: rme:Rmet_6300 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="GI:134287555"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="GeneID:4947337"
FT                   /translation="MKRTRTLLSWGALAFIAASANAFAAKNAASPIAPIPSFDVGSIIG
FT                   DAMSPVNPYNSGTDPITMPGDARMAVFSYSRDKIFRVMTAPLKLTTIELERGETLISEP
FT                   AMGDSVQWVLDTDGANHVYVKPTKPGLVNTLHLSTNKREYELTLVSSPLGGLFYQNVRF
FT                   NYPNSLMAKVRARSDATEDDLEAKHDSQSDSGPIGVSPDKLNFDYTVSGTSSLKPETVF
FT                   DDGTFIWIRMPSRTPFAVPTIKDGGDIVSPNFIRRGPYIVIQRLADEVKLTRPGEEVTI
FT                   TRGRRGLFGF"
FT                   /protein_id="YP_001109721.1"
FT   sig_peptide     26976..27050
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_7057"
FT                   /product="hypothetical protein"
FT   misc_feature    <27219..>27677
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cl11423"
FT                   /db_xref="CDD:175248"
FT                   /locus_tag="Bcep1808_7057"
FT   misc_feature    27576..27830
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cd06911"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bcep1808_7057"
FT   misc_feature    order(27591..27611,27624..27641,27786..27788,27801..27821)
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bcep1808_7057"
FT   gene            27858..29132
FT                   /db_xref="GeneID:4947338"
FT                   /locus_tag="Bcep1808_7058"
FT   CDS_pept        27858..29132
FT                   /locus_tag="Bcep1808_7058"
FT                   /gene_family="HOG000263269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugation TrbI family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   rme:Rmet_6299 conjugation TrbI-like protein"
FT                   /db_xref="GI:134287556"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="GeneID:4947338"
FT                   /translation="MAKQTDPTSPEEKALFKGKVPRNVMIAVGAIAALAIGGLGFYTQT
FT                   IEANKAEAEALQAKRERAAEAVERSSANKTDVDKIIEEQQAEARRRAAEAAAASSAAAA
FT                   ANAKKPTLSADAVLPTGNTEELKASNDQDSIFVSPIFRAGVKVKDAQPQQPQLPNGVIS
FT                   PQQMLLQQAAAQDAAVKEATAQAALASRGGQGVGAMTTQKRDTAFLNDVAQLSEGNKDF
FT                   ARTGIVGQSHGCTLSPPAKIPVLSSEALNSDRPGTASLIVESDVYANNGDGRCLVIPWG
FT                   TTIVAPYSSDIQPGQESILVAGAEMRLPNGKHVPLYGAQGANGDGAAGFSGHVNNHFLR
FT                   IYSTSFLTAILVRAFSNSDQSTTTGPLGVTQAGSTAGQIAAQTAQSVLDRYKNIPPTIT
FT                   SSPGERHFMLKVNRDMVLEQYRGPR"
FT                   /protein_id="YP_001109722.1"
FT   misc_feature    28557..29108
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:174812"
FT                   /locus_tag="Bcep1808_7058"
FT   gene            29129..29935
FT                   /db_xref="GeneID:4947339"
FT                   /locus_tag="Bcep1808_7059"
FT   CDS_pept        29129..29935
FT                   /locus_tag="Bcep1808_7059"
FT                   /gene_family="HOG000263270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   rme:Rmet_6298 hypothetical protein"
FT                   /db_xref="GI:134287557"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947339"
FT                   /translation="MIARAAFAVAFALACAQAQSAVIAQVISPVSVVIQDGATRRVAML
FT                   PGKPVYYCGLDAFVDWASPLIGQPVRSSRDAGITVSIDGRDVALDDLFIDRGWLQPPVL
FT                   DEGAQVALAERRGGWACSRAVVPFELLHTNVDPKILAGIALNESNYRGRAWPWTLNVAG
FT                   QGYFFKSREEAYKAIESLLARDRCDFDVGLMQVNWCYHGKRFASAWAALAPATNVAAAE
FT                   AILTENFARTDSVAKAVAYYHSANPTPGRAYLARFAQHLSMIEAGL"
FT                   /protein_id="YP_001109723.1"
FT   sig_peptide     29129..29191
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 21"
FT                   /locus_tag="Bcep1808_7059"
FT                   /product="hypothetical protein"
FT   gene            29932..31197
FT                   /db_xref="GeneID:4947340"
FT                   /locus_tag="Bcep1808_7060"
FT   CDS_pept        29932..31197
FT                   /locus_tag="Bcep1808_7060"
FT                   /gene_family="HOG000263271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6297 hypothetical protein"
FT                   /db_xref="GI:134287558"
FT                   /db_xref="GeneID:4947340"
FT                   /translation="MKYTIKFLACAASAIVCAAASAANTDPFDFDYDILGGISERPALI
FT                   FNDGEKTYIQPRAGQVIVADGGHTEGPYVVVEGTPSSITYKVGAHSATARWKKANTFIG
FT                   GTGALAAMKDDQPAGFDGFTNRLVMIGTRSALEPVRAIRASMTVGGFVKALVPQGWTGS
FT                   AQKDVDLTTLEQFGTRDGENWMQALDRLMAQTELYADVDFTARHVRLHRDAPKSAALNY
FT                   ASSSRDADEAGLNRVVAQVTAEAPPVSRLAERFGAQAIRDGDDTHIQIRFTSKPAKTVT
FT                   FKTPDGKALHPSWDDTKNVLTLDRAERFVVADESNHVEVTRDAKTVYDFDQPNAAKLEA
FT                   VFDREGRTYFKFSGSVVRVGVTDARNLGIGEQKGRYFMFEGTSDLFTVTADGNTIHVKR
FT                   RKEVVYREVPDATLQAGGGPAS"
FT                   /protein_id="YP_001109724.1"
FT   sig_peptide     29932..30000
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7060"
FT                   /product="hypothetical protein"
FT   misc_feature    30004..30195
FT                   /note="VirB9/CagX/TrbG, a component of the type IV
FT                   secretion system; Region: VirB9_CagX_TrbG; cd06911"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bcep1808_7060"
FT   misc_feature    order(30019..30039,30052..30069,30181..30183)
FT                   /note="VirB7 interaction site; other site"
FT                   /db_xref="CDD:132874"
FT                   /locus_tag="Bcep1808_7060"
FT   gene            31197..31619
FT                   /db_xref="GeneID:4947341"
FT                   /locus_tag="Bcep1808_7061"
FT   CDS_pept        31197..31619
FT                   /locus_tag="Bcep1808_7061"
FT                   /gene_family="HOG000222008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bch:Bcen2424_1355 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:134287559"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947341"
FT                   /translation="MRIVPIVAAVLAFTALPSRADCLDDAAAFHGVNPQLLRVIAQHES
FT                   GMRPNAVNRNTNGSEDIGLMQINTSWLPTLARYGIRREHLFNGCVSAYVGAWILASNVR
FT                   RFGPNWKAVGAYNAVTPSKQLVYASAIYRRFMQQGR"
FT                   /protein_id="YP_001109725.1"
FT   sig_peptide     31197..31259
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.961 at
FT                   residue 21"
FT                   /locus_tag="Bcep1808_7061"
FT                   /product="hypothetical protein"
FT   misc_feature    31296..>31550
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7061"
FT   misc_feature    order(31326..31328,31398..31400,31488..31490,31542..31544)
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7061"
FT   misc_feature    31326..31328
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7061"
FT   gene            31622..32179
FT                   /db_xref="GeneID:4947342"
FT                   /locus_tag="Bcep1808_7062"
FT   CDS_pept        31622..32179
FT                   /locus_tag="Bcep1808_7062"
FT                   /gene_family="HOG000263272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6295 hypothetical protein"
FT                   /db_xref="GI:134287560"
FT                   /db_xref="GeneID:4947342"
FT                   /translation="MQKTLSNHARARALVAAALAVVHLAAYAGVDLAAKSIDADGWQVL
FT                   ASAPKPQPVAAEGAKQAQLLAVPAPAPTSTTAGPSTDVAAVMLPGAGAPAASGTLTFSV
FT                   TPADVNLRDALDRWLQQQGWQLAWKIDDDLPLEFNATFTGDFTSVLQQVMKATNHMRTP
FT                   TRACRHSNNVIRVIVRAGNCQD"
FT                   /protein_id="YP_001109726.1"
FT   sig_peptide     31622..31708
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_7062"
FT                   /product="hypothetical protein"
FT   gene            32185..33789
FT                   /db_xref="GeneID:4947343"
FT                   /locus_tag="Bcep1808_7063"
FT   CDS_pept        32185..33789
FT                   /locus_tag="Bcep1808_7063"
FT                   /gene_family="HOG000263273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Type II secretory pathway component PulD-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_5240 type II and III secretion system
FT                   protein"
FT                   /db_xref="GI:134287561"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947343"
FT                   /translation="MRVHLLKSAVAIAVALMGAGCAVTQQDVNDSYDAAHRTISEALGK
FT                   GPAPMALVEDVPTAFLGDRLVPLAYEATLPAVFRDKTVTLPANLGIRQIATLISTATGY
FT                   PVHLSPDVFVPRDSLVPGQTESKGQSNSARTEEPVYRQAFSGKTGMYMRNMTTDLGLDW
FT                   SFDGSTINVNRFVTRMYQIAAIPGKVSIKSTMSKGMDTSTGNQSASGGGGSSGGNTGSF
FT                   SAQTSTGREGDFDQIASITAEIDKLKSPMGRVSVNPQSRLVMVYDTKEAADNIGKLLNH
FT                   ENAISTRQVAITVRTLQIALNKGSQAGMNADVVFNAMHAGLARYAISFMSPTSLATGGG
FT                   SVGVSVLRPDAPFSGTNAVVNALNQYGRTVQDNTMTKMTLNGLPVSIASFKSDDYLRST
FT                   TPSSGSLTATSGGVPGLTPGTITTGDFVNVLPAVNDHNQIVLAYWADSSKLNGPFTSAG
FT                   AGSGQTQQQIQLAHTVGTKDDQTIALSDGQTVVLYGAITDQADSTTNTGIAGLTGSWNK
FT                   AKTFQVIMLKATVVPSM"
FT                   /protein_id="YP_001109727.1"
FT   sig_peptide     32185..32259
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.477 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_7063"
FT                   /product="hypothetical protein"
FT   misc_feature    32374..33777
FT                   /note="type IVB pilus formation outer membrane protein, R64
FT                   PilN family; Region: pilus_B_mal_scr; TIGR02520"
FT                   /db_xref="CDD:162902"
FT                   /locus_tag="Bcep1808_7063"
FT   misc_feature    32944..33777
FT                   /note="Bacterial type II and III secretion system protein;
FT                   Region: Secretin; cl02829"
FT                   /db_xref="CDD:164025"
FT                   /locus_tag="Bcep1808_7063"
FT   gene            33795..35117
FT                   /db_xref="GeneID:4947344"
FT                   /locus_tag="Bcep1808_7064"
FT   CDS_pept        33795..35117
FT                   /locus_tag="Bcep1808_7064"
FT                   /gene_family="HOG000263274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287562"
FT                   /db_xref="GeneID:4947344"
FT                   /translation="MMHITEPLPSDKRARLVFGIDWRAYPVKGGKAERRRYADAFGATH
FT                   YVEFKVGTEQIGGFAMPDTSELKGAQLYSGAARVALHDRIKNRAAALVLLQDEQRVYAV
FT                   FVVRGAVRSDEVLTPEAAQSRRLEIEQECLKSNLSLVTLGAGDRIGDVDEPFQASELLA
FT                   SRKAGRISRLPVSVPTILPVAAIIVGAFLGVPKLMDVLSPPPPPPRTPTFAEQYAAAVQ
FT                   ETFAKPRPRASQLAPALLAAVGGSETVIKGWLFQEANCPSSGYCTITFRRHGGTFSGFA
FT                   QAATASMRPVVFARDGLTLTSRGAAVPTVARLVESESSKWPTAQAFIEQLQTPPQRMSA
FT                   QTYELHSYGYTVTIEEARPLIAVAGAGTHVGRVIKQGDWTIDGFRWQSPLLEKLPPNMA
FT                   LESLQVQLRLKEGVAPTTSSDTGDSPYGVHFTAKGKYYVFD"
FT                   /protein_id="YP_001109728.1"
FT   gene            35104..35685
FT                   /db_xref="GeneID:4947345"
FT                   /locus_tag="Bcep1808_7065"
FT   CDS_pept        35104..35685
FT                   /locus_tag="Bcep1808_7065"
FT                   /gene_family="HOG000263275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287563"
FT                   /db_xref="GeneID:4947345"
FT                   /translation="MSLIKHVLIAAGVGVAVSAHADPVGARLSIGDIDQLARANVVRSL
FT                   GGSAPGVPMLPPRAMSQPQPGIAASGIAANASPKPIDKPARPVRPLADPVSFLGAFNDE
FT                   AGSHVLYSYRDAIYPARVGATLLNGWSVKAVDGYAVTVAEGKRTWKEPIRGVAPVQMSP
FT                   ATAAIRSLVDLSSPLPTGAPLPGVPLGGTQ"
FT                   /protein_id="YP_001109729.1"
FT   sig_peptide     35104..35169
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7065"
FT                   /product="hypothetical protein"
FT   gene            35682..37922
FT                   /db_xref="GeneID:4947346"
FT                   /locus_tag="Bcep1808_7066"
FT   CDS_pept        35682..37922
FT                   /locus_tag="Bcep1808_7066"
FT                   /gene_family="HOG000263276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   vei:Veis_3702 type II secretion system protein E"
FT                   /db_xref="GI:134287564"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4947346"
FT                   /translation="MSFFSEVESPEPEKNSFFGRLKALKRGFVGSSPAVMPIVGREPTD
FT                   GGETAHVFEPRSKTTSKCVKPRHADRAEPMTMGMMLRRAQDEIEDVEVISEKAAASRLE
FT                   EAAEASAASSELSAPSPNARTGQDTAPDDQIERGGEAAQSPSAGPVESMSIPVEESSAD
FT                   GAAVQHGGGFDEPPTVRRIGMDLAEAPELAIETGRPRLVSAESLTFKRVLCQRDPNAAL
FT                   AVSDAARREFIAVELQAGISIVVATQRFHDGQLYATYMKDLARADISIHEEMVADEDVI
FT                   AALYSKEKQRTSEFVPEASRAIGVFRDVIEAATAYGAADVHWEYRDFAEDVELRLRVDG
FT                   DLYTYRQMPKALVRRSLSAAYQDLVQRNTNSGETFQPTAPQSAMIPLVAHMDIVNIRWQ
FT                   SAPLVGGFDVALRLLDGNFKHVNVLLPHEMGLEASQLAIIENLGKVTGGATFLTGETGS
FT                   AKTTLLRAMSYLVPNRDRIKQFAVNEPSEVPAPWLSDISIQRRPGESEEDANRKIVEVI
FT                   RTLMRMDPDDLTIGEVRDSVLAGLVAELALTGHPVRATLHGNSILGAVMRLVGGRLKLP
FT                   MDEVASGSFLNAVGNQKLIPKLCPHCKRSARDVLTQQQIATLERKFGLNPSTMACRDED
FT                   GCEHCRRPGLFTRSGKVAAGIKGQTLAMELYRPTPEFLERVGARDWRGAERVWRTGRRT
FT                   GFADADMTGKTVYEHALYKASQGMIDPRFIDESMCAFDAYCVFPDSMGAQPS"
FT                   /protein_id="YP_001109730.1"
FT   misc_feature    36318..37835
FT                   /note="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB [Cell motility and secretion
FT                   / Intracellular trafficking and secretion]; Region: PulE;
FT                   COG2804"
FT                   /db_xref="CDD:32635"
FT                   /locus_tag="Bcep1808_7066"
FT   misc_feature    36819..37625
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7066"
FT   misc_feature    order(37041..37046,37056..37064)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7066"
FT   misc_feature    order(37044..37046,37056..37064,37122..37124,37128..37133,
FT                   37272..37277)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7066"
FT   misc_feature    37260..37274
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7066"
FT   gene            37949..39052
FT                   /db_xref="GeneID:4947347"
FT                   /locus_tag="Bcep1808_7067"
FT   CDS_pept        37949..39052
FT                   /locus_tag="Bcep1808_7067"
FT                   /gene_family="HOG000263277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5876 type II secretion system
FT                   protein"
FT                   /db_xref="GI:134287565"
FT                   /db_xref="GeneID:4947347"
FT                   /translation="MALPAKERMRVATWRFRALREMFYRETRLDVAKKGLRNSETLLER
FT                   LTTLEQRHRSRKNLSWPAFQKIAQRMRAGDDFATAMKSFVPTDEFVLLELAGQSPRDDA
FT                   AIRGLELAEMAAHAKGVLSATTSMQLAYPAFLIVYLYAFCVLFGSEILPATLDVQPLEK
FT                   WSAFGRVVYAFDTFCADYWWLTSSVVAGLVAGYFYTLKRWTGERRNKIDAMPLMWRNRR
FT                   DLRAALLIVSLAGLFDSSLTLRAALDRLTKAADPWMRWHLRRMSARLTANPDKPMQALD
FT                   TGIFSETTIDIMTDAAGRDQFVESIKELGQHSLSRVVDAVKRNAKITHYVLLGGAVLLF
FT                   LVFGLGSYFATGAVAFDGASTSLNQKF"
FT                   /protein_id="YP_001109731.1"
FT   misc_feature    <38135..>38725
FT                   /note="Type II secretory pathway, component PulF [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: PulF; COG1459"
FT                   /db_xref="CDD:31648"
FT                   /locus_tag="Bcep1808_7067"
FT   gene            39064..39657
FT                   /db_xref="GeneID:4947348"
FT                   /locus_tag="Bcep1808_7068"
FT   CDS_pept        39064..39657
FT                   /locus_tag="Bcep1808_7068"
FT                   /gene_family="HOG000263278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_3700 hypothetical protein"
FT                   /db_xref="GI:134287566"
FT                   /db_xref="GeneID:4947348"
FT                   /translation="MKKTNKMGTTKRRYIGKGRRKQKGELSLVEAAGVMAAAALIALVV
FT                   YMGRGYVMDRIHAMQFKSEAQYFVSGIQDATAGEIDFSSVTMLSLTQNRAFDTAGRRLN
FT                   KTTGALTGLFGGAVTAAPATVTATNDAIAVTYPIPAKVCALSADSISEAYTQVKVNNTT
FT                   ISGPSTTFDSGTAAAACASAGATASVIMYATKGN"
FT                   /protein_id="YP_001109732.1"
FT   gene            39667..40884
FT                   /db_xref="GeneID:4947349"
FT                   /locus_tag="Bcep1808_7069"
FT   CDS_pept        39667..40884
FT                   /locus_tag="Bcep1808_7069"
FT                   /gene_family="HOG000263279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6288 hypothetical protein"
FT                   /db_xref="GI:134287567"
FT                   /db_xref="GeneID:4947349"
FT                   /translation="MLSIIEAVIVLVATALLTLQGIQHDVEMRRQDVLSVEGKNQAVIT
FT                   AALSKWVTDKYASLVGQMVGSKATAIAPPTLADLRAGGYLKANYATGPIWGGNYMIQMS
FT                   VGPDNCSTGSGSCQVSYVFYSSQPVTRLGKPDVAGAGIVAQAAGNDFGISTTQNPATIK
FT                   GLNGRWYAVNPVPGAPAAIVMATNGPSSDGNSVFIRRDGALKWTGSQDVNGVDLHNVGN
FT                   IDAQGTIAAPMIATSNAAVSNAIRTPGTLAIQNAAGTGPAPISSGDSTVNGNATITGTA
FT                   TMGSIAVPRAACAGTGIASAADGSGMLFSCQRDPISGLRQWLPVGGTWQQYARYLVSHG
FT                   AWVPAPSCNAGGTPEVLLAPQSVYIDPTAAVSFNADGVGPWTISITDGSGNPISINAVA
FT                   TTYCAY"
FT                   /protein_id="YP_001109733.1"
FT   gene            40894..41673
FT                   /db_xref="GeneID:4947350"
FT                   /locus_tag="Bcep1808_7070"
FT   CDS_pept        40894..41673
FT                   /locus_tag="Bcep1808_7070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287568"
FT                   /db_xref="GeneID:4947350"
FT                   /translation="MRKILVLFRVVLLFATVVGAGPASAGPARCSYGNQDSTCTTPLRS
FT                   QPIPQPQCSSGPGWTMASAAVWQGSRWSAPQCNYQSPPSCPPGMVLQSAATWNGIAWVG
FT                   LDCEFPQATVNTGAAFANCWQAILRKAVFTWGLTATMFNWHQTAGATWTGVDAKGATFA
FT                   YAPLDQGQTYVDNYQYMIEYAQGGQYFVRAITKTWLLSSGGVWIGHYEFACPVDASGNM
FT                   TGPTKVLGGVWGDNPDLMGVVPKSKLHWISDYDLGLN"
FT                   /protein_id="YP_001109734.1"
FT   sig_peptide     40894..40971
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7070"
FT                   /product="hypothetical protein"
FT   gene            complement(41775..42764)
FT                   /db_xref="GeneID:4947351"
FT                   /locus_tag="Bcep1808_7071"
FT   CDS_pept        complement(41775..42764)
FT                   /locus_tag="Bcep1808_7071"
FT                   /gene_family="HOG000263280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="allergen V5/Tpx-1-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rfr:Rfer_4490 allergen V5/TPX-1 related"
FT                   /db_xref="GI:134287569"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947351"
FT                   /translation="MTKLKTIGLSALSVTVAIALAACGGGGGDAGSAPAAGGGSGSSGG
FT                   ATPPGTPGNVTSAQYAPGSVELAMFNQLAAYRNQCGFPAFQENTILDQAAAAHAQYMSA
FT                   NSVISDTEDASKSGFVGATYADRASHFGFPNPIDVGGVSNGYYTNAALTNDQYGNALLA
FT                   SWLAGVYHVALATLPYKVLGIGAQSTTFSGYPNWAAGITFGQLSAALPNAPLTFPCEGV
FT                   TGVRYQQSVENPIPPNTSGAWGTPVSIVGNASDTVLMTSGTMTDTSGHVIALQVLDSST
FT                   DPNKLLKKFEGVAFPTTPLSPNTKYSVSLTGTINGTSFSRNFTFTTSA"
FT                   /protein_id="YP_001109735.1"
FT   sig_peptide     complement(42690..42764)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.418 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_7071"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(42183..42569)
FT                   /note="SCP_bacterial: SCP-like extracellular protein
FT                   domain, as found in bacteria and archaea. The wider family
FT                   of SCP containing proteins includes plant
FT                   pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
FT                   cysteine-rich secretory proteins, and allergen 5...;
FT                   Region: SCP_bacterial; cd05379"
FT                   /db_xref="CDD:88558"
FT                   /locus_tag="Bcep1808_7071"
FT   gene            complement(42986..43351)
FT                   /db_xref="GeneID:4947352"
FT                   /locus_tag="Bcep1808_7072"
FT   CDS_pept        complement(42986..43351)
FT                   /locus_tag="Bcep1808_7072"
FT                   /gene_family="HOG000263281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287570"
FT                   /db_xref="GeneID:4947352"
FT                   /translation="MDDLAYLVSESNAAWLDGRGDGRFERYERFYHSERERQAEAFELE
FT                   RVNDAYPDWVGSQPARVIGMLAKHWFGKVLVALTCMYVGAQVVPTMSLAMPYKSTALLG
FT                   AIFVALRVFHRKRPRAK"
FT                   /protein_id="YP_001109736.1"
FT   gene            complement(43540..44742)
FT                   /db_xref="GeneID:4947353"
FT                   /locus_tag="Bcep1808_7073"
FT   CDS_pept        complement(43540..44742)
FT                   /locus_tag="Bcep1808_7073"
FT                   /gene_family="HOG000263282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6284 hypothetical protein"
FT                   /db_xref="GI:134287571"
FT                   /db_xref="GeneID:4947353"
FT                   /translation="MEKKNSREAYRSIERLFVPDWLADRIRETNFDLVDQMRWLLEMDG
FT                   AFNEILAVERKEIEHVKHNEASLRNLLRAPFLMVAPTLESVEDWRCFVDDTPTTVAVDQ
FT                   LSRKLPTLDALAKLSVEHHNRIFLDLVTSVIHISVLAAPLLGITAEVASYLVSVPTYKL
FT                   RIALGKMNGLPLFRWRFNSPTFWYQFTASNLTDEMVAHQIMATSPIRMNSAPSKAGWSE
FT                   LRLPRDKNETYASALMAYGCRASTAASLFRLNQNAMRQRFFEMHGTSSPCGNTPNSLSW
FT                   FVETPTNRLHGTIFTWLYRAALAAGANAPQALIATNDVYQQIFGGQHAISVDRGCNLTR
FT                   AMAADNRLTIAPCRSCRTEYLVSNNETKIEMHHSFDCPACTGQLAAKRRGNRSRARNEA
FT                   H"
FT                   /protein_id="YP_001109737.1"
FT   gene            complement(44792..46027)
FT                   /db_xref="GeneID:4947354"
FT                   /locus_tag="Bcep1808_7074"
FT   CDS_pept        complement(44792..46027)
FT                   /locus_tag="Bcep1808_7074"
FT                   /gene_family="HOG000263283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6283 hypothetical protein"
FT                   /db_xref="GI:134287572"
FT                   /db_xref="GeneID:4947354"
FT                   /translation="MSKKPLKKPEDDETFNPTVPDHPTSEADELDLPATFAHVPDKLEL
FT                   STTARDMFGDLPENLIRIIIHESEEVAHSTRKILQEHMRIGGNFAHIHASVIGHYVSTQ
FT                   GDTRKVRNMAAELVYSFLTKLFRKSKSSVSLYIRCYNKFSNNIGAVEMLTISDMSLLVH
FT                   NNISNEIVEKVIDAKREDPTLTKSEVTTLIASLREQIAGKDNSIEEATSQLTTTVGRLD
FT                   DAQREIDRLSAELANVRQEQAREKTKAQEAQVSLASTGKQVSTLQHTIAGKEREVEQLT
FT                   AEIAKLKANPVKVDVEVPTVPPSYSTLEEAVAAKLAEHTAVKAQLEAAQAQLSELEARV
FT                   QTHRAAIEAGEVLEKKIRGLIDTFSSFVHEYHSAQLLATADGNPGRFKPLFEAFGDLIG
FT                   KFHGEVMAAARA"
FT                   /protein_id="YP_001109738.1"
FT   misc_feature    complement(<45059..>45451)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bcep1808_7074"
FT   gene            complement(46257..46958)
FT                   /db_xref="GeneID:4947355"
FT                   /locus_tag="Bcep1808_7075"
FT   CDS_pept        complement(46257..46958)
FT                   /locus_tag="Bcep1808_7075"
FT                   /gene_family="HOG000263284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NERD domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NERD domain protein; KEGG: bxe:Bxe_A3742
FT                   hypothetical protein"
FT                   /db_xref="GI:134287573"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="GeneID:4947355"
FT                   /translation="MLWTIILLCGAWVLYKQYAKPHPRHPSTPPMTRSQESGDAGEARV
FT                   YAELCRVLSQLCGNDFYVHPTALLLLHAPGTEFPTAEVDHLVVTPFGIFVIETKNWAGT
FT                   ILPGRVADQVVCHLPGGRLEERRSPISQNRSKVSFLRGTLPATWSVQGLGVFSNDACSL
FT                   SADLPLALVTLRDLGYWLRTQRDRHVKSGHPNINVSAAWDVVRRLSVEDPSGSALAAHR
FT                   HKVAGNLTVNI"
FT                   /protein_id="YP_001109739.1"
FT   misc_feature    complement(46470..46856)
FT                   /note="Nuclease-related domain; Region: NERD; pfam08378"
FT                   /db_xref="CDD:149442"
FT                   /locus_tag="Bcep1808_7075"
FT   gene            47082..47387
FT                   /db_xref="GeneID:4947356"
FT                   /locus_tag="Bcep1808_7076"
FT   CDS_pept        47082..47387
FT                   /locus_tag="Bcep1808_7076"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287574"
FT                   /db_xref="GeneID:4947356"
FT                   /translation="MGRRSKAVRDWRAFGAVPASTPLTLPLSRVFDASTFPEPTGSAIT
FT                   RHARANLAIGPELFRALTTRSRTKALRADFLARPEHRSHRALSGHPLFNFLWREAC"
FT                   /protein_id="YP_001109740.1"
FT   gene            47393..47743
FT                   /db_xref="GeneID:4947357"
FT                   /locus_tag="Bcep1808_7077"
FT   CDS_pept        47393..47743
FT                   /locus_tag="Bcep1808_7077"
FT                   /gene_family="HOG000263285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287575"
FT                   /db_xref="GeneID:4947357"
FT                   /translation="MFIGAFKSPGKFLALCLALYIATQSIVVAVFVVVAAISHFKGSVK
FT                   KEPRSHERDSTEGHEIDTAQQQPERGQAAPARSDVHVAPTPQRQYAKSAVVIPMKAGSS
FT                   STGAHSLKMGTK"
FT                   /protein_id="YP_001109741.1"
FT   sig_peptide     47393..47500
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.430 at
FT                   residue 36"
FT                   /locus_tag="Bcep1808_7077"
FT                   /product="hypothetical protein"
FT   gene            47857..48306
FT                   /db_xref="GeneID:4947358"
FT                   /locus_tag="Bcep1808_7078"
FT   CDS_pept        47857..48306
FT                   /locus_tag="Bcep1808_7078"
FT                   /gene_family="HOG000263286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6280 hypothetical protein"
FT                   /db_xref="GI:134287576"
FT                   /db_xref="GeneID:4947358"
FT                   /translation="MEPHVAGWQLDMFGSASPILIPPPKPDPLPDPALWEPQVREKLAE
FT                   AVVFFALDSRHSDNVPEALIDCAEMLHHRLCNRAVDKVDYYATLGWIMELWTGAIPYQV
FT                   VCAVGRVPPRAMQDAIRDTPLLNYDFNRLNRWCSGQLSLEAQWVA"
FT                   /protein_id="YP_001109742.1"
FT   gene            48294..49133
FT                   /db_xref="GeneID:4947359"
FT                   /locus_tag="Bcep1808_7079"
FT   CDS_pept        48294..49133
FT                   /locus_tag="Bcep1808_7079"
FT                   /gene_family="HOG000263287" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6279 hypothetical protein"
FT                   /db_xref="GI:134287577"
FT                   /db_xref="GeneID:4947359"
FT                   /translation="MGGVAMFFTRMLAQAFPGGPRASPVTPPPPSPRQAERTVGTGASN
FT                   ETFVTIDGIAHLFVDEGDCVVEFVPAFDDAPGDTIFGTKILPALAPHWAMVHEYPVPLK
FT                   DAIATAIRRASVPASPTLGETSTSAAAEQRPAQPVDESRSASAHDDYESSPSLTRQSGR
FT                   ASSPRGGHETSSRSSVVEGRITGWGEETFPNRRPGKQSRTYRSFALRLDAREGERVLQG
FT                   EGLKEAISDCGCCVGDVVTVKRLRKIKVPAFRKEDGEPIFKNGQQVMWDKWLWSITK"
FT                   /protein_id="YP_001109743.1"
FT   gene            49115..49735
FT                   /db_xref="GeneID:4947360"
FT                   /locus_tag="Bcep1808_7080"
FT   CDS_pept        49115..49735
FT                   /locus_tag="Bcep1808_7080"
FT                   /gene_family="HOG000106483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: bur:Bcep18194_A6107 single-strand binding
FT                   protein"
FT                   /db_xref="GI:134287578"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:4947360"
FT                   /translation="MVHHQMKEFLMASVNKVIIVGNLGADPEVRYLPSGDAVANVRVAT
FT                   TDRYKDKASGDFKEMTEWHRISFFGRLAEIASEYLKKGSSIYVEGRIRTRKWQGQDGQD
FT                   RYSTEIVADQMQMLGGRSSGGRGDGAGHGGDGDFEQGTRRHAAPPASRPAPSQSTPRSS
FT                   ARSQQSGPPPTEPQSYGGSGGFDDMMDDVPFESWYPRKAWAAL"
FT                   /protein_id="YP_001109744.1"
FT   misc_feature    49163..49468
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7080"
FT   misc_feature    order(49163..49174,49247..49255,49298..49300,49304..49306,
FT                   49367..49369,49394..49396,49427..49429,49436..49438)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7080"
FT   misc_feature    order(49178..49186,49202..49204,49232..49234,49253..49258,
FT                   49292..49297,49301..49303,49307..49309,49313..49315,
FT                   49319..49321,49358..49363,49385..49387,49391..49393,
FT                   49397..49402,49439..49441,49445..49447)
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7080"
FT   misc_feature    order(49367..49369,49373..49375,49379..49381,49460..49462)
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7080"
FT   gene            complement(49812..50063)
FT                   /db_xref="GeneID:4947361"
FT                   /locus_tag="Bcep1808_7081"
FT   CDS_pept        complement(49812..50063)
FT                   /locus_tag="Bcep1808_7081"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287579"
FT                   /db_xref="GeneID:4947361"
FT                   /translation="MDHQNFRSQWSPTSRRIDTTLRAPCGTKGKSTSRSRISPIGLRVF
FT                   RCLRQAQKRLLNEAARERVGLVQQRHGVRHAGGKKDGV"
FT                   /protein_id="YP_001109745.1"
FT   gene            50127..51269
FT                   /db_xref="GeneID:4947362"
FT                   /locus_tag="Bcep1808_7082"
FT   CDS_pept        50127..51269
FT                   /locus_tag="Bcep1808_7082"
FT                   /gene_family="HOG000263288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4324 hypothetical protein"
FT                   /db_xref="GI:134287580"
FT                   /db_xref="GeneID:4947362"
FT                   /translation="MGKVKELDLASLDWSNIFPHYIDSQFLSGKGRWWRCPLCDGEETF
FT                   RIFPPERDPNGGWHCARCLKGGMGARLIHEVTGKPYREIFYELETGNYNGGIPPEVVRK
FT                   VKPVPVRAEKSDEQKCREMQAAWDSAAAVTVDSPVWKYLSNRIPGLKLEWIGRDVRCHP
FT                   GMEYVDAFGKKQGSFPVMLQRARSQAGKPRRVHRTYLTLDGEKVPFLTKKGKSRAKLEM
FT                   SAPAGSFGSSVLLNTRRSRTLALVEGAETGFAVVARYENRIEVRCLLNCGGLEHADINW
FT                   DEYDHVIIYADHDKVDQRRGFRPGEHHAQILAERIRKHGKRVSIVKSVVEGVDFCDVWK
FT                   LQCQRRAQQRELVRARQLAREETRKRNLSRIRSSGLCAAM"
FT                   /protein_id="YP_001109746.1"
FT   gene            51254..51592
FT                   /db_xref="GeneID:4947363"
FT                   /locus_tag="Bcep1808_7083"
FT   CDS_pept        51254..51592
FT                   /locus_tag="Bcep1808_7083"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287581"
FT                   /db_xref="GeneID:4947363"
FT                   /translation="MRGNVTLTPAAAGIPFFLPGGDTSPPGRIAPGYITRWMMGSFRLL
FT                   LDEFEVVEVPPKAAVEGAADLFEGPRFDVIDRLLQGDDRYVLRDEAFRPAVDFCMAWLD
FT                   EKAKSRGH"
FT                   /protein_id="YP_001109747.1"
FT   gene            51595..51870
FT                   /db_xref="GeneID:4947364"
FT                   /locus_tag="Bcep1808_7084"
FT   CDS_pept        51595..51870
FT                   /locus_tag="Bcep1808_7084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287582"
FT                   /db_xref="GeneID:4947364"
FT                   /translation="MATSGFLREAAFFCSVARDKQREPEEELEDAPHPAGPKRSDRTNE
FT                   EKQGGKIAGATVVHESTSGKDQRIRQDEKKAAQDKRKGAEPARHGG"
FT                   /protein_id="YP_001109748.1"
FT   gene            complement(52160..52495)
FT                   /db_xref="GeneID:4947365"
FT                   /locus_tag="Bcep1808_7085"
FT   CDS_pept        complement(52160..52495)
FT                   /locus_tag="Bcep1808_7085"
FT                   /gene_family="HOG000263291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287583"
FT                   /db_xref="GeneID:4947365"
FT                   /translation="MRDKIEMTITINELVSPLLFERLSSCPSARRRAAVLKALAESALR
FT                   QELTGHAVAAPAPTASLATPTPRQDAAAHAGSTVGHDEFQVLSVGDGSLDRTSFDDALH
FT                   DQLGAWG"
FT                   /protein_id="YP_001109749.1"
FT   gene            complement(52505..53422)
FT                   /db_xref="GeneID:4947366"
FT                   /locus_tag="Bcep1808_7086"
FT   CDS_pept        complement(52505..53422)
FT                   /locus_tag="Bcep1808_7086"
FT                   /gene_family="HOG000002736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6275 hypothetical protein"
FT                   /db_xref="GI:134287584"
FT                   /db_xref="GeneID:4947366"
FT                   /translation="MFPSLAPLAASRSIAGYGESVLTARKVATIVIDQVEYEVGPDVSL
FT                   TAAYGNTGRALADDYVLSANYAALLFGAIHFAGVDHIERLVLGLPVHNMKKYAAELKER
FT                   FTGELDFGAGRVKIDKVMVIPQPLGSLVLASSNRPGGFGRDVEHLVVDVGYFTTDWVYA
FT                   NGFTMDDKRSGGMPGGASQIYQRIAALIARDQGDEVEDIERIDKALREKTPFFFYGTNV
FT                   DLAPYLEMAQPLISGVVKEMQNNVGRLANVRSIILSGGGAALYAAVIRRAFPRVVIEVI
FT                   DAPCLANVRGFLLVGESSLARERR"
FT                   /protein_id="YP_001109750.1"
FT   misc_feature    complement(52535..53422)
FT                   /note="PRTRC system protein D; Region: PRTRC_D; TIGR03739"
FT                   /db_xref="CDD:163451"
FT                   /locus_tag="Bcep1808_7086"
FT   gene            54201..54653
FT                   /db_xref="GeneID:4947367"
FT                   /locus_tag="Bcep1808_7087"
FT   CDS_pept        54201..54653
FT                   /locus_tag="Bcep1808_7087"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287585"
FT                   /db_xref="GeneID:4947367"
FT                   /translation="MEERTVGAAVTKMRNRNYPAHSPAPATARFVDAETRKRQAGRVAT
FT                   KLIWAESIRAARPRSGREMVGDGLRGARTASVMAAGWTVGLHALPMQRADRMESLKDRK
FT                   QQGRAGGIRRSRRRGSATEAGNPARRQVGSSCRKGERLWFGAPRAS"
FT                   /protein_id="YP_001109751.1"
FT   gene            54917..56059
FT                   /db_xref="GeneID:4947368"
FT                   /locus_tag="Bcep1808_7088"
FT   CDS_pept        54917..56059
FT                   /locus_tag="Bcep1808_7088"
FT                   /gene_family="HOG000263292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fis family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG:
FT                   rme:Rmet_6273 helix-turn-helix, fis-type"
FT                   /db_xref="GI:134287586"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:4947368"
FT                   /translation="MAAILNVRAVVGRYRLSPELRDALLVLFDQHVAEIHSTTRISKRA
FT                   LSIKTQEYRVTAICKAFVELREGGFAVQTPWSLKSKHVEYLVDRWVRDKQTGGTIENKL
FT                   TYLRALAQWMGKANLIGTLGDYVDRSAAGLQRSYVATEDKSWTANGVDAAAKIAEIAST
FT                   CPYTAVQLKLQAAFGLRVEESFMLRPVEAVRDARTLDVTRGTKGGRPREVPIERKIEIL
FT                   EEAARLSNGVSGSTIPAGRTLKQWRDWYYYVLAKHGMTKSGIGVTSHGLRHEYLQTLYE
FT                   QVAAVPAPIKGSSARPDPAVHEDAKRRVVEAAGHSRPSKANAYLSTFARQTALKKALPS
FT                   IDETMAALATAGGNKSHAAAALGISRQALYRLLASPPGHQ"
FT                   /protein_id="YP_001109752.1"
FT   misc_feature    55427..55891
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7088"
FT   misc_feature    order(55454..55459,55532..55534,55718..55723,55886..55888)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7088"
FT   misc_feature    order(55454..55456,55532..55534,55721..55723,55730..55732,
FT                   55859..55861,55886..55888)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7088"
FT   misc_feature    order(55454..55456,55721..55723,55730..55732,55859..55861,
FT                   55886..55888)
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7088"
FT   misc_feature    order(55454..55456,55730..55732,55886..55888)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7088"
FT   misc_feature    <55949..56029
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Bcep1808_7088"
FT   gene            complement(56476..57594)
FT                   /db_xref="GeneID:4947369"
FT                   /locus_tag="Bcep1808_7089"
FT   CDS_pept        complement(56476..57594)
FT                   /locus_tag="Bcep1808_7089"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6267 hypothetical protein"
FT                   /db_xref="GI:134287587"
FT                   /db_xref="GeneID:4947369"
FT                   /translation="MPSTRLFLRRTAARRRGDGRSRTAVCSLHELRRHPRVPRVVGRTG
FT                   TRRHLVALRAGMAFLVRRRSSIRATSISYRFRPDRRCILRIKRHIQHVHRLAPVPYSRC
FT                   RTTGLTRLIQTSKELPEGIFALFSVLPARKNSNNAGDEKLTTFRQMIEQLYPCEHCGGR
FT                   PTVGRSQRLVECDENRRFDFSQFGRFGGPPNIGDVLPRPPEAPLTEPLVCIYCTGCGMS
FT                   TQWETIGDDEAAAKDRCAETWNRRLNRPKATDEDLRRLIERELGACDTQQVLDMLSRVD
FT                   GDWNEIGPVFKMLAQRIVDATVVTFDTWPIAPVLEDAARYRKLVQLAKWIEVDGQDYVQ
FT                   FPKIQSPNEHRDFLFEDRIAIAVDALPDRDRW"
FT                   /protein_id="YP_001109753.1"
FT   gene            complement(57731..58960)
FT                   /db_xref="GeneID:4947370"
FT                   /locus_tag="Bcep1808_7090"
FT   CDS_pept        complement(57731..58960)
FT                   /locus_tag="Bcep1808_7090"
FT                   /gene_family="HOG000263293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6249 hypothetical protein"
FT                   /db_xref="GI:134287588"
FT                   /db_xref="GeneID:4947370"
FT                   /translation="MSRVSFAGVAVPLDDVQENPAAFVRPLERAKISPGYAQCLCRGAA
FT                   SPLRLQIRRYGSLFHLAGWPDEGPLHDRLSCSFHKDPSDGSSESGKALPGIVATAVGLR
FT                   AKLDVALTQRTVGAVSKGPRQAGAPTTSRRSAPLLGFLQTLWQVAGLNRWSGVDRARNW
FT                   GVCNARVLAEISDAVINGEPAEQVLHVMRRFQEADRTAINAEFDAFLARVVQRDGTNHR
FT                   GLVIGEISEIGVTPYGRSITLRQSAKRYYCNTELIALAEKRYDHAMRALGDGSARVVAI
FT                   LVIERTPKGHHVVVELAAMLCSSTYITCDSIHEVAMANRLVAEGRAFDKPIRLNEGTDM
FT                   LPDFVLTDTAEPTHIEVYGMNGVAEYEARKREKQRLRMARGIHAVEWDIDRCQLVDVHF
FT                   PPIARRSARP"
FT                   /protein_id="YP_001109754.1"
FT   misc_feature    complement(57818..58882)
FT                   /note="Protein of unknown function (DUF1173); Region:
FT                   DUF1173; pfam06666"
FT                   /db_xref="CDD:148331"
FT                   /locus_tag="Bcep1808_7090"
FT   gene            59071..59361
FT                   /db_xref="GeneID:4947371"
FT                   /locus_tag="Bcep1808_7091"
FT   CDS_pept        59071..59361
FT                   /locus_tag="Bcep1808_7091"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287589"
FT                   /db_xref="GeneID:4947371"
FT                   /translation="MAKREPLFHDHFLVGVSLFPPTIELPSQCRESPRRGEEGHRRATD
FT                   NYSTVVAKPCQDSDQGDDHQQTGNDQVHVEWVRGFGVWGCATRGTAAGQMR"
FT                   /protein_id="YP_001109755.1"
FT   gene            59859..60860
FT                   /db_xref="GeneID:4947372"
FT                   /locus_tag="Bcep1808_7092"
FT   CDS_pept        59859..60860
FT                   /locus_tag="Bcep1808_7092"
FT                   /gene_family="HOG000263294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6243 hypothetical protein"
FT                   /db_xref="GI:134287590"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:4947372"
FT                   /translation="MSRKSAERKFAREADPHQAELVKLLKQFGYAHQINTVFADFVEIS
FT                   AIALSNSVDKPQFGPREKRYLEIVGKYTPEELQLFARMFAELTLSFEHRLGVDDRLPPG
FT                   ALPCPGNLTDVLGETYMMLDIGNDRAGQFFTPYCVSRLMAGISIGDRCEAIEQEGFMRM
FT                   QEPACGAGGMVIATADALLSIGQNYQQTMHATCIDIDARCAHMTYLQLSMMHIPAIVVH
FT                   GNALTMEVWGMWYTPAHILGGWRAKLRQGRQADALREVLALDRSAVASDADAKQEPADD
FT                   LVFDGEVAVATAVEESAVAAVLPADTLCDLFDDAVEQSRAGIFEVVDQLALF"
FT                   /protein_id="YP_001109756.1"
FT   misc_feature    <60195..>60446
FT                   /note="Type I restriction-modification system
FT                   methyltransferase subunit [Defense mechanisms]; Region:
FT                   HsdM; COG0286"
FT                   /db_xref="CDD:30634"
FT                   /locus_tag="Bcep1808_7092"
FT   gene            61136..62815
FT                   /db_xref="GeneID:4947373"
FT                   /locus_tag="Bcep1808_7093"
FT   CDS_pept        61136..62815
FT                   /locus_tag="Bcep1808_7093"
FT                   /gene_family="HOG000081510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: rme:Rmet_6241 ParB-like
FT                   partition proteins"
FT                   /db_xref="GI:134287591"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:4947373"
FT                   /translation="MQQTPLQQPTIKLGRIKLGRNPRTYFDDAKMAEMKASISARGVDT
FT                   PVIVRPLDDGFFELIAGGRRYKAALETRGDDYDMPVNVKDVDSVEAEEIAFTENIQRDD
FT                   MSPGDEAVEAARLLGRCQGDREEAARRIGWSLPTLNSRLALLNCSNEVLIALNTRQILL
FT                   GHAELLAALSKENQDRVLSVIISEKKSVTDVRKLVESAACSLAAAIFDKTDCAACPHNS
FT                   AMQSEMFGESIATGNCTNRQCYNGKTDKQLEVTAAGLRDEFPTVRIVRAGDNHTRVQLA
FT                   VDGVNGVGAEQAKACHGCQNYGVAVSGLPDSLGKTFRGQCFDTVCNMRKVADRITAEKA
FT                   AAKAATSEAKGSSVPTKAAGKSASSSDASAPTAVTVVAESDRVKQYREALWRKALRRDV
FT                   GKNAALARQYLIAIVLAGYARQIKDEVFRSVYEKVTDEKAPAADLPKALLLACTTSDDQ
FT                   AAMLVTGMFVAAIEGLDVTYLKQLCKHHNLDLTQYWKLDKEFLDLVTKAEMMVIADELG
FT                   LRAAMGDNFKKVFSKSKAEVITALLAVEGFTYEGKLLKVLKF"
FT                   /protein_id="YP_001109757.1"
FT   misc_feature    61166..61435
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bcep1808_7093"
FT   misc_feature    61178..62812
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Bcep1808_7093"
FT   gene            62893..63339
FT                   /db_xref="GeneID:4947374"
FT                   /locus_tag="Bcep1808_7094"
FT   CDS_pept        62893..63339
FT                   /locus_tag="Bcep1808_7094"
FT                   /gene_family="HOG000263295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6240 hypothetical protein"
FT                   /db_xref="GI:134287592"
FT                   /db_xref="GeneID:4947374"
FT                   /translation="MFQTLEPLLRSAEKLVLSLTMDGENIVVFLTPAGGKDAMLRQPLI
FT                   LRATAVELDEGFAAAISSFTAAHQSLGDQVAATNAILEAQQQLQATKAQKALSKASKPE
FT                   AANAAVDEDANADEEGAGPTAAAPGVTPPADEKPAGTDLSSLLL"
FT                   /protein_id="YP_001109758.1"
FT   misc_feature    62893..63141
FT                   /note="PRTRC system protein E; Region: PRTRC_E; TIGR03741"
FT                   /db_xref="CDD:163453"
FT                   /locus_tag="Bcep1808_7094"
FT   gene            63348..63566
FT                   /db_xref="GeneID:4947375"
FT                   /locus_tag="Bcep1808_7095"
FT   CDS_pept        63348..63566
FT                   /locus_tag="Bcep1808_7095"
FT                   /gene_family="HOG000081532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6239 hypothetical protein"
FT                   /db_xref="GI:134287593"
FT                   /db_xref="GeneID:4947375"
FT                   /translation="MSISIAVLVREFTYNGMALLDPGPTFSPDQVRDLYTAQYPELTTA
FT                   AVDGPDMKGEVAHYKFVRAAGAKGAHA"
FT                   /protein_id="YP_001109759.1"
FT   misc_feature    63357..63554
FT                   /note="PRTRC system protein C; Region: PRTRC_C; TIGR03738"
FT                   /db_xref="CDD:163450"
FT                   /locus_tag="Bcep1808_7095"
FT   gene            63666..64808
FT                   /db_xref="GeneID:4947376"
FT                   /locus_tag="Bcep1808_7096"
FT   CDS_pept        63666..64808
FT                   /locus_tag="Bcep1808_7096"
FT                   /gene_family="HOG000263296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6238 hypothetical protein"
FT                   /db_xref="GI:134287594"
FT                   /db_xref="GeneID:4947376"
FT                   /translation="MFFDPALPDSSIAAGSAARWQPPRAAPARRRPAADLLTLPSFSTE
FT                   VPGAVRLKWREDVNLSDLVLKHFQYGPLRAGDVHDPADAGDAFQQAFHAWTRRQYGRLS
FT                   RLRFTPHLFDAHAVRDVLDGLGNGNNDDDPTPLFFGFGLEDEWVYSLEGAIETLRSTHP
FT                   LLFRTVMGALYRASARTMFIRLPDWFMYEFSCWYWDGDPHISDKDADEALKERFDDDTE
FT                   TRSAYLPSVVRPQLCPDDADPCVFSGGKWRYRSALTAPELMRLRARSRGMPRRVCTEVL
FT                   KLRALMRRSRSRDLLHVNYAANPAYALCSVIVEDNQFVGDLLDCHFENESQSGDATTYS
FT                   GFSRLASTPKAIRRQYADLALAFRILTHLDRLLALVSQST"
FT                   /protein_id="YP_001109760.1"
FT   misc_feature    63768..64799
FT                   /note="PRTRC system protein F; Region: PRTRC_F; TIGR03742"
FT                   /db_xref="CDD:163454"
FT                   /locus_tag="Bcep1808_7096"
FT   gene            64820..65548
FT                   /db_xref="GeneID:4947377"
FT                   /locus_tag="Bcep1808_7097"
FT   CDS_pept        64820..65548
FT                   /locus_tag="Bcep1808_7097"
FT                   /gene_family="HOG000081543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6237 hypothetical protein"
FT                   /db_xref="GI:134287595"
FT                   /db_xref="GeneID:4947377"
FT                   /translation="MSGISAGRTGSDVALSQALLLYTGKDGAHFATAHAVIADRQSGRP
FT                   VIGAGRPLDRKVLVQTLQQLAEHVAPRAEFLPATVLGVSPEAVTWWCPPAMRRVFFECE
FT                   NLGKRSAVVPHPGLVFQALNQGFRVFAVACSDRPVRETPLFEPPYFNTWDMGRICIGSA
FT                   QVPKRVDVASIDGWEAGFFDSAFTHPNAGGKRIEYKDGEYAFWRDMLDGKFGETFPLNA
FT                   LVPMKRTLEQLVNGQVGRGA"
FT                   /protein_id="YP_001109761.1"
FT   misc_feature    64856..65536
FT                   /note="PRTRC system protein B; Region: PRTRC_B; TIGR03737"
FT                   /db_xref="CDD:163449"
FT                   /locus_tag="Bcep1808_7097"
FT   gene            65545..66180
FT                   /db_xref="GeneID:4947378"
FT                   /locus_tag="Bcep1808_7098"
FT   CDS_pept        65545..66180
FT                   /locus_tag="Bcep1808_7098"
FT                   /gene_family="HOG000081110" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6236 hypothetical protein"
FT                   /db_xref="GI:134287596"
FT                   /db_xref="GeneID:4947378"
FT                   /translation="MNPLDTVLQQSFPAVMVPSRETVVPMTRSGERLLIASDGVYLEVL
FT                   RPWVRVVRRIAQYAVSIAVPYGKVEETTALLCGQIPAALVAEFHAMARAALPNEVGAWI
FT                   VWNSVTNEFRIVALPSLSHGPGHLVYERPRLADGEWLVVDCHSHGTSPAFFSRTDNQDD
FT                   KHDVKFALVLGHCDRTPSVALRLCAKGIFEKFERAPETWAAALTMERV"
FT                   /protein_id="YP_001109762.1"
FT   misc_feature    65557..66132
FT                   /note="Domain of unknown function (DUF2016); Region:
FT                   DUF2016; cl09677"
FT                   /db_xref="CDD:164137"
FT                   /locus_tag="Bcep1808_7098"
FT   gene            66180..66998
FT                   /db_xref="GeneID:4947379"
FT                   /locus_tag="Bcep1808_7099"
FT   CDS_pept        66180..66998
FT                   /locus_tag="Bcep1808_7099"
FT                   /gene_family="HOG000081554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   rme:Rmet_6235 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="GI:134287597"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="GeneID:4947379"
FT                   /translation="MSEVITHSIPADMLRRPWRVVVVGAGGTGSAFLPSLARLHHAMIE
FT                   LGHPGGIECTVYDDDTVSETNVGRQGFYPNDVGHYKALLLVNRLNNLMGTNWVAEPRRV
FT                   DSSVRIVADVVVGCVDSRRARHAIVQAAKRGSCRYYLDCGNETDRGQVILGEFGKARHD
FT                   RLPHVGDLFPDLLNAKNDRDDDTPSCSMADALRKQSLVINQAISVQAYNLLWTLYRTGS
FT                   LKYSGSFVNLETGRTSPISIDPAAWARFGYEAPPPKKPKARKSRKATVAV"
FT                   /protein_id="YP_001109763.1"
FT   misc_feature    66198..66908
FT                   /note="PRTRC system ThiF family protein; Region:
FT                   PRTRC_ThiF; TIGR03736"
FT                   /db_xref="CDD:163448"
FT                   /locus_tag="Bcep1808_7099"
FT   misc_feature    66297..66635
FT                   /note="Superfamily of activating enzymes (E1) of the
FT                   ubiquitin-like proteins. This family includes classical
FT                   ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
FT                   activating enzymes and other mechanistic homologes, like
FT                   MoeB, Thif1 and others. The common...; Region:
FT                   E1_enzyme_family; cl00287"
FT                   /db_xref="CDD:176579"
FT                   /locus_tag="Bcep1808_7099"
FT   misc_feature    order(66351..66353,66357..66359,66384..66386,66420..66422,
FT                   66531..66533,66549..66551)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73265"
FT                   /locus_tag="Bcep1808_7099"
FT   misc_feature    order(66552..66554,66609..66614,66630..66632)
FT                   /note="substrate interface; other site"
FT                   /db_xref="CDD:73265"
FT                   /locus_tag="Bcep1808_7099"
FT   gene            complement(67079..67561)
FT                   /db_xref="GeneID:4947380"
FT                   /locus_tag="Bcep1808_7100"
FT   CDS_pept        complement(67079..67561)
FT                   /locus_tag="Bcep1808_7100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287598"
FT                   /db_xref="GeneID:4947380"
FT                   /translation="MSVSEMRKGGSRCDWVDAQKREKQVQCRTARRRRAPESSRKPPRF
FT                   PLDEKKAPARLLGRRWYQKNTVCLDVSCGPAEIEIAGPFVDEFDVNGKTLATCELEPIA
FT                   CLDRGYSVRCLTVNDEPPSLPFGHAEPWELNRTLEAYHRMRQINVPHRLGTRASHE"
FT                   /protein_id="YP_001109764.1"
FT   gene            67630..68091
FT                   /db_xref="GeneID:4947381"
FT                   /locus_tag="Bcep1808_7101"
FT   CDS_pept        67630..68091
FT                   /locus_tag="Bcep1808_7101"
FT                   /gene_family="HOG000220583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative outer membrane lipoprotein
FT                   transmembrane"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6233 putative outer membrane
FT                   lipoprotein transmembrane"
FT                   /db_xref="GI:134287599"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="GeneID:4947381"
FT                   /translation="MFKLLISALLLASLTACASYDFGSPDVYQRYDVQRAGEIEAATVV
FT                   SVRGITISSESDRSGLSSMLSAGVSAFLGSRTIGGGNGRYIAGALAGAGAAYVSQRLSE
FT                   SLARHAGLEVVVRTVSGRTLVVVQSDEQRFAPGDRVMLVSSSSGMRITR"
FT                   /protein_id="YP_001109765.1"
FT   sig_peptide     67630..67701
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.503 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7101"
FT                   /product="hypothetical protein"
FT   misc_feature    67690..68085
FT                   /note="Rickettsia 17 kDa surface antigen; Region:
FT                   Rick_17kDa_Anti; cl10470"
FT                   /db_xref="CDD:175220"
FT                   /locus_tag="Bcep1808_7101"
FT   gene            68178..68570
FT                   /db_xref="GeneID:4947382"
FT                   /locus_tag="Bcep1808_7102"
FT   CDS_pept        68178..68570
FT                   /locus_tag="Bcep1808_7102"
FT                   /gene_family="HOG000263297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6232 hypothetical protein"
FT                   /db_xref="GI:134287600"
FT                   /db_xref="GeneID:4947382"
FT                   /translation="MFKVPKVLYADRRAGGVASDAALTHHATRMLHRVARDLRLRAGEH
FT                   EVVAEPAKAGRGCRVTLRTSRMMLEVADSTSRQHVAVSFRTRRGHRDLSGGGDNVVPLA
FT                   QLDTDEGYQALLGGLRLVDGLDNDRR"
FT                   /protein_id="YP_001109766.1"
FT   gene            68702..69052
FT                   /db_xref="GeneID:4947383"
FT                   /locus_tag="Bcep1808_7103"
FT   CDS_pept        68702..69052
FT                   /locus_tag="Bcep1808_7103"
FT                   /gene_family="HOG000263298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287601"
FT                   /db_xref="GeneID:4947383"
FT                   /translation="MHESESPAVITASWDGNEAKLIQSTVDSFAVVSVEPPAGSPRSRL
FT                   GARLVRASWSKDQRQQFGRFCHTLTVSSIVGVVGYVHAISEFSIWAAMNVAALVVIGVV
FT                   TYVVGMDSMNGE"
FT                   /protein_id="YP_001109767.1"
FT   gene            69268..69678
FT                   /db_xref="GeneID:4947384"
FT                   /locus_tag="Bcep1808_7104"
FT   CDS_pept        69268..69678
FT                   /locus_tag="Bcep1808_7104"
FT                   /gene_family="HOG000263299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287602"
FT                   /db_xref="GeneID:4947384"
FT                   /translation="MSEVLEESELPAVGESALRGKTVGEVAKYIAQALQAAGLEPESVS
FT                   AANVSPSLHGTFFGARDSSYWPIGSQSRRRSSVSVRRDRSEGWRVSIDTVWFQDDGDGG
FT                   HMRTQPLVIIRTMTRSDGWAVAAVVSNLLDIG"
FT                   /protein_id="YP_001109768.1"
FT   gene            69757..71277
FT                   /db_xref="GeneID:4947385"
FT                   /locus_tag="Bcep1808_7105"
FT   CDS_pept        69757..71277
FT                   /locus_tag="Bcep1808_7105"
FT                   /gene_family="HOG000263300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6228 hypothetical protein"
FT                   /db_xref="GI:134287603"
FT                   /db_xref="GeneID:4947385"
FT                   /translation="MYTIKTPDASIHVDTLAHVFHVFFHDATLSAYETTEISLTRGGVE
FT                   MPILRYNGILTVRQPGAAEAIFTSLFEEIRNRWFSRDGRQLQPWQVTRKRWEVFQFVFE
FT                   LATKPAWMLSGEQLEAEVEAARGTGRRFHLPDVCDHVANALFGFTSQGPRLSLSGGVNG
FT                   RHEVHVAYALFLDHPIPDSVLADYRGDAKRFEYDLRWFPVLLDVPVLRNTLPYDVMQSA
FT                   VAIYRHEKRQIDAELGAGIVAALQSAPAGISCVEVDDRLFAADLVDKPDLPEQYQRPVD
FT                   VGSAMSPVAERLRDLIADAVLKKSLDRLGADRQKGRISLRQYNLQVEMAKLERGRMTFE
FT                   GANRFAADVEARNVGALLSVLDHAAGWNDQSKRVLREQFGVSLHGLNSTRRRRAIFAFC
FT                   GYDEVAQAEWEAKQDAARAHRRAEDSANDAKKQAGLARYRTHDNVLITGVQHVDQAIAD
FT                   GYSEIRSFRYGAATRYALAKPGSTEGRTLHAKNGTLDYARSRLTQLAA"
FT                   /protein_id="YP_001109769.1"
FT   gene            71291..71755
FT                   /db_xref="GeneID:4947386"
FT                   /locus_tag="Bcep1808_7106"
FT   CDS_pept        71291..71755
FT                   /locus_tag="Bcep1808_7106"
FT                   /gene_family="HOG000263302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6247 hypothetical protein"
FT                   /db_xref="GI:134287604"
FT                   /db_xref="GeneID:4947386"
FT                   /translation="MRFDRTIRYEDYIWTRRKELAFLNRHKRIAKKLERDCPLFADQLA
FT                   PAPETDVEAEKARRVERARRSEQVMRDLDARQWRAARASYFACEPEIRARIMAEWGAWR
FT                   GPAKPLYFIYVVEKHNGVGEERTRRMRERDAEIREAVLPMVNVQGDLLRT"
FT                   /protein_id="YP_001109770.1"
FT   gene            72011..72262
FT                   /db_xref="GeneID:4947387"
FT                   /locus_tag="Bcep1808_7107"
FT   CDS_pept        72011..72262
FT                   /locus_tag="Bcep1808_7107"
FT                   /gene_family="HOG000146509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287605"
FT                   /db_xref="GeneID:4947387"
FT                   /translation="MNQRESSNPFPPDAVSIAEIEVAINVWRNRSPAPTAPDGLLALCA
FT                   EARVLADVYGVMIVTHSSSVPRSSLTSKQVAALIGAQS"
FT                   /protein_id="YP_001109771.1"
FT   misc_feature    72044..72253
FT                   /note="Protein of unknown function (DUF3717); Region:
FT                   DUF3717; pfam12512"
FT                   /db_xref="CDD:152946"
FT                   /locus_tag="Bcep1808_7107"
FT   gene            72379..73404
FT                   /db_xref="GeneID:4947388"
FT                   /locus_tag="Bcep1808_7108"
FT   CDS_pept        72379..73404
FT                   /locus_tag="Bcep1808_7108"
FT                   /gene_family="HOG000230241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: dde:Dde_0483 ATPase"
FT                   /db_xref="GI:134287606"
FT                   /db_xref="GeneID:4947388"
FT                   /translation="MKLSPVRLTQLLATYIPKRLPVLITGRPGIGKSDIVEAATEEAEH
FT                   DLLISHPVVEDPTDSKGLPFPSADGRHARFLPFGDLERALSATRPLVWFLDDLGQASPA
FT                   VQAAKMQLLLARRIGEHQLPDCVSFVAATNRRSDNAGVTGILDPLISRFAAVVELEATV
FT                   DDWTAWAVRKNVPPELIAFLRFRPDLLWEARSGRDIVASASPRKWGFLAKTMPAVSADL
FT                   LPDAIRATVGEGAGAELISFLSIYRALPSVDAILLDPSRGVIPDEPSILYALTAALSHK
FT                   ASDGNFERVLQYADRLADTGKREFTAVLVRDSIARTPDLQNHHAFIRAQGGEIGKIIRG
FT                   E"
FT                   /protein_id="YP_001109772.1"
FT   misc_feature    72415..72858
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7108"
FT   misc_feature    72454..72477
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7108"
FT   misc_feature    order(72457..72480,72664..72666,72778..72780)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7108"
FT   misc_feature    72652..72669
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7108"
FT   misc_feature    72832..72834
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7108"
FT   gene            73504..74433
FT                   /db_xref="GeneID:4947389"
FT                   /locus_tag="Bcep1808_7109"
FT   CDS_pept        73504..74433
FT                   /locus_tag="Bcep1808_7109"
FT                   /gene_family="HOG000263303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287607"
FT                   /db_xref="GeneID:4947389"
FT                   /translation="MNITDLQSKVMLSSVTISTWVARRYDGKVTEEVEKSHHARGIGRF
FT                   NKRLLPEYAPSYAEVVSIGNRIRSHYYSRTLKYDQLGVRLLPTMVYMELAERLRAMKDE
FT                   FDLAVSIFLTNYLDLKEQARAEMNTLYNEADYPSLAELKGKFGVKLSVLPFPDASQFGV
FT                   DLPSDVLTTLRTEIDEHAMASIQTANNDLVGRLYEAVSTMASRLYATGNVRLDVANHVR
FT                   ELCDLLPKLNFSDDPKLAHTLTEAKQHLAAHNGADLKESGVLRSQVASKATEIEALMAA
FT                   FMGGAPAAPLTDQIPVQSATGLSFLAAA"
FT                   /protein_id="YP_001109773.1"
FT   gene            74441..75649
FT                   /db_xref="GeneID:4947390"
FT                   /locus_tag="Bcep1808_7110"
FT   CDS_pept        74441..75649
FT                   /locus_tag="Bcep1808_7110"
FT                   /gene_family="HOG000263304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dde:Dde_0484 hypothetical protein"
FT                   /db_xref="GI:134287608"
FT                   /db_xref="GeneID:4947390"
FT                   /translation="MDSRIAKQRTALVLDHPFIGALALRLKVREDLSCKTFWTDGETLG
FT                   YNPTYAERLNDLEVRGVLAHEVWHVAGGHCWRQGDRDPNGWNEACDYVVNLMVEAAGMQ
FT                   LPSGVLIDHRFKGMSAEEVYGVLSHEKRQVAKQPGGKQASDPPSGGKPGSLTGSPGSQP
FT                   PQPSDDKAVGPAASCGEVRQYAGPDKAAKAAEWKVAVLQAAKAAQACGKLGGALQAAVE
FT                   QSVAAVGDWRSLLHRFAQDAAPTDYTWAQPNRRYLHVGMYLPSLNEPAVGDAVFVRDAS
FT                   GSVWDETQAQFAAEILAVADAVRPRRLIVLDCDVRVTQVQVFERGEPAELAPLKGGGGT
FT                   SFIDPFRWVKREEIDPAFLVYLTDMAGTFPSEAPAYAVLWASTTPLKRARRAPFGETIE
FT                   VVC"
FT                   /protein_id="YP_001109774.1"
FT   misc_feature    74444..75640
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cl00057"
FT                   /db_xref="CDD:173993"
FT                   /locus_tag="Bcep1808_7110"
FT   gene            75925..76971
FT                   /db_xref="GeneID:4947391"
FT                   /locus_tag="Bcep1808_7111"
FT   CDS_pept        75925..76971
FT                   /locus_tag="Bcep1808_7111"
FT                   /gene_family="HOG000119934" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rme:Rmet_6302 type II secretion system protein E"
FT                   /db_xref="GI:134287609"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4947391"
FT                   /translation="MSEIAENPLLKVARLEENAVQLFFESLKLIKPYLESSTVAEVMIN
FT                   SANNIWVEERGEMRRLDIEFNPSTLTGAIHSLAASVEKSALAGTAQGIINGGHKNLRIA
FT                   TVMKPTAIDGDALAIRRHRETNLSINDYAKMGAFSLVHAKRSVDRPIFPPGVADEALAE
FT                   AFTAMVQQRANVLVAGGTSAGKTTFLNSLNGLIPREERVITIEDTMELKVDLPNRVRLL
FT                   SNPDKGVTTQILVALCLRFRPDRIIVGEVRGGEAYDFIQALSTGHDGGMGSIHSNDARG
FT                   GLTRLESLAMLGIPPGSRWELADMRKAIAECFHYVIHLRRTGELRHVSEVLAIKGFKDG
FT                   DYVLERVF"
FT                   /protein_id="YP_001109775.1"
FT   misc_feature    75943..76968
FT                   /note="Flp pilus assembly protein, ATPase CpaF
FT                   [Intracellular trafficking and secretion]; Region: CpaF;
FT                   COG4962"
FT                   /db_xref="CDD:34569"
FT                   /locus_tag="Bcep1808_7111"
FT   misc_feature    76387..76920
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcep1808_7111"
FT   misc_feature    order(76459..76464,76474..76482)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcep1808_7111"
FT   misc_feature    order(76465..76470,76525..76527,76549..76551,76570..76581,
FT                   76585..76590,76642..76650,76654..76656,76693..76695,
FT                   76705..76707,76714..76719,76747..76755,76765..76767,
FT                   76774..76776,76885..76887)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcep1808_7111"
FT   misc_feature    order(76468..76485,76900..76902)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcep1808_7111"
FT   misc_feature    76657..76674
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Bcep1808_7111"
FT   gene            76989..77369
FT                   /db_xref="GeneID:4947392"
FT                   /locus_tag="Bcep1808_7112"
FT   CDS_pept        76989..77369
FT                   /locus_tag="Bcep1808_7112"
FT                   /gene_family="HOG000263305" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6303 hypothetical protein"
FT                   /db_xref="GI:134287610"
FT                   /db_xref="GeneID:4947392"
FT                   /translation="MKKHIKSLSSRARKKLLATSHYLFGRGQRLSTLTALLLTFSAPAA
FT                   KAVDLGDMGNAADFICLIQAYVSGPWLYGIGIVLIIVGAVMISNSESNFGKFLSTIVVG
FT                   LGVASCAIPIVKNHLKINYTCA"
FT                   /protein_id="YP_001109776.1"
FT   sig_peptide     76989..77132
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.860 at
FT                   residue 48"
FT                   /locus_tag="Bcep1808_7112"
FT                   /product="hypothetical protein"
FT   gene            77410..77673
FT                   /db_xref="GeneID:4947393"
FT                   /locus_tag="Bcep1808_7113"
FT   CDS_pept        77410..77673
FT                   /locus_tag="Bcep1808_7113"
FT                   /gene_family="HOG000263306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6304 hypothetical protein"
FT                   /db_xref="GI:134287611"
FT                   /db_xref="GeneID:4947393"
FT                   /translation="MGGADRGLAIANGTLTTLLCYSSMSLVYLVIGIVVHWVLRWLSSS
FT                   DPWWKEVLVVYNRYPDVHEPLHTADFAARFRRPYGFDQELPL"
FT                   /protein_id="YP_001109777.1"
FT   misc_feature    <77410..77604
FT                   /note="Type IV secretory pathway, VirB3-like protein;
FT                   Region: VirB3; cl01501"
FT                   /db_xref="CDD:174635"
FT                   /locus_tag="Bcep1808_7113"
FT   gene            77670..80147
FT                   /db_xref="GeneID:4947394"
FT                   /locus_tag="Bcep1808_7114"
FT   CDS_pept        77670..80147
FT                   /locus_tag="Bcep1808_7114"
FT                   /gene_family="HOG000263307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6305 type IV secretory pathway VirB4
FT                   components-like protein"
FT                   /db_xref="GI:134287612"
FT                   /db_xref="GeneID:4947394"
FT                   /translation="MSANPKRRAIQEIAPWATMVTPEVILDKDGSLLTLYTFEGVDADS
FT                   PNSDEISAARDNLDHACKNFDHRITAWWRMSHRRVRGEIGGQFASEMDERVDAINQRSV
FT                   GSGKFFRNTHSLALAYTPETGINKLFEKIAYHITVGGKSVPIALLETIKDMVFSRSAFV
FT                   FDMERITSDIKRFEGILDAFKGGVARLKMKRLQLQHALAFLHQAANPSVPPRRVRYPVT
FT                   MLDTHLTETFVTYGAEHIMFESAYGTRYAKIISVKEWMGFQEAALDVLADVDAEFDVCV
FT                   MFRFLSTSKAQAYIEKMRKFYKVAAFSPVKILKGFFSKDEKKESMENERGREILAEEAE
FT                   NALARLIADGQQYGFVNISVVVYGDTSDECDDHAREIVGRIGNAGFGVLIEKRNLPAAW
FT                   ASTLPGRWDQQKRLQFVETPVVSDIAPVRGVAEGSDVNQWLTQQLGRKVGPLTLLPTRH
FT                   RTLQRITLHDPSGKSHTLIVGPIGAGKTIFLNFLVSQTGRFAPRRIKFDKNRSTRIPTM
FT                   FADGKFVDATGKFAAATQVNPLSMLVDPRHYTYVSGWVQMAIEGDGEDFRCTPQQERTI
FT                   YERVVTLAQGYGPEFWTLSFLTTLLPVELRDRLQIWTKGEKNGRFFDHVEDAFSLSDDL
FT                   AIEMGELFESYPVAAALFMDYAFYRISQWLDGKRVTIIEVEECGFFFRYPRFYARLEMW
FT                   AVTIRGLNGTLVMATQSLSQLERVPNFEILKENIQNFFFLPNRDARNNKRLYRDVFGLT
FT                   DDQIDMISDGIPNRDYLWVTPDHSRMLQAKFPKEALAILRADGAAQRTLDKHLASGSPT
FT                   WREDYLKEIATVD"
FT                   /protein_id="YP_001109778.1"
FT   misc_feature    77682..80054
FT                   /note="type IV secretion/conjugal transfer ATPase, VirB4
FT                   family; Region: VirB4_CagE; TIGR00929"
FT                   /db_xref="CDD:162115"
FT                   /locus_tag="Bcep1808_7114"
FT   misc_feature    <78720..78893
FT                   /note="VirB family, component of type IV transporter
FT                   system; Region: CagE_TrbE_VirB; pfam03135"
FT                   /db_xref="CDD:111973"
FT                   /locus_tag="Bcep1808_7114"
FT   gene            80380..81123
FT                   /db_xref="GeneID:4947395"
FT                   /locus_tag="Bcep1808_7115"
FT   CDS_pept        80380..81123
FT                   /locus_tag="Bcep1808_7115"
FT                   /gene_family="HOG000263308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6306 hypothetical protein"
FT                   /db_xref="GI:134287613"
FT                   /db_xref="GeneID:4947395"
FT                   /translation="MKNMRTFRAAVVAASMFMTQHAFAQLVVFDPTNFAQNVITAAKAV
FT                   KGEIYQNTNILYQYQMMMNDLLQAQNLNPAAWKAAYDQITGDIKKVNALVGTLQGLYGD
FT                   LNKGGEWVTQVQGLISRSGKSNAQWFSDMNTLFQQNDKVARNLFQMGSNIMQHTSDLAV
FT                   RRQQLQSQLSMSPTQQATAEITTHYLDIVTSQNADILQLSAAKAQKDAQKDAQQAEDDK
FT                   EKAADAEKFISKQQAERAAYGINSQ"
FT                   /protein_id="YP_001109779.1"
FT   sig_peptide     80380..80454
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_7115"
FT                   /product="hypothetical protein"
FT   misc_feature    80404..>80595
FT                   /note="Conjugal transfer/entry exclusion protein
FT                   [Intracellular trafficking and secretion]; Region: COG5314;
FT                   cl02193"
FT                   /db_xref="CDD:174714"
FT                   /locus_tag="Bcep1808_7115"
FT   gene            81120..82130
FT                   /db_xref="GeneID:4947396"
FT                   /locus_tag="Bcep1808_7116"
FT   CDS_pept        81120..82130
FT                   /locus_tag="Bcep1808_7116"
FT                   /gene_family="HOG000263309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6307 hypothetical protein"
FT                   /db_xref="GI:134287614"
FT                   /db_xref="GeneID:4947396"
FT                   /translation="MRRGMMRQWLPSGLLLIALVLPTVARAALQDTLTQFGTTGWSSSY
FT                   VVGEVAKGAMAAIEEITKLMTDLIDLAVTVSKSLEKDSDKMAGGLATITIIVAFLRFAA
FT                   TKDPVAAWGSAFEDLAVLGIFASVYLAYGTWAPGFYKWFNDLAVAVSGTDAQSLPMAMV
FT                   KSAGAIFDAVNEALKAEHWWNYVALVINLIPLLAAWFILMVASLVFLFYVSLGTIQMAV
FT                   AIVMGKIAFALGMSEFTRGWFKSWLDFTIGAGMYMVVAAILQRLMTTTLATTFGNTISK
FT                   GLTTPYAGSLTLDLSIFVLILAFEIPKFASMFGGGASASGAAFKSLTKLATKGMV"
FT                   /protein_id="YP_001109780.1"
FT   sig_peptide     81120..81203
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 28"
FT                   /locus_tag="Bcep1808_7116"
FT                   /product="hypothetical protein"
FT   misc_feature    81390..82040
FT                   /note="TrbL/VirB6 plasmid conjugal transfer protein;
FT                   Region: TrbL; cl01503"
FT                   /db_xref="CDD:174636"
FT                   /locus_tag="Bcep1808_7116"
FT   gene            82130..83455
FT                   /db_xref="GeneID:4947397"
FT                   /locus_tag="Bcep1808_7117"
FT   CDS_pept        82130..83455
FT                   /locus_tag="Bcep1808_7117"
FT                   /gene_family="HOG000263310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6308 hypothetical protein"
FT                   /db_xref="GI:134287615"
FT                   /db_xref="GeneID:4947397"
FT                   /translation="MSDARLFAPVNAAELVSRNERRIELIAQCANESSRAEFDRKWMVL
FT                   IRRCAEWFSSVPFGPDLYREPSGAFRWTVETAFYAMRLAGGLKFGTNLTSERRRRIEPQ
FT                   YNFGVFLAAICSGLDEPYRHFDVERATDCQVWNPSVHGAVGPWLAGTSYCVARRATALP
FT                   VERMRTGMLAHALVGTELLSGLDAEVQAEIFGAINPTQSPTGGVESLTHKVVRQAVATA
FT                   AEFDRKAQRAVFEPVTFAVPSAIHVAAELEPKVESAPPAAAPAPAPAEHVTADSSAAVA
FT                   AAGGGAPADPEMPLASDSEGARPRPVPAPVLQGAPKGPDERQMALELPPAAAVNPAEIR
FT                   REPGAAPATPAGERFDEILKGAPRMISDFFAALRQDVAGGKAKVRWAEKGLVVPKRTIG
FT                   GYGVASDTLIEHMRRRNLLLANDPTEVTLAPRIGELILERGA"
FT                   /protein_id="YP_001109781.1"
FT   misc_feature    82145..>82783
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Bcep1808_7117"
FT   gene            83452..85320
FT                   /db_xref="GeneID:4947398"
FT                   /locus_tag="Bcep1808_7118"
FT   CDS_pept        83452..85320
FT                   /locus_tag="Bcep1808_7118"
FT                   /gene_family="HOG000221876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6309 hypothetical protein"
FT                   /db_xref="GI:134287616"
FT                   /db_xref="GeneID:4947398"
FT                   /translation="MRGYINHFRPIYEVRATIGWLIALFALPLSGMPYGGAFALFALAL
FT                   FAFRSGQVWRALKFRMGLSTKWLTTLAVPTLLAIQNRMRAEVNAMYLGTGFEWTQKHCQ
FT                   MAHDILRMPTTEIPGLPKWLPKTKAGRAFEEMIENLFAPKDSIRDRTPQGASWIHGLEP
FT                   AKGHVPFHYKAMGGHTAVGGTTGSGKTRTYEVISTQVIHCGDVLIDIDPKNDKEWKARA
FT                   EREAKRTGRKFLYFNQAKPSESIRLEPLDSWSQPSEIPSRIAQLMEEGPFRDFAYLFIS
FT                   RSVNGELYIGDKPNLRSILKYAQLGIDPLLEKALKRFFIESGLTDWDELVTADTVKIAN
FT                   KPGSTRVDAMISLYQARFGANDRGHEAIDGLIATHVHDREHYMRIIASALPLLQMLATG
FT                   ETGLMLAPKVDDFEDEREIWTIEKVIRQKAVLHIGLDSLSNSIVAKAIASMILADVSAV
FT                   CGSIYNFYDSPPEVVLIIDEIAEAINEQVIQILNKGRGAGFKAFVAFQTRADLEAKLGN
FT                   AAKMLQVLGNLNNQIILRLEDTDTAEWFSKKVGDTAIRNLIVSSSTSKASEGHVGEFTG
FT                   SVTRSQQLEAVPLIPTRLIQTLPNLQYFMRISGGAVYQGRIPILTG"
FT                   /protein_id="YP_001109782.1"
FT   misc_feature    83983..85248
FT                   /note="TraG/TraD family; Region: TraG; pfam02534"
FT                   /db_xref="CDD:111435"
FT                   /locus_tag="Bcep1808_7118"
FT   misc_feature    <84784..85284
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7118"
FT   misc_feature    84868..84882
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7118"
FT   gene            85331..85846
FT                   /db_xref="GeneID:4947399"
FT                   /locus_tag="Bcep1808_7119"
FT   CDS_pept        85331..85846
FT                   /locus_tag="Bcep1808_7119"
FT                   /gene_family="HOG000263311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6310 hypothetical protein"
FT                   /db_xref="GI:134287617"
FT                   /db_xref="GeneID:4947399"
FT                   /translation="MSAVFKKIIREHKLSAHLTPVFTFAPELELVCTRVAEFVGEHFIG
FT                   RAEPLVKEMFVDGLAAFKRVRKTGDPHVAFMQGLFGSAHMLYARRFVVRDGDRFHVWSP
FT                   MFEPVTVFESRFKLAPEMVDERCPENVSQKSAAFQLAARALTGETFRLYFEEYDVAHTF
FT                   SDSDADAA"
FT                   /protein_id="YP_001109783.1"
FT   gene            86056..86661
FT                   /db_xref="GeneID:4947400"
FT                   /locus_tag="Bcep1808_7120"
FT   CDS_pept        86056..86661
FT                   /locus_tag="Bcep1808_7120"
FT                   /gene_family="HOG000263313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6312 hypothetical protein"
FT                   /db_xref="GI:134287618"
FT                   /db_xref="GeneID:4947400"
FT                   /translation="MAGSRFVGHIKMWFFFVPLLSVVLMPVAPDTSLFEIPDDEAASVA
FT                   KSLGEARTADAIEATNRTFKHYFIESGLVAASLDSTGGSQIEDGGVAGFASRWVHNFWR
FT                   LVYRMVYRLTVMKHWLLGVLVFGIAMFIDGTVRRKVRAAAAGYVSPLSFHLAGHGILLV
FT                   FGVTFTVLIAPVPLLAPYWLAIAACLGALLWKAASSYQ"
FT                   /protein_id="YP_001109784.1"
FT   gene            87016..87909
FT                   /db_xref="GeneID:4947401"
FT                   /locus_tag="Bcep1808_7121"
FT   CDS_pept        87016..87909
FT                   /locus_tag="Bcep1808_7121"
FT                   /gene_family="HOG000263314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6313 hypothetical protein"
FT                   /db_xref="GI:134287619"
FT                   /db_xref="GeneID:4947401"
FT                   /translation="MSTINDEAHVGTDTADVAVDHAAASELPGSDVPAATGGPAVNDGR
FT                   QTTDGADDGDVERELDEMERSAGILQREGLISAEEAVTKLEEVARTRTLFRDLPPEQRA
FT                   RIVQRRREIGRELMNKQLSGAAVVAARVTMKHTRLKPLFEQWWPYLNRMTINMQRFGRA
FT                   TYGASEQGIVSTWFEKQLEQLEGYVNEQLDVAKGFREKTETEMRARGETVFEPTVTKPS
FT                   LDIEVEAYSRFSMRLLTVILKFDEVMDHFDFLVWNGIRDQSDVDDETARFLRKFHPVGL
FT                   RGYTTHLKLMNTVRGN"
FT                   /protein_id="YP_001109785.1"
FT   gene            87927..89648
FT                   /db_xref="GeneID:4947402"
FT                   /locus_tag="Bcep1808_7122"
FT   CDS_pept        87927..89648
FT                   /locus_tag="Bcep1808_7122"
FT                   /gene_family="HOG000229064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UvrD/REP helicase"
FT                   /transl_table="11"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rme:Rmet_6314
FT                   UvrD/REP helicase"
FT                   /db_xref="GI:134287620"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="GeneID:4947402"
FT                   /translation="MLDELNPQQREVALLRRHCLAIACPGAGKTKMSAAKAAWRLQDPT
FT                   AMVGAVTFSKDAAVELRERILALAPPDAKRRLFAGTFHSLAYKQLHRPGRGRPDIASDG
FT                   DRLGMLGRVLAELGYDWKVEEAVPIIERIKMNFGRADEGSAEATLYAAYQDALERNGKI
FT                   DFQDMLRLAVEQMQRGDITPYRFTDLLVDEFQDTDPLQFRWVELHARAGTHVTVVGDDD
FT                   QSIYGFRAALGFGGMERFASTFEAQRVVLGSNYRCRAEILAAADLVIQNNIDRMPKVLH
FT                   AARGAGGAVAARRFDDEYGDAVAALEVLHPKLAAGASCAILARTNRILDPIESVCRSHG
FT                   VPYYRASGGSVLNKPQAALMCNLLQVVEGHKQNGIDAVLGYMGMSSYDLGALHKRMGTA
FT                   FVQLQKQELVGLGLREDTATAYRAFMKRLGEWQALCQRSFHSLALEGVYEWMMTYAKGD
FT                   VAIRAIQCIYDVVSRLNGSFTERIEFLKRDNNKPGDGVLVLTTMHSSKGLEYDHVWISR
FT                   SEEGVVPDDKSPESEERRLFYVAMTRARDSLTISSIKKNPVSRFVIESRIEQTSAA"
FT                   /protein_id="YP_001109786.1"
FT   misc_feature    87933..89630
FT                   /note="Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]; Region: UvrD;
FT                   COG0210"
FT                   /db_xref="CDD:30559"
FT                   /locus_tag="Bcep1808_7122"
FT   misc_feature    87939..89027
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:175496"
FT                   /locus_tag="Bcep1808_7122"
FT   misc_feature    <89424..89576
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:175496"
FT                   /locus_tag="Bcep1808_7122"
FT   gene            complement(90004..90411)
FT                   /db_xref="GeneID:4947403"
FT                   /locus_tag="Bcep1808_7123"
FT   CDS_pept        complement(90004..90411)
FT                   /locus_tag="Bcep1808_7123"
FT                   /gene_family="HOG000263315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   rme:Rmet_6225 protein of unknown function DUF583"
FT                   /db_xref="GI:134287621"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="GeneID:4947403"
FT                   /translation="MKAKPNNVTVLMPGLVVEGNMILDHGLSVFALANGDIISTEGLLH
FT                   VGAGGIVKGKVQGEIVRIDGLVEGDVHARDMLEINGRVLGNVFYCGTIRLGQQAALNGQ
FT                   LRRVSRELVIENARAERETAPERLESQGAAQ"
FT                   /protein_id="YP_001109787.1"
FT   misc_feature    complement(90103..90387)
FT                   /note="Protein of unknown function, DUF583; Region: DUF583;
FT                   cl09137"
FT                   /db_xref="CDD:158432"
FT                   /locus_tag="Bcep1808_7123"
FT   gene            90946..91209
FT                   /db_xref="GeneID:4947404"
FT                   /locus_tag="Bcep1808_7124"
FT   CDS_pept        90946..91209
FT                   /locus_tag="Bcep1808_7124"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287622"
FT                   /db_xref="GeneID:4947404"
FT                   /translation="MCGRPLNVYYRLRRMGRVPELRRADARESRPRYDSKDDRGRPAEF
FT                   SPGRRKSSGNALARRFLSVRSRERQDVAVDVDDDRLRRVLGM"
FT                   /protein_id="YP_001109788.1"
FT   gene            complement(91355..91963)
FT                   /db_xref="GeneID:4947405"
FT                   /locus_tag="Bcep1808_7125"
FT   CDS_pept        complement(91355..91963)
FT                   /locus_tag="Bcep1808_7125"
FT                   /gene_family="HOG000263316" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6223 hypothetical protein"
FT                   /db_xref="GI:134287623"
FT                   /db_xref="GeneID:4947405"
FT                   /translation="MSAVLEPPHEGRGQPDTPTQNTPPTDESPVRLATSTGLKPIQRLT
FT                   SDSRIDKIVPDSDAVTILHYSSVFARTFIRSDYNFCAAKIAVARGGKVLAVQTALRETA
FT                   DWMRKATAWVERHNARALTFPYEQIELKVTRPLAGLLVRCLTQYDRLFVASMEAQLAEK
FT                   ITPQDRANILKNAEGRILHVRTVCIPDNDRFDADGTARD"
FT                   /protein_id="YP_001109789.1"
FT   gene            92493..92849
FT                   /db_xref="GeneID:4947406"
FT                   /locus_tag="Bcep1808_7126"
FT   CDS_pept        92493..92849
FT                   /locus_tag="Bcep1808_7126"
FT                   /gene_family="HOG000263317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287624"
FT                   /db_xref="GeneID:4947406"
FT                   /translation="MGHLTESTKRAPLPRNALFFRLFFSVPEVRVLPNRLNSRIADVIS
FT                   QTIAEERSTTDTTTPAWRERCEVAQVAMFTDSDRRIFLSSIANRRGEAAANALEQSADA
FT                   LRTQAIFQLARKPS"
FT                   /protein_id="YP_001109790.1"
FT   gene            92846..94120
FT                   /db_xref="GeneID:4947407"
FT                   /locus_tag="Bcep1808_7127"
FT   CDS_pept        92846..94120
FT                   /locus_tag="Bcep1808_7127"
FT                   /gene_family="HOG000229613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6221 hypothetical protein"
FT                   /db_xref="GI:134287625"
FT                   /db_xref="GeneID:4947407"
FT                   /translation="MNAVVSLIGGPVRSVVEERAMRPPVIGKIRPGIKVLTSAARGNPD
FT                   AVALYEEMVAAGDSFETIGKAIESRCRLKHALAPRNTDYFTCRRSDFNNPDVADEILRL
FT                   YGENRGQGIRLYRFPVLFAFNDWMQNIPNEMAAWGSSGRKYFSQYGPDGLRYCKTYAKV
FT                   ERDPRAQRAARHFGGRDVIFRQDDAIPDGICNPEQCPQYQSRQCNLGAQFIFAIPDIKG
FT                   LGLIELPTNSIYVLQKAYAAMKTVQLARGKLTGTKFWISKREFDITRINEAGDAVRQMQ
FT                   MLTVLDADIDIGALLDGAEDATAPIEGAGRPTLPDSGSTVIHLHPSEGESPAMRADQAV
FT                   AADGPPESMDEKRHRMQDLLQRLRFVEEDQRKAFRIYGHFRFGRGWVERPTDVDKMIAR
FT                   LTTALEDPTSLQSEIGAAVESYHGT"
FT                   /protein_id="YP_001109791.1"
FT   gene            94288..94773
FT                   /db_xref="GeneID:4947408"
FT                   /locus_tag="Bcep1808_7128"
FT   CDS_pept        94288..94773
FT                   /locus_tag="Bcep1808_7128"
FT                   /gene_family="HOG000270610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein CHP02464; KEGG:
FT                   mxa:MXAN_5330 hypothetical protein"
FT                   /db_xref="GI:134287626"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="GeneID:4947408"
FT                   /translation="MRRIGNITAFFGAADVFSNWHPCSFTFHDVTFNCGEQFMMYAKAM
FT                   LFDDHATAEAILSSTSPREQKRLGRSVRGFYEARWITAREKIMFVGCREKFRQNEALAI
FT                   ALRATGTSVLVEASPYDRIWGVGLGEQDPRIADPSAWLGLNLLGKALMHVRDALSRS"
FT                   /protein_id="YP_001109792.1"
FT   misc_feature    94315..94761
FT                   /note="Domain of unknown function (DUF1768); Region:
FT                   DUF1768; cl01271"
FT                   /db_xref="CDD:174603"
FT                   /locus_tag="Bcep1808_7128"
FT   gene            94854..96209
FT                   /db_xref="GeneID:4947409"
FT                   /locus_tag="Bcep1808_7129"
FT   CDS_pept        94854..96209
FT                   /locus_tag="Bcep1808_7129"
FT                   /gene_family="HOG000229066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair exonuclease-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6220 DNA repair exonuclease-like
FT                   protein"
FT                   /db_xref="GI:134287627"
FT                   /db_xref="GeneID:4947409"
FT                   /translation="MKIAHFSDLHYAHEHLDEADRCFSHAVADAIAREAQVAVISGDST
FT                   DHRLDAHAPALNSLATQVHRLAQAMPVLMLQGTFSHEPPGTLDNFALMGARYPVAIADR
FT                   VCQVALYNGNFWFSRGPVFDEDEVQHHLCSEPEAVFTCLPTMNKAELALRVGSLAASTD
FT                   FADTLVGFLAAAGRINAAFRTVGVPTIGVSHGTVNGCQTEHGVTMAGFDHEFSLSALFG
FT                   AECSAFMLGHIHKYQTWEREGRLVGYPGSIGRFHYGELGNKGYLSWEVSATDAHAVLVP
FT                   TPSREMVSVAFDGPPDTNELEALAAASAGKFVRIRWQIDEEHKQLVDRKAIEEMFSTAA
FT                   GVKLEPRVLPVMRSRAEGISTAPTVDAKLTRWSELADVDAVPLVDRLQLLEAGEPDAIA
FT                   QAILARLASADEPAGGQFGTPIVEPALSLATMAAISPAADEPSWLSDDLFAA"
FT                   /protein_id="YP_001109793.1"
FT   misc_feature    94854..96092
FT                   /note="DNA repair exonuclease [DNA replication,
FT                   recombination, and repair]; Region: SbcD; COG0420"
FT                   /db_xref="CDD:30769"
FT                   /locus_tag="Bcep1808_7129"
FT   misc_feature    94857..95609
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Bcep1808_7129"
FT   misc_feature    order(94875..94877,94881..94883,94980..94982,95091..95096,
FT                   95433..95435,95547..95549)
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_7129"
FT   misc_feature    order(94875..94877,94881..94883,94980..94982,95091..95093,
FT                   95433..95435,95547..95549)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_7129"
FT   gene            96409..96930
FT                   /db_xref="GeneID:4947410"
FT                   /locus_tag="Bcep1808_7130"
FT   CDS_pept        96409..96930
FT                   /locus_tag="Bcep1808_7130"
FT                   /gene_family="HOG000263318" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6219 hypothetical protein"
FT                   /db_xref="GI:134287628"
FT                   /db_xref="GeneID:4947410"
FT                   /translation="MFGLYPAGVRWAQFYTASTDAKALQKCLVDHGGCTAALFHQPFGA
FT                   QRGAVIAQRDGLFVLTHVIDADQAEIVVTPGVELQNLIWSFDSGYSGQWSGRELQILTG
FT                   CPDWDAVLKQTSDAFRRLCGTVQAAVDGTLGKPASRPEPTLTIDDDDVPFLPDDYLQPI
FT                   TLAEIQSCDH"
FT                   /protein_id="YP_001109794.1"
FT   gene            96918..99239
FT                   /db_xref="GeneID:4947411"
FT                   /locus_tag="Bcep1808_7131"
FT   CDS_pept        96918..99239
FT                   /locus_tag="Bcep1808_7131"
FT                   /gene_family="HOG000229067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ATPase involved in DNA repair"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6218 putative ATPase involved in DNA
FT                   repair"
FT                   /db_xref="GI:134287629"
FT                   /db_xref="GeneID:4947411"
FT                   /translation="MRPLKLLLEGFHGVRDGMKRDSVELDLESLPNGLIALTGPNGAGK
FT                   TTIMDNLHPYRIMPSRASKLSVDAFSYWDHICGVQARKEFEWEHDGLRYRSTFAFRKPG
FT                   KTGKADYFLFYRSTDGEWRPVSLPDGTVSDGKGETYDRCVDAICGSLESFFTSVFSAQN
FT                   RRPLASYGASEIKALLAELLKIDHLRALSTKAAEVAKVLARQLGVVQQDLTAFSGKRER
FT                   VDQTRNAIAMDVSEIAKAREQRTAAQAEIATLTQQHAVLVAKQGENGGAAARLGELGAR
FT                   RNELRTSLDVLESDGQAEQQRLLQRATAIRNTIAGHAAVVRQRESILGAAADRDDAQLR
FT                   LSKAEALIEPLQRAIDELDAKRLRAATVGSTLSSLQSEGTTKADLIKTLTEQSAVIGSV
FT                   PCAGMDIHMTCPLLAQARSAAQQVDVHTISLDDLRTRYRGHKAELDQLAPAVEALSVTR
FT                   AELQRVNAEISAARQALQRATELAARKPLLDAAETGIQQGQAELASLDVERGEVSKRRE
FT                   AETARLNGLLREVEAEVSRVAAVDVAQAIADVDRQLATRRETCTGLDARIEALIRSQAT
FT                   GETTLVTLERELEGFSATQALAERISDEIAKWKLLAKGLGNDGVIALTIDDAGPALTQT
FT                   VNDLLLACYGTRFTVEIQTQRTLANGETREGFEILVHDAESDSSKAVGVMSGGQKVWIN
FT                   ECLTRGVALYIAANAGQPYETLFSDESDGPLDPDRKVQFMRMKREVLRQGGYAREFFIS
FT                   QTPDLIAEADAVIDVAALAR"
FT                   /protein_id="YP_001109795.1"
FT   misc_feature    96918..>98495
FT                   /note="ATPase involved in DNA repair [DNA replication,
FT                   recombination, and repair]; Region: SbcC; COG0419"
FT                   /db_xref="CDD:30768"
FT                   /locus_tag="Bcep1808_7131"
FT   misc_feature    96918..>97229
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7131"
FT   misc_feature    97032..97055
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7131"
FT   misc_feature    order(97041..97046,97050..97058)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7131"
FT   gene            99784..100344
FT                   /db_xref="GeneID:4947412"
FT                   /locus_tag="Bcep1808_7132"
FT   CDS_pept        99784..100344
FT                   /locus_tag="Bcep1808_7132"
FT                   /gene_family="HOG000222239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative endonuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVc0026 putative endonuclease"
FT                   /db_xref="GI:134287630"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:4947412"
FT                   /translation="MKKQISWAVLAASLCCCIAIAFAGRAQAETLPMVEVAFSPDGGAE
FT                   SLVLRTIGEARKSIRVLAYSFTAPAVTRALIAAKRRGIDVAVTVDARSNFDHDRSGRAR
FT                   AALGALAYAGIPVRVVNVFPAQHSKFIVVDGGTVETGSYNYSQQARYNAENVIVLRGDT
FT                   GVADAYQKNWEALSARGQLYRAP"
FT                   /protein_id="YP_001109796.1"
FT   sig_peptide     99784..99870
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_7132"
FT                   /product="hypothetical protein"
FT   misc_feature    99895..100311
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7132"
FT   misc_feature    order(100162..100164,100168..100170,100207..100209,
FT                   100213..100215,100243..100245)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7132"
FT   misc_feature    order(100162..100164,100168..100170,100183..100185,
FT                   100204..100209,100213..100215)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7132"
FT   gene            complement(100523..100747)
FT                   /db_xref="GeneID:4947413"
FT                   /locus_tag="Bcep1808_7133"
FT                   /pseudo
FT   gene            complement(100991..101311)
FT                   /db_xref="GeneID:4947414"
FT                   /locus_tag="Bcep1808_7134"
FT   CDS_pept        complement(100991..101311)
FT                   /locus_tag="Bcep1808_7134"
FT                   /gene_family="HOG000263319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu0540 hypothetical protein"
FT                   /db_xref="GI:134287631"
FT                   /db_xref="GeneID:4947414"
FT                   /translation="MDSRDVDVCRQIGQLLYDAAPVRSRSIIMRAQLADDEDQAKFEFD
FT                   AVAENGESSWFLGSASLNGKLLELLLEHRRFFLSRNQPKWKLFTIIIDVEKRRFSLDLK
FT                   YD"
FT                   /protein_id="YP_001109797.1"
FT   gene            complement(101314..101601)
FT                   /db_xref="GeneID:4947415"
FT                   /locus_tag="Bcep1808_7135"
FT   CDS_pept        complement(101314..101601)
FT                   /locus_tag="Bcep1808_7135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287632"
FT                   /db_xref="GeneID:4947415"
FT                   /translation="MQVLASACRSVSASQMASHSLLAWHATKGHANGNSTTWSNTHVTA
FT                   GDTLAIELGADMNLNGRLRPASDGLKGLTSRTQLEMINQHISILRIRPGR"
FT                   /protein_id="YP_001109798.1"
FT   gene            101830..102885
FT                   /db_xref="GeneID:4947416"
FT                   /locus_tag="Bcep1808_7136"
FT   CDS_pept        101830..102885
FT                   /locus_tag="Bcep1808_7136"
FT                   /gene_family="HOG000114767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rme:Rmet_6282 integrase, catalytic region"
FT                   /db_xref="GI:134287633"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="GeneID:4947416"
FT                   /translation="MGTHYQHLSAEERATIMILLQQGCSARGIARTLRRSPSTITREIR
FT                   RALQWPQRTAFVPAGSGGCTYDARAAGARACAMRLKRRRHPKLAEDGVLFGVVHHFLLE
FT                   GWSPSQIAGTLKRMWPDDLDRRVSHETIYNCIYAMPRGELRKELIACLRRAQAKRMPRS
FT                   RGQDRRGQLPDAVSIHLRPPEANERAFPGHWEGDLLKGAANRSAVGVLVERSSRLVLLA
FT                   KLKDATAASALEGFTAKLRSIAEPMRKTLTYDRGKEMARHPELSEATGIRVYFCDPRSP
FT                   WQRGSCENINGLLRQYLPKGTDLSVYSQEELDAIADRLNSRPRAIHGFYPPIAVYQAML
FT                   EKVTQASHSLQ"
FT                   /protein_id="YP_001109799.1"
FT   misc_feature    101830..102855
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Bcep1808_7136"
FT   misc_feature    <102574..102723
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7136"
FT   gene            complement(103004..103327)
FT                   /db_xref="GeneID:4947417"
FT                   /locus_tag="Bcep1808_7137"
FT   CDS_pept        complement(103004..103327)
FT                   /locus_tag="Bcep1808_7137"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287634"
FT                   /db_xref="GeneID:4947417"
FT                   /translation="MSPHRLSTEHQHRPPGERPSSKFARGGETSRGSAVLRGEAYPCLH
FT                   ILEFRKTSMKSVLALAIAATDAVAFIARSPAAPSRTARDRTAVALACASRIGAIVLAYI
FT                   GVF"
FT                   /protein_id="YP_001109800.1"
FT   gene            complement(103366..103851)
FT                   /db_xref="GeneID:4947418"
FT                   /locus_tag="Bcep1808_7138"
FT   CDS_pept        complement(103366..103851)
FT                   /locus_tag="Bcep1808_7138"
FT                   /gene_family="HOG000263320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287635"
FT                   /db_xref="GeneID:4947418"
FT                   /translation="MDCKSRYTDLIYFAHGDVAACRYRFFLISADPKQVVLQLDNHRGQ
FT                   RGILISDHQTRDGILNRIADRELDGIPFAMLCVALSENNIHHVVSAEPDLEDYIHRGHP
FT                   YRRIPEKAARGRHIERISIDSRNLTIGRARIQTAHDTPTLTAPDLASLLNSADIGAS"
FT                   /protein_id="YP_001109801.1"
FT   gene            complement(103922..104851)
FT                   /db_xref="GeneID:4947419"
FT                   /locus_tag="Bcep1808_7139"
FT   CDS_pept        complement(103922..104851)
FT                   /locus_tag="Bcep1808_7139"
FT                   /gene_family="HOG000267540" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bur:Bcep18194_C6618 phage integrase"
FT                   /db_xref="GI:134287636"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4947419"
FT                   /translation="MDDPTLWLSAPTDAYRQWQRTEAAGADRRAFSPRSIVQHEAMFER
FT                   FMRHLIAARRSLATFGPDHLESFFADLDRRCKPGTTTRLRYQKLLDRLGRHLVDVGVRK
FT                   TNPAAVYTLSQTWPDDEPVPIYLVEDDDHRLQASIRSIDGLDDRALRNRAIVGLLLSTG
FT                   ITAQEIRHTAAADLDLSPARPHLRIPKRGPREERRINIDEFAARALVSWRNLSGTTGNP
FT                   LLFPSPRAGGPMTDEMLGRIVRDELAAVAIRVPDMSPRTLRNTYARRLLLAGQSNDDVM
FT                   RALGLTSQRTVIRIRATLAPSPQAADAT"
FT                   /protein_id="YP_001109802.1"
FT   misc_feature    complement(104030..104770)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Bcep1808_7139"
FT   misc_feature    complement(order(104063..104065,104072..104074,
FT                   104279..104281,104357..104359))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7139"
FT   misc_feature    complement(order(104063..104065,104072..104074,
FT                   104357..104359))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7139"
FT   misc_feature    complement(order(104072..104080,104279..104281,
FT                   104354..104359))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7139"
FT   gene            complement(105070..105453)
FT                   /db_xref="GeneID:4947420"
FT                   /locus_tag="Bcep1808_7140"
FT   CDS_pept        complement(105070..105453)
FT                   /locus_tag="Bcep1808_7140"
FT                   /gene_family="HOG000263321" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A3819 hypothetical protein"
FT                   /db_xref="GI:134287637"
FT                   /db_xref="GeneID:4947420"
FT                   /translation="MPEKFEFDTEVDPVLFDHALERATEDFRRVVMSITARYCTSGLTV
FT                   FVTWPALLEIEEEAFSDLGFQSRNEAAVVAALPRIGPTTLPGVDLNALIDWDLSAEPLP
FT                   VAYQCVRDHLRSMSSAAQRGGEV"
FT                   /protein_id="YP_001109803.1"
FT   misc_feature    complement(105073..105432)
FT                   /note="Protein of unknown function (DUF2471); Region:
FT                   DUF2471; pfam10616"
FT                   /db_xref="CDD:151139"
FT                   /locus_tag="Bcep1808_7140"
FT   gene            complement(105560..105901)
FT                   /db_xref="GeneID:4947421"
FT                   /locus_tag="Bcep1808_7141"
FT   CDS_pept        complement(105560..105901)
FT                   /locus_tag="Bcep1808_7141"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bte:BTH_I2686 H-NS histone family
FT                   protein"
FT                   /db_xref="GI:134287638"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947421"
FT                   /translation="MLVNINFLFTTGEKMSTFHELLAQRAALEAEIEAAKAEERLIALE
FT                   EVKRLVDEFAFSTREVFGTSAVRKRQPVQPRYRDPATGATWSGRGRSPAWIDGKDRSQF
FT                   QIAPPTVQG"
FT                   /protein_id="YP_001109804.1"
FT   misc_feature    complement(105584..105697)
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:175028"
FT                   /locus_tag="Bcep1808_7141"
FT   gene            complement(105964..109110)
FT                   /db_xref="GeneID:4947422"
FT                   /locus_tag="Bcep1808_7142"
FT   CDS_pept        complement(105964..109110)
FT                   /locus_tag="Bcep1808_7142"
FT                   /gene_family="HOG000021783" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bch:Bcen2424_6871 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP C-terminal domain protein; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="GI:134287639"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="GeneID:4947422"
FT                   /translation="MDAGSFGALPAYAELQVASDFSFLHGASRAEEYVARAAQLGYSAI
FT                   AITDECSLAGVVRAHVEAKAANMALIIGSHFRLTAADGAPALAFTALAMNRDGYGNLCE
FT                   FISLGRMRGKKGTYRLAPLDLEHPEAPYTHLRGLPDCIAILSPDFPANEQRLDAQVEWF
FT                   ARVFGDRAWVALTLHARAMDDIHRGVVERVAARHGVPVVATSWPLMHVRSRKPLQDVLT
FT                   GIRVGRPVSECGYELAPNAERHLRSRLRLANLYPAGALEETVRVARRCTFSLDDLKYEY
FT                   PDELVPAGTDPATYLREQTYIGARRRFPAGIPIDVQAQIEHELQLIADLKYEAYFLTVY
FT                   DIVQFAREQGILCQGRGSAANSSVCYCLGVTEVDPSRQSMLFERFISKERNEPPDIDVD
FT                   FEHQRREEVMQYIYRKYGRDRAALTAAVTTYRPRSALREAGKALGVDPAIVDRVAKQHH
FT                   WFDSRADLLQRFSEAGLDPDAPLNQQWAAFAAQLLGYPRHLSQHSGGFVISRGKLTRLV
FT                   PVENAAMEDRSIIQWDKDDIEALGILKIDVLALGMLSMVRRALDMISEKRGETFELQDI
FT                   PAEDKATYDMLCDGDSMGVFQVESRAQMSMLPRLRPQCFYDLVIEVAIVRPGPVQGGMV
FT                   HPFLRRRQGLEPVTFPSEGMEKALARTLGVPIFQEQVMQVAMLAAGFSAGEADQLRRAM
FT                   AAWKRKGGLEPYHERLVSGMLERGYDREFAESIFAQIKGFGEYGFPESHAASFALLVYS
FT                   SAWLRRHEPAVFLAALLNSQPMGFYTPSQLLQDARRRGVEVLPVDVNVSTWDSALEGPA
FT                   TSAPVRLGFSLLRGMREDVAGRIELARAARPFVDVADLARRARLDRHDLQVLARANALC
FT                   SLTGGRRAALWLAAAALPDRDLLRGTERDDTVPALPQASEGHEIVTDYRAMGFTLGRHP
FT                   LALLRERLALDRLQSAEQLATLRSGQLARACGLVTVRQRPGTANGVLFMTLEDETGQVN
FT                   VILWPGLLEKFRKEALGAALLAVYGVWQAEGKVRHLIASKLVDRTELLGALPTTSREFC
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_001109805.1"
FT   misc_feature    complement(105970..109089)
FT                   /note="error-prone DNA polymerase; Validated; Region:
FT                   dnaE2; PRK05672"
FT                   /db_xref="CDD:168166"
FT                   /locus_tag="Bcep1808_7142"
FT   misc_feature    complement(108892..109071)
FT                   /note="DNA polymerase alpha chain like domain; Region:
FT                   POLIIIAc; cl02625"
FT                   /db_xref="CDD:174726"
FT                   /locus_tag="Bcep1808_7142"
FT   misc_feature    complement(106957..108228)
FT                   /note="Bacterial DNA polymerase III alpha subunit; Region:
FT                   DNA_pol3_alpha; pfam07733"
FT                   /db_xref="CDD:149024"
FT                   /locus_tag="Bcep1808_7142"
FT   misc_feature    complement(106003..106236)
FT                   /note="DnaE_OBF: A subfamily of OB folds corresponding to
FT                   the C-terminal OB-fold nucleic acid binding domain of
FT                   Thermus aquaticus and Escherichia coli type C replicative
FT                   DNA polymerase III alpha subunit (DnaE). The DNA polymerase
FT                   holoenzyme of E. coli...; Region: DnaE_OBF; cd04485"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="Bcep1808_7142"
FT   misc_feature    complement(order(106018..106020,106072..106074,
FT                   106078..106080,106084..106086,106234..106236))
FT                   /note="generic binding surface II; other site"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="Bcep1808_7142"
FT   misc_feature    complement(order(106033..106041,106060..106068,
FT                   106087..106089,106132..106134,106138..106146,
FT                   106162..106164,106168..106179,106213..106221))
FT                   /note="generic binding surface I; other site"
FT                   /db_xref="CDD:72957"
FT                   /locus_tag="Bcep1808_7142"
FT   gene            complement(109117..110496)
FT                   /db_xref="GeneID:4947423"
FT                   /locus_tag="Bcep1808_7143"
FT   CDS_pept        complement(109117..110496)
FT                   /locus_tag="Bcep1808_7143"
FT                   /gene_family="HOG000222372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6870 hypothetical protein"
FT                   /db_xref="GI:134287640"
FT                   /db_xref="GeneID:4947423"
FT                   /translation="MLEGGRVVALDRAARALGVVAGMRRGGVLSLAPDAQIRERDAARE
FT                   RELVLGVAYALLQFTPSVVDADEAVVVLDVTASLRLFHGILALRQRVRDVVASFGVTAA
FT                   ISVASSGPAAWMVARGLRGGLALSARSLRRALARVPLVVAPDARRYANWFEDLGCETLA
FT                   DLQRLPRAGLRKRCGTQLLDWLDQVAGTAPAAYDWLEMPPSFDTRVELMDRVEHAEALL
FT                   FVARRLILQLTGWLTAKQLDVAAFTLLLEHERGRDAIAPTEIEIALGAPTRFEEHLTRL
FT                   VKERLGHVELAGPVIAVRLVARSVQEAAAPSDSLFPEPGGTPQDHARLLELLTARLGSE
FT                   NVLVAAPMADYRPEPAARWVPMRDAPKPSPLPSDLPRPAWLLAKPVPLLTREHRPFYGT
FT                   PLRIVSPGERIEGGWQDGQTVTRDYFVAEDDNGICYWIYKERPTASDESEARFFLHGLF
FT                   G"
FT                   /protein_id="YP_001109806.1"
FT   misc_feature    complement(109576..110409)
FT                   /note="DNA Polymerase Y-family; Region: PolY_like; cd03468"
FT                   /db_xref="CDD:176458"
FT                   /locus_tag="Bcep1808_7143"
FT   misc_feature    complement(order(109672..109674,109678..109692,
FT                   109780..109782,109867..109884,109960..109962,
FT                   110047..110052,110053..110058,110287..110289,
FT                   110296..110298))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176458"
FT                   /locus_tag="Bcep1808_7143"
FT   gene            complement(110516..111232)
FT                   /db_xref="GeneID:4947424"
FT                   /locus_tag="Bcep1808_7144"
FT   CDS_pept        complement(110516..111232)
FT                   /locus_tag="Bcep1808_7144"
FT                   /gene_family="HOG000222360" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6829 hypothetical protein"
FT                   /db_xref="GI:134287641"
FT                   /db_xref="GeneID:4947424"
FT                   /translation="MHPALAHPEQIHPSLWRASQLARPSARGIDTGHAVLSAELPGGGW
FT                   PASALIELLAPQPGIGELRLLAPVLARAASRPVMLIQPPHALQPLALAYWGIDPSGFVT
FT                   LAAPRTADALWAADQALRAGTCAAVLLWQQHVRADALRRLNLAAQNGSALFFLFRPAAA
FT                   ARDPSPAPLRLALAPKRDGVDVTFLKRRGLVRDTPLFVPLSPSPILLNRHASLDRRASA
FT                   APQPRSVPAAIAGAVV"
FT                   /protein_id="YP_001109807.1"
FT   gene            111654..111965
FT                   /db_xref="GeneID:4947425"
FT                   /locus_tag="Bcep1808_7145"
FT   CDS_pept        111654..111965
FT                   /locus_tag="Bcep1808_7145"
FT                   /gene_family="HOG000263322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   rsp:RSP_3026 transcriptional regulator, MocR family"
FT                   /db_xref="GI:134287642"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="GeneID:4947425"
FT                   /translation="MQSLSFRTSHGSLSSATRSPSQWRPDFARIRGHVANAIADQIEEA
FT                   IRSGLFKPGDKLPTQQAIADSLGFHLNTIYAAFKELARRGLTRAFARRGTFVLDVETV"
FT                   /protein_id="YP_001109808.1"
FT   misc_feature    111765..111944
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcep1808_7145"
FT   misc_feature    order(111825..111827,111831..111836,111858..111872,
FT                   111876..111881,111888..111890,111918..111923,
FT                   111927..111938)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Bcep1808_7145"
FT   gene            complement(112058..112357)
FT                   /db_xref="GeneID:4947426"
FT                   /locus_tag="Bcep1808_7146"
FT   CDS_pept        complement(112058..112357)
FT                   /locus_tag="Bcep1808_7146"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6516 integrase, catalytic region"
FT                   /db_xref="GI:134287643"
FT                   /db_xref="GeneID:4947426"
FT                   /translation="MECPLSGRVSCAVAGFPAPDVAMVATERITVTMRDLDRCKVVQDM
FT                   ADGKLEPRRAAARPELTTRQIRRFVAPLPQPVPTPCRNSLDCDRRERGDGGTGL"
FT                   /protein_id="YP_001109809.1"
FT   gene            112525..112776
FT                   /db_xref="GeneID:4947427"
FT                   /locus_tag="Bcep1808_7147"
FT   CDS_pept        112525..112776
FT                   /locus_tag="Bcep1808_7147"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287644"
FT                   /db_xref="GeneID:4947427"
FT                   /translation="MSEDGHVSRFKLQLATIRKHANVHAQLRSLYRHSEVARGVIRSAD
FT                   IGVHADALGGRVLRSVHLFVSKVEERLPYSNRRQVWLD"
FT                   /protein_id="YP_001109810.1"
FT   gene            complement(112747..113085)
FT                   /db_xref="GeneID:4947428"
FT                   /locus_tag="Bcep1808_7148"
FT   CDS_pept        complement(112747..113085)
FT                   /locus_tag="Bcep1808_7148"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: rme:Rmet_5562 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:134287645"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947428"
FT                   /translation="MPVQGRENMDPKSPGYLALIAQRESLDAQIIAARKAEREVAIGQI
FT                   KALMKEFDLSVLDLQERVQKRNSKRMSTVPKYRDPATGKTWSGRGRQPAWLGNDPAAFL
FT                   IQPDLPAI"
FT                   /protein_id="YP_001109811.1"
FT   misc_feature    complement(112798..113031)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep1808_7148"
FT   misc_feature    complement(<112798..112884)
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:175028"
FT                   /locus_tag="Bcep1808_7148"
FT   gene            complement(113099..113329)
FT                   /db_xref="GeneID:4947429"
FT                   /locus_tag="Bcep1808_7149"
FT   CDS_pept        complement(113099..113329)
FT                   /locus_tag="Bcep1808_7149"
FT                   /gene_family="HOG000263188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6383 hypothetical protein"
FT                   /db_xref="GI:134287646"
FT                   /db_xref="GeneID:4947429"
FT                   /translation="MTKSRRPDPDLLPDGDYWATCRERNEISAALNGHSAVFPQARMVV
FT                   RSGWAYFYRRDEEVWSCNVRYAAANFVIQMA"
FT                   /protein_id="YP_001109812.1"
FT   gene            complement(113532..113894)
FT                   /db_xref="GeneID:4947430"
FT                   /locus_tag="Bcep1808_7150"
FT   CDS_pept        complement(113532..113894)
FT                   /locus_tag="Bcep1808_7150"
FT                   /gene_family="HOG000290185" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /transl_table="11"
FT                   /note="PFAM: PemK family protein; KEGG: gox:GOX2564
FT                   PemK-like protein"
FT                   /db_xref="GI:134287647"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="GeneID:4947430"
FT                   /translation="MAGALWAPDRRDIIWIDCTPQVGREMKDLHPMLVLSPKAFNERTG
FT                   IVIGLPMTTAEFNDTNPFAIKFKGPKNVTSYVLGHQPKSFDWRARGAKAHPWKRVPDEV
FT                   FAAACEQLNQIIAIGD"
FT                   /protein_id="YP_001109813.1"
FT   misc_feature    complement(113547..113879)
FT                   /note="PemK-like protein; Region: PemK; cl00995"
FT                   /db_xref="CDD:174491"
FT                   /locus_tag="Bcep1808_7150"
FT   gene            complement(113894..114148)
FT                   /db_xref="GeneID:4947431"
FT                   /locus_tag="Bcep1808_7151"
FT   CDS_pept        complement(113894..114148)
FT                   /locus_tag="Bcep1808_7151"
FT                   /gene_family="HOG000289070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: dra:DR0416
FT                   ppGpp-regulated growth inhibitor suppressor ChpR/MazE,
FT                   putative"
FT                   /db_xref="GI:134287648"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:4947431"
FT                   /translation="MAKTATLTIQKWGNSLAVRIPAAVARSAHFEVDQEVEITADEIGV
FT                   TVRPVGPRKLTLAEKLAQFDPAKHGGEAMATGRIGAEVF"
FT                   /protein_id="YP_001109814.1"
FT   misc_feature    complement(113900..114133)
FT                   /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
FT                   cl00877"
FT                   /db_xref="CDD:174436"
FT                   /locus_tag="Bcep1808_7151"
FT   gene            complement(114398..114832)
FT                   /db_xref="GeneID:4947432"
FT                   /locus_tag="Bcep1808_7152"
FT   CDS_pept        complement(114398..114832)
FT                   /locus_tag="Bcep1808_7152"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_4321 hypothetical protein"
FT                   /db_xref="GI:134287649"
FT                   /db_xref="GeneID:4947432"
FT                   /translation="MQGAGHGRAALERQTPTKPSEQAAEQDLCFDLSEGAVLQQAIAST
FT                   RELVCEARPALKQRIWLYRAEASAGSTKRGNITCLDSKSLNRAIQAVIQRHNLLGDDGL
FT                   PLRLNLSRLRKSRFDRALRTADGDIAITANLMGNTPRVAH"
FT                   /protein_id="YP_001109815.1"
FT   gene            114884..115147
FT                   /db_xref="GeneID:4947433"
FT                   /locus_tag="Bcep1808_7153"
FT   CDS_pept        114884..115147
FT                   /locus_tag="Bcep1808_7153"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bpm:BURPS1710b_A1167 IS407A, transposase OrfA"
FT                   /db_xref="GI:134287650"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4947433"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT                   /protein_id="YP_001109816.1"
FT   misc_feature    114887..115084
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Bcep1808_7153"
FT   gene            115243..115902
FT                   /db_xref="GeneID:4947434"
FT                   /locus_tag="Bcep1808_7154"
FT   CDS_pept        115243..115902
FT                   /locus_tag="Bcep1808_7154"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bpm:BURPS1710b_1719 IS407A, transposase OrfB"
FT                   /db_xref="GI:134287651"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947434"
FT                   /translation="MLHYDAKPDHENEVLAARLVELAHERRRFGYRRLHALVEREGTHA
FT                   NHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKC
FT                   LTVVDDFTKEAVDIVVDHGISGLYVARALDRAARFRGYPKAVRTGQGPEFTSRALDQWA
FT                   YANGVALKLIQAGKPTQNAYIESFNGKFRDECLRDGFIKTGRPAEGYSSRSGSNRV"
FT                   /protein_id="YP_001109817.1"
FT   misc_feature    115486..115827
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7154"
FT   gene            complement(115841..116658)
FT                   /db_xref="GeneID:4947435"
FT                   /locus_tag="Bcep1808_7155"
FT   CDS_pept        complement(join(115841..116308,116308..116658))
FT                   /locus_tag="Bcep1808_7155"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   reu:Reut_D6468 transposase, IS4"
FT                   /db_xref="GI:134287652"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:4947435"
FT                   /translation="MAKPIIDDELWTLIEPLLPPPKPRREKNPGRLPVSNRAALTGILF
FT                   VLKTGLRWRDLPAEMGCGSGVTCWRRLRDWQAAGVWDRLHELLLAKLRAADQIDFSRAA
FT                   VDSSSIRAVGAGQKTGPNPTDRARPGSKHHIVTDANGTPLAAILTGANVHDVTQLLPLI
FT                   DAIPPIRGLRGHPLQRPRVVYADRGYDSERHRRALRDRGIEPVIAKRRTEHGSGLGKYR
FT                   WVVERMHAWLHHFRRLRIRFERRADIHGAFLKLGCCLICWNTLRRADQSL"
FT                   /protein_id="YP_001109818.1"
FT   misc_feature    complement(join(116297..116308,116308..>116574))
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Bcep1808_7155"
FT   misc_feature    complement(join(<115967..116308,116308..116349))
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Bcep1808_7155"
FT   gene            complement(116817..117614)
FT                   /db_xref="GeneID:4947436"
FT                   /locus_tag="Bcep1808_7156"
FT   CDS_pept        complement(116817..117614)
FT                   /locus_tag="Bcep1808_7156"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bch:Bcen2424_3298 IstB domain
FT                   protein ATP-binding protein"
FT                   /db_xref="GI:134287653"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4947436"
FT                   /translation="MSNDIAAQLKGLKLHGMASTWPELLAQSRHTEFDPERFMKQLLMA
FT                   ETAERQVRSIAYQMTAARFPAHRDLKGFDFAQAHVDEALVRELSDLSFLASAHNVVFIG
FT                   GPGTGKTHLASAIGIEAVQRHGKRVRYFSTVELTNALEQEKSIGKQGQIAHKLMYVDLV
FT                   ILDELGYLPFSQTGGALLFHLLSKLYEHTSVVITTNLSFGEWATVFGDAKMTTALLDRV
FT                   THHCHIVETGNESWRFKSSSAKAKATRKRAAKAAGSEELSTPE"
FT                   /protein_id="YP_001109819.1"
FT   misc_feature    complement(116904..117602)
FT                   /note="transposase/IS protein; Provisional; Region:
FT                   PRK09183"
FT                   /db_xref="CDD:169696"
FT                   /locus_tag="Bcep1808_7156"
FT   misc_feature    complement(117009..117371)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7156"
FT   misc_feature    complement(117282..117305)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7156"
FT   misc_feature    complement(order(117018..117020,117117..117119,
FT                   117279..117302))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7156"
FT   misc_feature    complement(117114..117131)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7156"
FT   gene            complement(117607..119112)
FT                   /db_xref="GeneID:4947437"
FT                   /locus_tag="Bcep1808_7157"
FT   CDS_pept        complement(117607..119112)
FT                   /locus_tag="Bcep1808_7157"
FT                   /gene_family="HOG000113082" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bch:Bcen2424_3299 integrase, catalytic region"
FT                   /db_xref="GI:134287654"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947437"
FT                   /translation="MGILAKIRRMYFREKVPLREIARRTGLSRNTVRSWLRQTDAVEPK
FT                   YPKRVSPSVVDEWAAQLTGWLRADSHRPKRDRRTARFMFEAIRGEGYAGSYGRVSAFVR
FT                   RWHEEQAEAPRRKAYVPLAFEPGEAFQFDWSCEYAFIGGLRRRLEVAHVKLNASRAFWL
FT                   VAYPTQSHEMLFDAHARAFAAFGGVPRRGIYDNMKTAVDKVGRGKERAVNARFEAMCGH
FT                   YLFEPEFCNRAAGWEKGIVEKNVQDRRRQIWHEAALRRWETLELLNEWVAGQCRQAWQM
FT                   RHPQWPELTVEDVLQDERTRLMPNPRPFDGYVEQTLRVSSTSLIHFQRNRYSVPTEYTN
FT                   QLVSVRCYPAYLSVVADAQEIARHERSFERHMTFYDWRHYITLVERKPGALRNGAPFVT
FT                   MPQPLQQLQRHLLKHPGGDHIMTQVLAAVREHGLDAVLLAVQAALDSGRPSGEHVLNVL
FT                   SRLKAPTTSTNLATTKLQLTEEPAADVSRYETLRANPPEDRHV"
FT                   /protein_id="YP_001109820.1"
FT   misc_feature    complement(118264..119058)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="Bcep1808_7157"
FT   misc_feature    complement(118387..118746)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7157"
FT   gene            complement(119221..119373)
FT                   /db_xref="GeneID:4947438"
FT                   /locus_tag="Bcep1808_7158"
FT                   /pseudo
FT   gene            complement(119475..119957)
FT                   /db_xref="GeneID:4947439"
FT                   /locus_tag="Bcep1808_7159"
FT   CDS_pept        complement(119475..119957)
FT                   /locus_tag="Bcep1808_7159"
FT                   /gene_family="HOG000243798" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: rha:RHA1_ro02757 possible transposase"
FT                   /db_xref="GI:134287655"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:4947439"
FT                   /translation="MECVANCARIRSLGNTPMLQTLTTTLRLLAKRWIALEDELETLDA
FT                   MLEQLTHQHAPRLRQRFGVGPYTAAKLVTVAGDNPERLKNEAALAALCGTSPLQASSGK
FT                   TVRHRLNRGGNRSANNALWTIAMVWMRSDPKTRTYVQRRTQEGMTNKEIHRCLNAT"
FT                   /protein_id="YP_001109821.1"
FT   misc_feature    complement(119535..119795)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Bcep1808_7159"
FT   gene            complement(120106..120813)
FT                   /db_xref="GeneID:4947440"
FT                   /locus_tag="Bcep1808_7160"
FT   CDS_pept        complement(120106..120813)
FT                   /locus_tag="Bcep1808_7160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bja:bll1855
FT                   putative transposase"
FT                   /db_xref="GI:134287656"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947440"
FT                   /translation="MKRGEIFPRENARYFRYEAGRNGITRNGACKPLRSAGKNGSQRFV
FT                   KSRNGGLDEPNSKSGVYERASRRSGQAGVDGRCWDTYSKVAFAKLYDRKTPLPAADLLN
FT                   DRVVPFFDGFGIALLRVLTDRGTEYCGNPEHHEYELYLALEDIDHTQTKAKSPQTNGIV
FT                   ERLHKTMLNDFYRIAFCKKIYDSIATLQTDLDAWLDQYDNEREHQGRWCYGKTPMRTFL
FT                   ASLELAKEKPIPH"
FT                   /protein_id="YP_001109822.1"
FT   misc_feature    complement(120292..>120576)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7160"
FT   gene            complement(120823..121761)
FT                   /db_xref="GeneID:4947441"
FT                   /locus_tag="Bcep1808_7161"
FT   CDS_pept        complement(120823..121761)
FT                   /locus_tag="Bcep1808_7161"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component LuxR family transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: bch:Bcen2424_4638 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="GI:134287657"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:4947441"
FT                   /translation="MILIVDDTPENLAFLSDTLQAHGYVVIVALSGEDALKRLARVTPD
FT                   VVLLDAMMPDMDGFETCLRIKKDGRHEHLPVIFMTALTESEHVVHGFRVGGIDYVTKPV
FT                   QPEELCARIGAHVRRSRAQLYAEAALSLDTRAALIVGADGTIRWQSPQAARHIAAYTTA
FT                   HDAPADARQPTNARDTDAPTRLPALLRTWFVDWLARGAPGDAVHEFSSGQIRRSASATR
FT                   GPEPSEWIVILKERDDTVHCNALAERFGLTMREAEVLLWVSHGKTNRDIGDILGIAART
FT                   VNKHLEHLFRKLHVETRAGAAAAAIKMLERT"
FT                   /protein_id="YP_001109823.1"
FT   misc_feature    complement(121411..121755)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(order(121453..121458,121465..121467,
FT                   121522..121524,121588..121590,121612..121614,
FT                   121741..121746))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(121612..121614)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(order(121588..121596,121600..121605))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(121450..121458)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(120841..121011)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(order(120868..120870,120901..120915,
FT                   120919..120924,120928..120933,120955..120963,
FT                   121000..121008))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7161"
FT   misc_feature    complement(order(120841..120846,120853..120855,
FT                   120862..120870,120961..120963,120967..120969,
FT                   120973..120975))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7161"
FT   gene            complement(121829..125251)
FT                   /db_xref="GeneID:4947442"
FT                   /locus_tag="Bcep1808_7162"
FT   CDS_pept        complement(121829..125251)
FT                   /locus_tag="Bcep1808_7162"
FT                   /gene_family="HOG000202756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bch:Bcen2424_4637 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="GI:134287658"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4947442"
FT                   /translation="MSQSHPSVGAPGTQRIVKVRRDYNAWVADETLEDYALRFTPRSFR
FT                   RWSELRVANTAIGAVSFLVLEAIGGSLVVNYGFTNAVWAIAAVSVLIWLTSLPISYYAA
FT                   RYGVDMDLLTRGAGFGYIGSTVTSLLYAVFTFIFFALEAAIMSLALQLYFHISLAIAYV
FT                   VSSLVVIPIVMFGITLINRLQSWTQPLWLVLFVLPYAAVLWRHSDLIAQWTTFAGFAPQ
FT                   GRAFSLIAFGQASTVVFALIVQVGEQVDYLRFLPPLTAKNRTRWWFALLSTGPGWIVPG
FT                   ALKMLGGALLAFIALQYEVDAGHATQPTQMYLVTYHLLLDPLGLASWALPAMTLFVIVS
FT                   QLKINVTNAYAGSLAWSNFFARLTHSHPGRVVWLVFNVMIALLLVEMGVFDAIAKVLSL
FT                   YANIAIAWIGALFADLVINKPLGYSPRHIEFKRAHLYDVNPVGVGAMLIAAAVAMLAHS
FT                   GLFGELARAMSSFIAFGAAFACAPLLAVLTRGRYYIARAAQPAGDATSLRCAICENTFE
FT                   PDDTAHCPAYGGTICSLCCSLDSRCHDRCKPHARFASQAARALHRVLPGARLGPAALRL
FT                   VHYASLVLAMLAVLSSVLYLIWAQSATSMRAAGPSIAHALSGSFLNIFLALSLVGCIAA
FT                   WWFVLERENRRVTQEESQRQTELLMLEIDAHQKTDAALKRATAAAESANQAKSRYVSGL
FT                   SHELRTPLNSILGYAQLLLQAKEELTPMRYNAVRTIHRSGEHLLALVDGLLDIARIEAG
FT                   KLQLNIAKVSLADFVAHLTSMLRPQALEKALAFDVQTVGRLPATVRTDQKCMSQILTNL
FT                   IGNAIRFTPSGTITLRVSHVLDTLKFEVVDTGPGIPPAELERLFLPFERGEAAHAYDHG
FT                   AGLGLTICRLLTQALGGSLEVDSEVGHGTRFVVRLFAPAVDAAAETHAELASIRGYTGA
FT                   RRTILVVDDLDDQRDIVVQLLTPLGFDVAEAASGTDALRWLAMHTADAIIMDISMPLMD
FT                   GYETSRLISENQLSNAPIVLLSANAFADDRDRASATGCKGYLVKPLQVNLLLDKLAQLL
FT                   ALDWIASDPGTSALPVTTQQPTPAVWPRELIEHLHAHLEVGYVQGVIEALDAAREARPG
FT                   LRAQIDALRSLAERFQLRELEHELDRLARGANA"
FT                   /protein_id="YP_001109824.1"
FT   misc_feature    complement(<124580..125173)
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:174215"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(123995..125080)
FT                   /note="Purine-cytosine permease and related proteins
FT                   [Nucleotide transport and metabolism]; Region: CodB;
FT                   COG1457"
FT                   /db_xref="CDD:31646"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(123005..123202)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(order(123020..123022,123032..123034,
FT                   123041..123043,123053..123055,123062..123064,
FT                   123074..123076,123128..123130,123137..123139,
FT                   123149..123151,123158..123160,123170..123172,
FT                   123182..123184))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(123164..123166)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(122534..122833)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(order(122546..122548,122552..122557,
FT                   122570..122572,122576..122578,122624..122635,
FT                   122711..122716,122720..122722,122726..122728,
FT                   122732..122734,122798..122800,122807..122809,
FT                   122819..122821))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(122807..122809)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(order(122627..122629,122633..122635,
FT                   122714..122716,122720..122722))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(122150..122449)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(order(122150..122155,122162..122164,
FT                   122219..122221,122282..122284,122306..122308,
FT                   122435..122440))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(122306..122308)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(order(122282..122290,122294..122299))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7162"
FT   misc_feature    complement(122150..122155)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7162"
FT   gene            125477..126751
FT                   /db_xref="GeneID:4947443"
FT                   /locus_tag="Bcep1808_7163"
FT   CDS_pept        125477..126751
FT                   /locus_tag="Bcep1808_7163"
FT                   /gene_family="HOG000202643" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4636 branched-chain amino acid
FT                   ABC transporter, periplasmic amino acid-binding protein"
FT                   /db_xref="GI:134287659"
FT                   /db_xref="GeneID:4947443"
FT                   /translation="MSADDRFDDDARMPSPLRRKMLGGLAAAPLMALGLPRGAFAQTPP
FT                   TAKVNTTRLAVTDTTVTVGQLHSATGTMAISETGSIQAERLAIEQINAMGGVLGRKIQI
FT                   IQEDGASDWPTFAEKSKKLLENDHVAAVFGCWTSASRKAVLPVFEKDNGLLYYPTFYEG
FT                   LEQSKNVFYTGQEATQQIVWALDWASNTKKAKTFFLIGSDYIWPRTSNKIARRHIEQHL
FT                   HAKVVGEEYYPLGTTEFASLMNKIKLARPDCIFATVVGGSNVAFYKQLKAAGITPQKQF
FT                   LLTLSVTEDEVLGIGGDNFAGFYSSMKYFQSLDNDNNKKFVAAFKARYGQKSVIGDVTQ
FT                   AAYLGPWIWKAACERAGSFDVDKVVAHSAGIEVANAPQGYAKVDANHHLWSRSLIGQGQ
FT                   ADGQFKVVAQSEQPIQPNPFPKGYM"
FT                   /protein_id="YP_001109825.1"
FT   sig_peptide     125477..125602
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.973 at
FT                   residue 42"
FT                   /locus_tag="Bcep1808_7163"
FT                   /product="hypothetical protein"
FT   misc_feature    125666..126709
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Bcep1808_7163"
FT   misc_feature    125666..126706
FT                   /note="Periplasmic component (FmdD) of an active transport
FT                   system for short-chain amides and urea (FmdDEF); Region:
FT                   PBP1_FmdD_like; cd06355"
FT                   /db_xref="CDD:107350"
FT                   /locus_tag="Bcep1808_7163"
FT   misc_feature    order(125882..125884,125945..125947,125954..125959,
FT                   126086..126088)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107350"
FT                   /locus_tag="Bcep1808_7163"
FT   gene            126808..127725
FT                   /db_xref="GeneID:4947444"
FT                   /locus_tag="Bcep1808_7164"
FT   CDS_pept        126808..127725
FT                   /locus_tag="Bcep1808_7164"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_4635 inner-membrane translocator"
FT                   /db_xref="GI:134287660"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:4947444"
FT                   /translation="MSATDIFNITLMQGFAGLSLFSVLLLMGLGLAVIFGQMGVINMAH
FT                   GEFMTIGAYTVYLFSWFSQNVWHALTPVYFFFAILAAFALAFAAGWLAEWALIRHLYKR
FT                   PLDTLLATWGLSLGMQQVFRSTFGPKEVSPALPDWLMGSWEPTPGLDIPVSGMFVMGLA
FT                   LLMTGGLLLALYRSRWGLRVRATVANRPMANAAGINTRRTDRMTFAIGCGIAGVAGAAF
FT                   TAIGSTGPTSGSLYIVDSFLVVTFGGAASLLGTVASAFGIAQMQSISEFFLSGSIARVL
FT                   TLLTVVVILMLRPQGLFASKVRRV"
FT                   /protein_id="YP_001109826.1"
FT   sig_peptide     126808..126906
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.700 at
FT                   residue 33"
FT                   /locus_tag="Bcep1808_7164"
FT                   /product="hypothetical protein"
FT   misc_feature    126907..127701
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Bcep1808_7164"
FT   misc_feature    127378..127434
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Bcep1808_7164"
FT   gene            127781..128950
FT                   /db_xref="GeneID:4947445"
FT                   /locus_tag="Bcep1808_7165"
FT   CDS_pept        127781..128950
FT                   /locus_tag="Bcep1808_7165"
FT                   /gene_family="HOG000202416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_4634 inner-membrane translocator"
FT                   /db_xref="GI:134287661"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:4947445"
FT                   /translation="MEPIQPAAGAVSPRSRPAAQPAGWRARVARLDAAGYAGIVLLALL
FT                   IVVVFPLALDTFRLNLMGKYLTYAFVAIGLVIAWGYGGVLSLGQGVFFGLGGYAMAMFL
FT                   KLEASDPAATHTQTTPGIPDFMDWNQLTALPTWWKPFHSLPFSILAVLVVPTALAFVIG
FT                   YAMFKRRVGGVYFAIITQAVALILSVLIIGQQGYTGGVNGITDLRTLLGWDIRTDHAKL
FT                   VLYFVNAALLIGALLAGRWVQRSKLGTLLLAMRDKEDRVRFSGYDVAMFKVFAFCLAAM
FT                   LAAVGGAMFTLQVGFMSPSFVGIVPSIEMVVYAAIGGRMSLVGAVYGAILVNLGKSWFS
FT                   ESFPNLWLYLMAAMFIGVVMVFPNGLAGLYDEHVRPRVRRLLGVANQEA"
FT                   /protein_id="YP_001109827.1"
FT   misc_feature    127973..128884
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Bcep1808_7165"
FT   misc_feature    128555..128611
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Bcep1808_7165"
FT   gene            128954..129697
FT                   /db_xref="GeneID:4947446"
FT                   /locus_tag="Bcep1808_7166"
FT   CDS_pept        128954..129697
FT                   /locus_tag="Bcep1808_7166"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; KEGG:
FT                   bch:Bcen2424_4633 ABC transporter related"
FT                   /db_xref="GI:134287662"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="GeneID:4947446"
FT                   /translation="MSNTDFLLAIEDLTVSFDGFKAIDSLNLYLERGELRVVIGPNGAG
FT                   KTTLLDLICGKTKETAGSIKFRNEEITRLAEFRRVRQGIGRKFQTPSIYENLSVAQNLE
FT                   VSFPRGRSVFGALAYREDTEMADRVRDVANEIGLAATLDMEAGLLSHGQKQWLEIGMLL
FT                   MQDPELLMLDEPIAGMSVRERELTAELLDRICRNRSMIVIEHDMAFVERIAHKVTVMHQ
FT                   GKILAEGPMAQVQADPRVIDVYLGH"
FT                   /protein_id="YP_001109828.1"
FT   misc_feature    128969..129694
FT                   /note="urea ABC transporter, ATP-binding protein UrtD;
FT                   Region: urea_trans_UrtD; TIGR03411"
FT                   /db_xref="CDD:163251"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    128975..129673
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129071..129094
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    order(129080..129085,129089..129097,129218..129220,
FT                   129470..129475,129566..129568)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129209..129220
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129398..129427
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129458..129475
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129482..129493
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   misc_feature    129554..129574
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Bcep1808_7166"
FT   gene            129732..130421
FT                   /db_xref="GeneID:4947447"
FT                   /locus_tag="Bcep1808_7167"
FT   CDS_pept        129732..130421
FT                   /locus_tag="Bcep1808_7167"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_4632 ABC transporter related"
FT                   /db_xref="GI:134287663"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4947447"
FT                   /translation="MLEVDDLVVSYGQSEVLHGIDFAVAQGEGVAVMGRNGMGKTTLFK
FT                   ALIGMLPANRGTVRVAGADVSKDESYRRVSKGIGYVPQGRQIFASLTVEENIQTGLENA
FT                   QSQRVPDELYALFPVLFDMRKRKGGNLSGGQQQQLAIARALATDPKVLLLDEPTEGIQP
FT                   SVIKDIATALNQIRTSRNIAIVVSEQVLSFALDVADRLFVIEGGRFVHQSTRDAGDTDR
FT                   IREYLSV"
FT                   /protein_id="YP_001109829.1"
FT   misc_feature    129735..130418
FT                   /note="urea ABC transporter, ATP-binding protein UrtE;
FT                   Region: urea_trans_UrtE; TIGR03410"
FT                   /db_xref="CDD:163250"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    129735..130394
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    129831..129854
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    order(129840..129845,129849..129857,129978..129980,
FT                   130194..130199,130296..130298)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    129969..129980
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    130122..130151
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    130182..130199
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    130206..130217
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   misc_feature    130284..130304
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_7167"
FT   gene            130483..131721
FT                   /db_xref="GeneID:4947448"
FT                   /locus_tag="Bcep1808_7168"
FT   CDS_pept        130483..131721
FT                   /locus_tag="Bcep1808_7168"
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG:
FT                   bch:Bcen2424_4631 formamidase"
FT                   /db_xref="GI:134287664"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="GeneID:4947448"
FT                   /translation="MPETLIKVDLDQSAYENEQVHNRWHPDIPMACWVKPGDDFILETY
FT                   DWTGGFIKNDDSADDVRDIDLSIVHFLSGPVGVHGAEPGDLLVVDLLDIGAKADSQWGF
FT                   NGFFSKTNGGGFLTDHFPSAQKSIWDFHGVYTSSRHIPGVNFAGLIHPGLIGCLPDPTL
FT                   LETWNARETGLIATAPERVPPLANPPFAATAHMGKLAGDARDKAAAQGARTVPPREHGG
FT                   NCDIKDLSRGSKVFFPVYVDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMRVNLIKG
FT                   GMAKYGIRNPVFQPSPITPTYNDYLIFEGISVDEQGGQHYLDVTIAYRQACLNAIEYLK
FT                   KFGYSGAQAYSLLGCAPVQGHISGVVDIPNACATLWLPTQIFDFDIRPNADGPIQYIQG
FT                   GVDLPCSPDLAKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001109830.1"
FT   misc_feature    130492..131637
FT                   /note="Acetamidase/Formamidase family; Region: FmdA_AmdA;
FT                   cl01023"
FT                   /db_xref="CDD:120322"
FT                   /locus_tag="Bcep1808_7168"
FT   gene            131759..132094
FT                   /db_xref="GeneID:4947449"
FT                   /locus_tag="Bcep1808_7169"
FT   CDS_pept        131759..132094
FT                   /locus_tag="Bcep1808_7169"
FT                   /gene_family="HOG000202304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FmdB family regulatory protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: bch:Bcen2424_4630 putative regulatory protein, FmdB
FT                   family"
FT                   /db_xref="GI:134287665"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="GeneID:4947449"
FT                   /translation="MPIYDFECASCGPFSVMRRIADREKPCCCPDCGAQGDRVVSAPSL
FT                   ALMGGARRAAHATNERAAHAPRQSGDGQPLRHRGGCSCCSGGAAKLAGTASDGLKRPAG
FT                   RPWMISH"
FT                   /protein_id="YP_001109831.1"
FT   misc_feature    131759..131908
FT                   /note="Zinc ribbon domain; Region: CxxC_CxxC_SSSS; cl00993"
FT                   /db_xref="CDD:163941"
FT                   /locus_tag="Bcep1808_7169"
FT   gene            132178..133218
FT                   /db_xref="GeneID:4947450"
FT                   /locus_tag="Bcep1808_7170"