(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_3

ID   BURVG_3; SV 1; empty ; DNA; empty ; PRO; 107231 BP.
XX
AC   NC_009228;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-107231
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of plasmid pBVIE04 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-107231
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-107231
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000620.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..107231
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /plasmid="pBVIE04"
FT                   /db_xref="taxon:269482"
FT   gene            29..5590
FT                   /db_xref="GeneID:4947583"
FT                   /locus_tag="Bcep1808_7553"
FT   CDS_pept        29..5590
FT                   /locus_tag="Bcep1808_7553"
FT                   /gene_family="HOG000229061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: cjj:CJJ81176_pTet0010 cpp14"
FT                   /db_xref="GI:134287795"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="GeneID:4947583"
FT                   /translation="MAKKRQRADDLNQLSFDFEFNATADIIDSLQAQIDVDEDEGAQHA
FT                   YRSNSAAVDRGENPQADDDSGRPAFTLISPAGLEDPRPLGVQQPGETALAGSARRGDPA
FT                   GQASGAANDRAPGLEPLDRPEAERPDGARDPGQQRDQHRAVTPADYNITAADRLGEGGA
FT                   KAKYRDNIAALKLLLQLREEQRSATPDEQAILVRYVGWGGLPQAFDHRNQDWQDEYLEL
FT                   AGLLSKDEYERARRSTQDAHYTSQTVIEGIYKGLQRIGFDGGRVFEPSAGIGNFLGLMP
FT                   APMRAATHFTAIELDPLTAEIARHLYPSATHINRGLQDVVIPAGHFDACVGNPPFGTQS
FT                   LYDPHHRELGGFSIHNYFLAKSIDKLREGGVMAVVVSRYFLDAANTAAREHIADRAHFL
FT                   GAIRLPNTAFKRNALTEVTTDIIFFQKAAAGETPDRRWVDVGEIRDHDTGEPITINRYF
FT                   IDHPEQMAGRMVITSKMHRDAADLVPEAGVDLAAAIERRLQALPADVYRPADDVATATD
FT                   RGEDKPALTLPDTLKVSSFFVAPNGRLARRLPDILDEHDYNYVEPKNERAGARIKGMVQ
FT                   VREALRDLMQAEQSEHVTDFELTSKRSKLNRVYDDFVRRFGHVSSQANRLAMSEDPEYP
FT                   LLHALESDYDKGISPETAKKHGVEPRRPSANKAAIFSKRVMSPRKEVTRVETAKDALVV
FT                   SMNESGRIDLARMMRLTGKPEEELIRDLKGLIYLNPERDRWETADQYLTGNVKAKLRAA
FT                   EAAAGQNPRYIENVDALRAVQPADIEPVDISIQLGSTWVPDQVIDQFVGHLLGDVRRRI
FT                   TYQETLGKWLVDIEHGDRTTARVTWGTEAYPANELIESILTNRPIQVKVEAGKDANGNK
FT                   IYRVDDSQTAAANQKADEIRQAFLDWVWEDKDRREMLARIYNDRFNTNIPAKYDGSHLD
FT                   LPGASLDITLRPHQKDAIWRGIQDGTALFDHVVGAGKTLVCVGTIMESKRMGLMSKPML
FT                   VVPNHLLLQWKDAFYSLYPNANILVAEKSDFKKENRERLFGRIATGDWDAVIVAHSSFK
FT                   KIGMPEDTLRELLEEQIEDLSDAITQIKAEQGDRITIKEMEKAKERMTERLERKADTGA
FT                   KDLAVSFADLGVDALFVDEAHEFKNLFITTTLSRVSGLGNLAGSEKAFDLFVKCRYLQQ
FT                   RNDGRGVFFATGTPISNTIAELYTMQRYLQYDELKARGIVHFDAWASTFGQVVTGWELD
FT                   ATGVNYRLNSRFSKFQNVPELISLYRTFADVITKSDLDRQAEERGTRFPVPKIKGGRPQ
FT                   NIIVDRSEAQALFMGVQTPVLDGNGAPVLRADGTPLKNWNNGSIIHRMENLPKDPRVDN
FT                   PLKITNDARKAGLDFRLINSNAADDPGSKVNTAVDNIYRIWEAWKDRKGTQLVFCDLST
FT                   PKLSKKAAPVADAANDDDSDDEAPAISMDELLASNSDFSVYDDIKAKLIARGVPEHEIR
FT                   FIHEATTDLQKAKLFDDMNRGHSRIMIGSTAKMGAGTNVQRRLVAEHHLDAPWRPSDLE
FT                   QREGRILRQGNLFYEEDPDGFEVEILRYATKQTYDSRMWQTIEYKAAGIEQFRKGDSLQ
FT                   RVIEDVASEAANAAEMKAAATGNPLIFMQVKLSADLKKVEALFSNYKRNQHSLESRIGW
FT                   LADADQRADRAVARWNREIELRDKATTEQFRFETKNRVYGEKDRETLLGEVMYAMKKAV
FT                   ERRAVGILDRPTEMPVGRYRGFDVKVYASRDEIQFTLTGSDTYEPENLSYRAEEKFSIT
FT                   GFIHRLDNFMARFEDWRQEAEETREKERREYAKAVAEQGKPFPQQARLEALRQDVRDVM
FT                   TELKLMQADENYVSQWQPRSLASDSNAGQQQDRYRMRA"
FT                   /protein_id="YP_001109960.1"
FT   misc_feature    <677..1306
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Bcep1808_7553"
FT   misc_feature    1388..3016
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bcep1808_7553"
FT   misc_feature    2855..>3178
FT                   /note="SNF2 family N-terminal domain; Region: SNF2_N;
FT                   pfam00176"
FT                   /db_xref="CDD:143942"
FT                   /locus_tag="Bcep1808_7553"
FT   misc_feature    <3431..4117
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bcep1808_7553"
FT   misc_feature    4358..4618
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="Bcep1808_7553"
FT   gene            6137..6274
FT                   /db_xref="GeneID:4947584"
FT                   /locus_tag="Bcep1808_7554"
FT   CDS_pept        6137..6274
FT                   /locus_tag="Bcep1808_7554"
FT                   /gene_family="HOG000263363" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RS01700 hypothetical protein"
FT                   /db_xref="GI:134287796"
FT                   /db_xref="GeneID:4947584"
FT                   /translation="MSASLYTLHHCIVILSCAYMEYTYTPWNGRNHYRRTVDYGRVVWC
FT                   "
FT                   /protein_id="YP_001109961.1"
FT   gene            6356..6616
FT                   /db_xref="GeneID:4947585"
FT                   /locus_tag="Bcep1808_7555"
FT   CDS_pept        6356..6616
FT                   /locus_tag="Bcep1808_7555"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287797"
FT                   /db_xref="GeneID:4947585"
FT                   /translation="MHIKFPVQKGTALAELGYGESLLIPCNDRTVQSVQSSIQSLYAKK
FT                   GLASREFSQRKALLILDEHVLPIPVVVVTRQHVAVLEEVPA"
FT                   /protein_id="YP_001109962.1"
FT   gene            6613..7008
FT                   /db_xref="GeneID:4947586"
FT                   /locus_tag="Bcep1808_7556"
FT   CDS_pept        6613..7008
FT                   /locus_tag="Bcep1808_7556"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287798"
FT                   /db_xref="GeneID:4947586"
FT                   /translation="MSNLVDCVQIRAMTAADAAAAMRTLVTKVDSQVGIGIWEGSITGK
FT                   ISGQTYDGNDGKHIAVFHDTSLVAPFGPHGDAESEACAALFCLAVKHADALGSLVEAAQ
FT                   AVLGAWEMGDLAGAVRGLSAALERVTE"
FT                   /protein_id="YP_001109963.1"
FT   gene            complement(7161..7457)
FT                   /db_xref="GeneID:4947587"
FT                   /locus_tag="Bcep1808_7557"
FT   CDS_pept        complement(7161..7457)
FT                   /locus_tag="Bcep1808_7557"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bur:Bcep18194_B1226 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:134287799"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947587"
FT                   /translation="MTDKSYSQLVAELKELERKIIAARAQARKDALAQIAELMYEFDIK
FT                   PNELRRPRNIRYNVQPTRPRYRDPVSGATWSGRGHVPAWIAYQDRSRFVIKDE"
FT                   /protein_id="YP_001109964.1"
FT   misc_feature    complement(7179..7436)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep1808_7557"
FT   gene            complement(7464..8141)
FT                   /db_xref="GeneID:4947588"
FT                   /locus_tag="Bcep1808_7558"
FT   CDS_pept        complement(7464..8141)
FT                   /locus_tag="Bcep1808_7558"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287800"
FT                   /db_xref="GeneID:4947588"
FT                   /translation="MNGTLTLSLEQCQELLQDIREKRRHRLTGSEYKAIIQAVDNHRVD
FT                   REASQLARQVAAQLAQHEGPGSKPPFEDPTMNRVFLVECQPATPPENDPRMQEHVVVGK
FT                   TVFRSREYDHVARANVPNDRGDPGREVTAKRLDVQHEGDGVVDRYGVYQVMTKTHTTYG
FT                   SGMPSMPKDVDKVLKGTYSSFQAACDAIDSQLGMTPRSRLASEQMQRLQETRAQRKNAP
FT                   RPA"
FT                   /protein_id="YP_001109965.1"
FT   gene            complement(8146..8403)
FT                   /db_xref="GeneID:4947589"
FT                   /locus_tag="Bcep1808_7559"
FT   CDS_pept        complement(8146..8403)
FT                   /locus_tag="Bcep1808_7559"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287801"
FT                   /db_xref="GeneID:4947589"
FT                   /translation="MNRLLLNEMYLFLCRLSRLGKTGVVFVLLVAVVSSIVLHTKGLNM
FT                   DDSIAQWTTTPLVVMAAVAVLAELVSSMMRVHLLQAADRG"
FT                   /protein_id="YP_001109966.1"
FT   gene            complement(8518..8952)
FT                   /db_xref="GeneID:4947590"
FT                   /locus_tag="Bcep1808_7560"
FT   CDS_pept        complement(8518..8952)
FT                   /locus_tag="Bcep1808_7560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287802"
FT                   /db_xref="GeneID:4947590"
FT                   /translation="MGGDLRVLEQQGPLMNTKETDQTLEQLKSIASALETLASLRLVET
FT                   FYSAEERQELLARRRKLYEDDAAAYAELQAAQDAQPDQGVGYEARVKKHGEQVVAEQFA
FT                   PVRAALEKRRETLRAIERFEVAHPLIKRLSSYAPSIDSAA"
FT                   /protein_id="YP_001109967.1"
FT   gene            complement(9217..9399)
FT                   /db_xref="GeneID:4947591"
FT                   /locus_tag="Bcep1808_7561"
FT   CDS_pept        complement(9217..9399)
FT                   /locus_tag="Bcep1808_7561"
FT                   /gene_family="HOG000263364" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfo:Pfl_2115 hypothetical protein"
FT                   /db_xref="GI:134287803"
FT                   /db_xref="GeneID:4947591"
FT                   /translation="MPALVSREPWWEKPPQPGQSEFECVWGWLELYDDGTFRFDASTRP
FT                   SDQQIEQRKGCRLPE"
FT                   /protein_id="YP_001109968.1"
FT   gene            complement(9620..10426)
FT                   /db_xref="GeneID:4947592"
FT                   /locus_tag="Bcep1808_7562"
FT   CDS_pept        complement(9620..10426)
FT                   /locus_tag="Bcep1808_7562"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287804"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947592"
FT                   /translation="MTLKAGAMLLAVGLVLAGCDGKKDSVQDSAGQTSASPASLLNSPK
FT                   LPDPVPASAAAQAPSLPKPDRNVPTTSYVDLNGEAAGMALTYIVSAKSQGTVSDEDKLN
FT                   RLSPSYYNETDAFKKKDLAATELPRINAALDEYRKHDYYTLPVSGYSQKPLGLTNVTVG
FT                   QYDFNTKSFPLTSYGQYCWAGILRNQQGATLRILPSDFPCSLPVSDEQQAKLIEATRAQ
FT                   NALALQGTLYLFVPRAENGTALAVVSRAHLELVNAQTKAPLASFDL"
FT                   /protein_id="YP_001109969.1"
FT   sig_peptide     complement(10373..10426)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.303 at
FT                   residue 18"
FT                   /locus_tag="Bcep1808_7562"
FT                   /product="hypothetical protein"
FT   gene            complement(10505..11056)
FT                   /db_xref="GeneID:4947593"
FT                   /locus_tag="Bcep1808_7563"
FT   CDS_pept        complement(10505..11056)
FT                   /locus_tag="Bcep1808_7563"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287805"
FT                   /db_xref="GeneID:4947593"
FT                   /translation="MQAVIQNLLHTKEDKMNIIWYVLRPFYLLGLVLAVPLFFIVANHA
FT                   GKDLEVSVPLLVGCLGYFALGYLLLKALPDFLRGRVLARVAAFKAKGFAPQWEVVSVIY
FT                   NRYVGFDPKARKALYVDVNDGTEELVDFDSVNAWELDVEKSKPALLKLLTRVPALPVVG
FT                   LRIDRRKADEWKSNLVTIFG"
FT                   /protein_id="YP_001109970.1"
FT   gene            complement(11144..11362)
FT                   /db_xref="GeneID:4947594"
FT                   /locus_tag="Bcep1808_7564"
FT   CDS_pept        complement(11144..11362)
FT                   /locus_tag="Bcep1808_7564"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xom:XOO_2590 hypothetical protein"
FT                   /db_xref="GI:134287806"
FT                   /db_xref="GeneID:4947594"
FT                   /translation="MREADLPVGLSAFYEVRTMATRDEMRKSLNEDAVLAWEEYERTGL
FT                   HLTLEEVSVWLSTWGSPDESPPPTCHE"
FT                   /protein_id="YP_001109971.1"
FT   gene            complement(11364..13565)
FT                   /db_xref="GeneID:4947595"
FT                   /locus_tag="Bcep1808_7565"
FT   CDS_pept        complement(11364..13565)
FT                   /locus_tag="Bcep1808_7565"
FT                   /gene_family="HOG000263365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xac:XAC2419 integral membrane protein"
FT                   /db_xref="GI:134287807"
FT                   /db_xref="GeneID:4947595"
FT                   /translation="MKTSRILAGLMAGMATLLSLPALAQSTSLGEITQAAQRSGDKSRE
FT                   ALVSIYGNVVNNPLATGGAGGSDTILAGIFQVANGALLVVGAFFACYVMFKKVSQTAHD
FT                   GAVFDREKHTMWGPIRIVWGLASLVPTANGWSLAQLLMLWGASLMGVGIANLGVDASVS
FT                   AFENGQSMVVQPVMPSTVNLAHSVFESNLCMHAINAGLAQAESSGALVTQDGYIQQSPT
FT                   NSGFVLKNSSFVCGGADINNDLQPQSQSTGWFSGTIDTSDLRRAHLQALQAMQSSLTSA
FT                   AQGFVNAVVQKQSGGGGALPDAEIAIQSAAQQYENTISSMAATKQGNIAALASQLSSSI
FT                   KEGGWWTLGAWYQTFAQANTKLSDAVAAKASVYGMSSEGDPSMLTVYQSAMAAYKAQQA
FT                   TSTYTPTLGTTSTGNYSKGAAGSDANKIIGSFFNAPGQRIVNYMIDINAGGEGRGQVNP
FT                   LIKMKNLGDYTMAAAETGLGAYVTAKAIAQVKEGWSVAGMFAKVANAVSSIGDALQGVL
FT                   DAMSPFLVMAIIALFILGGTLSTYLPMVPFIIWFGAAVNWLVVVGEAIIAAPLWAITHL
FT                   GGEGDGLGHRTAHGYIFLLNVMVRPILMVIGFFLGGAGIIAGGTLLNQTFGIALANAQF
FT                   DSVTGLFSIIFFLTIYASMCLNLVHSCFNLIFIVPDQVINWVGGHASGTIGRDDNDRMH
FT                   NAIRVFGSKLEQLLPGGGRSAGGKGGGGGKGGDGIKAST"
FT                   /protein_id="YP_001109972.1"
FT   sig_peptide     complement(13491..13565)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_7565"
FT                   /product="hypothetical protein"
FT   gene            complement(13562..14155)
FT                   /db_xref="GeneID:4947596"
FT                   /locus_tag="Bcep1808_7566"
FT   CDS_pept        complement(13562..14155)
FT                   /locus_tag="Bcep1808_7566"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287808"
FT                   /db_xref="GeneID:4947596"
FT                   /translation="MATEQKKNALRTTGKVAWRVFLPFSAMKRTVVLAKKEVERTKESL
FT                   GALKELGDDARKTIVEGIKGPKEQRNDSFADAMSRRSANALNEEELYRYFLGKKRIAIG
FT                   TAAFFALMGLYGVLGGIWFGHNRGIALGAISLVASQPVFFMVALGAQLRLWQLRTHRLS
FT                   KEEKGGLEDFMREVEGWWWVTLDPEFGRKGGTHA"
FT                   /protein_id="YP_001109973.1"
FT   gene            complement(14155..15375)
FT                   /db_xref="GeneID:4947597"
FT                   /locus_tag="Bcep1808_7567"
FT   CDS_pept        complement(14155..15375)
FT                   /locus_tag="Bcep1808_7567"
FT                   /gene_family="HOG000263366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraW protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTOA0062 TraW protein"
FT                   /db_xref="GI:134287809"
FT                   /db_xref="GeneID:4947597"
FT                   /translation="MKNKIVMRPLAAAVLAGGLVASTPAFAICDGCVVGAVNAASTMIT
FT                   GAITAMNTSVSTLLYNLGMAVNENGNKTASTIEAAARAQRENDVNMEMNRRIEDARQRY
FT                   QVPDNICSESGSGGAVQVGAAAGAAKGGIRPGGGAAIGNSAIAQAINSPPPAPEIDASR
FT                   AAKIHAQYCDADDYSAYGGARACPSVGSLPGADKRIDSVLSGAGPNGKAPELTFSQQQT
FT                   DVARMYTQNSIRRSIGPQLRKGEADTVAGAQYVGLMTQYNAIISAASDPQDQLIADSQP
FT                   NPATKDLLADALQAPSAASYYNQVASSQAKATGLMSAREFEAFEVGRRYANTQYQTDLQ
FT                   AMSGDNLLREQIRVASLNNWLLLEVKNELRKGNVINGEVLASVARQEYEPILTQKYRTI
FT                   GGRMGGQ"
FT                   /protein_id="YP_001109974.1"
FT   sig_peptide     complement(15292..15375)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 28"
FT                   /locus_tag="Bcep1808_7567"
FT                   /product="hypothetical protein"
FT   gene            complement(15372..18437)
FT                   /db_xref="GeneID:4947598"
FT                   /locus_tag="Bcep1808_7568"
FT   CDS_pept        complement(15372..18437)
FT                   /locus_tag="Bcep1808_7568"
FT                   /gene_family="HOG000263367" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraU protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTOA0060 TraU protein"
FT                   /db_xref="GI:134287810"
FT                   /db_xref="GeneID:4947598"
FT                   /translation="MGFLDKGVTAIEDTLAYLARYWIGKDFAGYCELATAVGLTEEDIK
FT                   RHPGLKDPYIVVDNKLALLTAFDVQGTYQILSDQDFGKMIDNLRVKMNGYMKRYGHSIT
FT                   FGFERDPDRSLDELMRLVEPQINAARRIGLKSEDIILDRVRRNAPLVAWEQNLMIVYTH
FT                   MNVMSPEEMKRELKERSQEAQKHGLPRIDFGQNPASVLMAMKYRHDTMIERVRHDFERC
FT                   GSDGRPGIMLRPISAHEAIKRVRIMVNRERTSQKFRPVLPGDRFIPRGREDKRDHSDLT
FT                   APPVNYQICTNDVTNHRELIKTDELWHGNLSMELGPQEPQPFSSLFASIDREIPWRVRI
FT                   DLNPGGLNEMRARQMMVAFVGMLPSNRQIRQSFIDLNERSKEDAICSMKFAVSTWSPSE
FT                   SVTKRRMAALEKSIQSWGICQVTSVHGDPMAAWASTIPGFTTKNVANRMVPPLPDALAL
FT                   LPLQRPATPWGDGGSLIVRTPDGKIYPIQLGSRLQDTWIELISAPPGSGKSVLMNSMNS
FT                   ATVHRPGNVRLPLMTIIDVGPSSSGLIQLIKDSLPEHRKSEAAYLRLQNSLEYATNPFD
FT                   TQLGARFPTSREQEFLVDLLTLFCTDPATKKAPSGCSQVNEMLLRIAYEDRATKNPHMY
FT                   EPHIDRTVDAVLESSGLKTQYSEEWWSVAKWWEVTDMLFQAGYVREASLAQRQAVPILP
FT                   DFGAYLNDESIRDLFGEAKVPGTNEPLLKYMYRCFTVATSNYALFAGRTRFELNSETRI
FT                   ISIDLNDVIGGKTPEGMLRTAAMYMFARQMAAKNYFLRDEVVLPVVPQMYQEYHLKRVA
FT                   DVQDEQKTIAYDEVHNTGGQEAFVQTMIKDGREGRKWGIRIVNASQYLADYPTELLNAA
FT                   TAVYVMRGGNAADEEILRSVYSVSEEAIRRLQREAVGPGPEGGNFLALFKTKVGFVVQL
FT                   LTNTVGPIELWAFSTTQEDVALRNRLYKRIGPYEARKLLSEHFPLGTALETIEHMRAES
FT                   SEKEDVSVIERLASKLVERYTRKITKQRELVE"
FT                   /protein_id="YP_001109975.1"
FT   gene            18603..19420
FT                   /db_xref="GeneID:4947599"
FT                   /locus_tag="Bcep1808_7569"
FT   CDS_pept        join(18603..18953,18953..19420)
FT                   /locus_tag="Bcep1808_7569"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase and inactivated derivatives-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_A3991 transposase and
FT                   inactivated derivatives-like"
FT                   /db_xref="GI:134287811"
FT                   /db_xref="GeneID:4947599"
FT                   /translation="MAKPIIDDELWTLIEPLLPPPKPRREKNPGRLPVSNRAALTGILF
FT                   VLKTGLRWRDLPAEMGCGSGVTCWRRLRDWQAAGVWDRLHELLLAKLRAADQIDFSRAA
FT                   VDSSSIRAVGAGQKTGPNPTDRARPGSKHHIVTDANGTPLAAILTGANVNDVTQLLPLI
FT                   DAIPPIRGLRGHPLQRPRVVYADRGYDSERHRRALRDRGIEPVIAKRRTEHGSGLGKYR
FT                   WVVERTHAWLHHFRRLRIRFERRADIHGAFLKLGCCLICWNTLRRADQSL"
FT                   /protein_id="YP_001109976.1"
FT   misc_feature    join(<18687..18953,18953..18964)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="Bcep1808_7569"
FT   misc_feature    join(18912..18953,18953..>19282)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Bcep1808_7569"
FT   gene            complement(19429..20118)
FT                   /db_xref="GeneID:4947600"
FT                   /locus_tag="Bcep1808_7570"
FT   CDS_pept        complement(19429..20118)
FT                   /locus_tag="Bcep1808_7570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTOA0059 TraT protein"
FT                   /db_xref="GI:134287812"
FT                   /db_xref="GeneID:4947600"
FT                   /translation="MTTDRTDIHDPAAVELDKVLPKPNLGSNFEKAAYPTLLFSTKSRV
FT                   WGDKHPDAVEPTEPEFERQDLRRKALVADGHRCMFCGFYSSQNQVHNLSDNHRDVRAEN
FT                   LRAADHLCHGWNHLGELGEGNAVIAYLPGLSAQDANHLQRTIIVALRSDDPVVREDAKK
FT                   LLNWMASHRDYAKDAWGTSDPAVFAEAIVRLEEQDREKREVVFEDLAVVFNPGPYTQVA
FT                   ATWARES"
FT                   /protein_id="YP_001109977.1"
FT   gene            complement(20166..20636)
FT                   /db_xref="GeneID:4947601"
FT                   /locus_tag="Bcep1808_7571"
FT   CDS_pept        complement(20166..20636)
FT                   /locus_tag="Bcep1808_7571"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287813"
FT                   /db_xref="GeneID:4947601"
FT                   /translation="MKKAMLKPIEWLGDLGRKAHITAAAKCADYVESRTPRERRIMLAS
FT                   AAMTFTGLCMATAAHADGQGIAGMVDTAAQQGDSIKTNLGKLFAVVGFGGAGYGGYNWW
FT                   RKGKEGEHSQIKGGQIFVPILAGAALGATGFVMIKAGETVGIQSSSQGQIPQ"
FT                   /protein_id="YP_001109978.1"
FT   sig_peptide     complement(20451..20636)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.764 at
FT                   residue 62"
FT                   /locus_tag="Bcep1808_7571"
FT                   /product="hypothetical protein"
FT   gene            complement(20661..21194)
FT                   /db_xref="GeneID:4947602"
FT                   /locus_tag="Bcep1808_7572"
FT   CDS_pept        complement(20661..21194)
FT                   /locus_tag="Bcep1808_7572"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraQ-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sec:SC067 TraQ-like protein"
FT                   /db_xref="GI:134287814"
FT                   /db_xref="GeneID:4947602"
FT                   /translation="MDLAQMVVHFASTFSVAMWRFLWVLGAVVGILYVGNSLLRMQRAS
FT                   RLPGQSPVTIGDILPIILIGGLLLNLSQFINATWNSFGTGTVSYGPISYSGASDFGRFA
FT                   DAINAVLTIASVAGGVFFFRGVVILKKASMDGQSSHGADDSVWRALTHMVGGAMLVQIP
FT                   DVIEAFRQSFGLYW"
FT                   /protein_id="YP_001109979.1"
FT   gene            complement(21207..22067)
FT                   /db_xref="GeneID:4947603"
FT                   /locus_tag="Bcep1808_7573"
FT   CDS_pept        complement(21207..22067)
FT                   /locus_tag="Bcep1808_7573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cell wall surface anchor family protein"
FT                   /db_xref="GI:134287815"
FT                   /db_xref="GeneID:4947603"
FT                   /translation="MSDPTDKDKQPDSGVDIFNMKPDTKSSNQAGKTHDGAAQTAKSKA
FT                   PALQGFASKLGPVHFAVVAAIIAAAWIAWPHMFGGSSRDTSTTTRMLNPDQAMSDASRT
FT                   QQQYQASANQAAASAPTTSASSVATTDAPSASAASAATAVTAASSPLPASETAAQAPST
FT                   KEAELQAKVDDLQGKLAAAEAQAAKCPAPAAAATASVSKPKHRVRHTSTSPRRYATSAT
FT                   TSHVGTGATKPGDFTLNTVYRDQAWIQNAERTYVVQAGDVIDGMRIIRVDASTRQVVTS
FT                   LGTIR"
FT                   /protein_id="YP_001109980.1"
FT   gene            complement(22105..23451)
FT                   /db_xref="GeneID:4947604"
FT                   /locus_tag="Bcep1808_7574"
FT   CDS_pept        complement(22105..23451)
FT                   /locus_tag="Bcep1808_7574"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sec:SC069 TraO-like protein"
FT                   /db_xref="GI:134287816"
FT                   /db_xref="GeneID:4947604"
FT                   /translation="MSTQSDVGRQSKVVAIGVIVAVAAIGYIAATYFADSSRKQSQISN
FT                   LQTQGRGTPTKESEQYSQVLDKYNRAKATDAEQSGQSYLSVLSSRTSNVPEQPASAPQA
FT                   QPQAQPQVVYYQQPAQQQNPQQDQQRQKEVTDQMQGLMANWAPVAHGTARVSTDSVDYA
FT                   KSLTRVSASEATQQAAAAAAAAAAKVKVVDDFALIPAMLQTAIDTDENSVVRAYIPSGQ
FT                   YAGAVLFAMGYKRITNTVDMTFSYMKWQGRSYKITAKAMDQDTMRTALSGEVNNRYFSR
FT                   IIIPAIAMGIGRTGQLFEQSAAQNIITPQGGVIQTYPSTPKWSAVGGTIAGGMGNQAGQ
FT                   VLANDAANMPVKQVLIPKDTPIWIQFIGPVLASDDVAAGATGPTQPVQPMQPGTDPLGA
FT                   VGQPASQPPRQNFPPTAPNGGYGSTPYNMPGYTPPGYYQPSGYGYYPRY"
FT                   /protein_id="YP_001109981.1"
FT   gene            complement(23463..24410)
FT                   /db_xref="GeneID:4947605"
FT                   /locus_tag="Bcep1808_7575"
FT   CDS_pept        complement(23463..24410)
FT                   /locus_tag="Bcep1808_7575"
FT                   /gene_family="HOG000263368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraN protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0060 TraN protein"
FT                   /db_xref="GI:134287817"
FT                   /db_xref="GeneID:4947605"
FT                   /translation="MSSQQQIQAAFPQTNYGAANYAVAGQPPQGYPQQYPAGAAPQNGV
FT                   APMPPLAPPSNFERAEQVVSPFSNDEIVRLRQQLDDSRKAKAYHPVRTVPRISSISVDL
FT                   SPGAALPIARVLPGEQTTLVFVDSTGAPWPLAVAPRVSDPRYFDVEWLQGTPSVVISAL
FT                   SAYEDGNATVFLQGMATPVVVKLATGEPDSKEKSRVVDYRLDLRVPGRGPNAQAPFLGA
FT                   GRVALYDDTMQAFLDGIPPRDAKRVTAHGDVPARTQVWQYGDAMFVRTNYDIQTAFDQS
FT                   MSAADGTRVYRLPPTPYVTLSEMGRSVTLQLDIN"
FT                   /protein_id="YP_001109982.1"
FT   misc_feature    complement(23469..24215)
FT                   /note="Protein of unknown function (DUF3625); Region:
FT                   DUF3625; pfam12293"
FT                   /db_xref="CDD:152728"
FT                   /locus_tag="Bcep1808_7575"
FT   gene            complement(24662..25435)
FT                   /db_xref="GeneID:4947606"
FT                   /locus_tag="Bcep1808_7576"
FT   CDS_pept        complement(24662..25435)
FT                   /locus_tag="Bcep1808_7576"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0059 TraM protein"
FT                   /db_xref="GI:134287818"
FT                   /db_xref="GeneID:4947606"
FT                   /translation="MTALNEANQERAVAAGSLPPRDQTEPDAASPNAANEQLAEIAAEL
FT                   HQTADAVEPAVRMEKDRKHLQFIAGSAVRLNFILATALLVSVVANGVLGWRAFNPDRQY
FT                   FASDNGRIFPLIPMSQPYRKAADVIQYAKDTMNRSFTMDFLNWRQQLEDVRGNYTRDGF
FT                   KSFIASLQASGVLATVRDRRMNMSVTAGTGVLTKEGVENGVYVWYVEMPIEVKLSGQTS
FT                   ELPAQRFLATVRIERVSTLDSIEGIGVGQLVTKPL"
FT                   /protein_id="YP_001109983.1"
FT   misc_feature    complement(24791..25111)
FT                   /note="Macrophage killing protein with similarity to
FT                   conjugation protein; Region: IcmL; pfam11393"
FT                   /db_xref="CDD:151833"
FT                   /locus_tag="Bcep1808_7576"
FT   gene            complement(25862..26434)
FT                   /db_xref="GeneID:4947607"
FT                   /locus_tag="Bcep1808_7577"
FT   CDS_pept        complement(25862..26434)
FT                   /locus_tag="Bcep1808_7577"
FT                   /gene_family="HOG000263181" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_D6459 hypothetical protein"
FT                   /db_xref="GI:134287819"
FT                   /db_xref="GeneID:4947607"
FT                   /translation="MLPTLRMNRNFVEALLAERAPCFAMGLVAEGQTHYACLALRPVDD
FT                   IPNDVTRSGFNFGHSIRGTDDFEVVHFGLEFYGYRIFNALINPSNFIARTILSHMVDTK
FT                   AFFFFAVNPSGGVTVFKSGIGECSLDSIESNLERILRSSTSDAQYDAALTTFSDHPDPV
FT                   GPMLHWVCRDCEDCLDLSHNVIELGPA"
FT                   /protein_id="YP_001109984.1"
FT   gene            26481..27155
FT                   /db_xref="GeneID:4947608"
FT                   /locus_tag="Bcep1808_7578"
FT   CDS_pept        26481..27155
FT                   /locus_tag="Bcep1808_7578"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_D6458 hypothetical protein"
FT                   /db_xref="GI:134287820"
FT                   /db_xref="GeneID:4947608"
FT                   /translation="MRCVDVEHQRLYIVELEQRAIGGPRQIIVHHRAEIGFIPLAAIDT
FT                   PQQRLAGQHDLSLAIRARLLDLLALRLSCRFAGCFQLLQLFVCRIETTFQHVHSGVLFE
FT                   EAVCAGNRRAGVRRFVTFAPYCRAQVRTEGAISTNVGGMFGNTSIVQPPSRFGAIYAGR
FT                   QLPSARISITNSDVPTLSRQVLTTAGGKGLPGCGIVFHRNRNKGFQARTAENSITPIRA
FT                   LQ"
FT                   /protein_id="YP_001109985.1"
FT   gene            complement(27130..30156)
FT                   /db_xref="GeneID:4947609"
FT                   /locus_tag="Bcep1808_7579"
FT   CDS_pept        complement(27130..30156)
FT                   /locus_tag="Bcep1808_7579"
FT                   /gene_family="HOG000156427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   reu:Reut_D6457 transposase Tn3"
FT                   /db_xref="GI:134287821"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:4947609"
FT                   /translation="MINKNKLLSVFSDAEQEALYGLPDFDDAQRLEYLALTESELALAS
FT                   SRPSIPAQVYCILQIGYFKSKHAFFRFDWDEVEDDYDFVLSRYFHGEPFERKPITRHEY
FT                   YAQREQIAELYGYRPWVAAFLPQLMQQAAQIVRRDVTPGFVAAELIVWLNEHKMIRPGY
FT                   TTLQELVSEALSVERRRLGDLLTGVLDELTQTALDQLLVRDDTLSKLAALKQDAKNFGW
FT                   RQMVREREKRGTLQPLHEIARTLLPRLDISQQNVLYYASLANFYTVHDLRNLKADQAQL
FT                   YLLCYAWVRFRQLTDNLVDAMAFHMKQLEEESSAGAKQSLIAEQVKRHRETPQIGRLLS
FT                   LYVDDSVADPTPFGEVRQRAYKIMAKDVLQNTAQRMTVKPLSQLALHWLAVDGLAKRIR
FT                   RHLRPLYVELDFVGTSPDNPWLAALAWVKGAFAKQQRLSQRPLAECPAATLPKRLRPYL
FT                   LIFGADGQPTGLHADRYEFWLYRQIRKRFQSGEIYLDDSLQHRHFSDELVSMNEKADAL
FT                   AQMEIPFLQQPIDAQLDALAAELHAQWLAFNRELKQGKLTHLEYDKDTQKLIWRKPKTE
FT                   NQKVREQAFYEQLPFCDVADVFRFVNGQCQFLSALTPLQPRYAKKVADADSLMAVIIAQ
FT                   AMNHGNHVMARTSDIPYHVLDSTYQQYLRQATLHAANDCISNAIAALPIFPYYSFDLDA
FT                   LYSAVDGQKFGVERPTVKARYSRKYFGRGKGVVAYTLLCNHVPLNGYLIGAHEYEAHHV
FT                   FDIWYRNTSDIVPTAITGDMHSINKANFAILYWFGLRFEPRFTNLDDQLQELYCIDDPA
FT                   LYEKCLIQPIGQIDRQLITSEKTNIDQIVATLGLKEITQGSLIRKLCTYSQENPTRRAI
FT                   FEFDKLIRTIYTLRYLRDPQLERNVHRSQNRLESYHQLRSTIAQVGGKKELTGRTDIEI
FT                   EISNQCARLIANVIIFYNSAILSHLLTKWEASGNAKALARLTQISPAAWRHILLNGHYT
FT                   FQSDNKIDLDALIAGLELE"
FT                   /protein_id="YP_001109986.1"
FT   misc_feature    complement(27193..29844)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_7579"
FT   misc_feature    complement(27283..28230)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bcep1808_7579"
FT   gene            30300..31991
FT                   /db_xref="GeneID:4947610"
FT                   /locus_tag="Bcep1808_7580"
FT   CDS_pept        30300..31991
FT                   /locus_tag="Bcep1808_7580"
FT                   /gene_family="HOG000220306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   reu:Reut_D6456 phage integrase"
FT                   /db_xref="GI:134287822"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4947610"
FT                   /translation="MKTRPTSPSAADIPTDFPDADALAALRAWYEGASSREAAHRYMQD
FT                   RLSHSQSARGVIGQIRRQLALYARNRQRADLATLFECPAQKRMHHARATTQAVELLRIM
FT                   PAPAPQIGDDIAHWLPNRAARTLHAAGIRTLADLTVRIPRRRQWWTVIPGLGPASARRI
FT                   EAFFAAYPALTERARALIIADRQSVVTPWEQLRLPHEIDGSAGAFRAPVSACILGVDND
FT                   YDAIQAWLALHESPATQRAYRKEAERLILWGIVARGKALSSLTTRDATDYRAFLRRPTP
FT                   RERWVGPPRPRTSTDWRPFVDNLSARSIAHALAVLSAMFRWLVEQRYVVANPFSGIKVR
FT                   GSKRAMALETSHAFTEGEWMLTRTIANGLEWSYGWQAPAAQRLRFMLDFGYATGLRISE
FT                   LADATLRSIEVDAAGDHWLHVVGKGGKPARVTLTPLARTALDRYLQERGLPVSRAHWNP
FT                   TTSLIGSLDDADAGIKPLRLWEVMRRFFRLVAQIIKNDHPVLAEKLHRASPHWMRHTHA
FT                   THAIARGVELSAVRDNLRHASISTTSIYLHTDDVKRARQFGQAFTD"
FT                   /protein_id="YP_001109987.1"
FT   misc_feature    30594..30875
FT                   /note="Phage integrase protein; Region: DUF3701; pfam12482"
FT                   /db_xref="CDD:152916"
FT                   /locus_tag="Bcep1808_7580"
FT   misc_feature    30969..31946
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Bcep1808_7580"
FT   misc_feature    31356..31940
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bcep1808_7580"
FT   misc_feature    order(31485..31487,31566..31568,31827..31829,31836..31838,
FT                   31905..31907,31932..31934)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bcep1808_7580"
FT   gene            complement(32355..32918)
FT                   /db_xref="GeneID:4947611"
FT                   /locus_tag="Bcep1808_7581"
FT   CDS_pept        complement(32355..32918)
FT                   /locus_tag="Bcep1808_7581"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287823"
FT                   /db_xref="GeneID:4947611"
FT                   /translation="MWGWFHLPRTLDDRGRLAPFPQGGKGGGMGGRPPTAAWSSSVPHS
FT                   FAIHKSIRSRRGYRNIPVVGLWSSWVVGARSAWMMIFCCTKCGRCYAGTVRRSVTVKAR
FT                   SPSLFIECVWPRRGRASRQACLPRGEPVRRGLGTLARQSRATFWGMPGGRPRLRGRGGA
FT                   RSAERAGGGRLRPPRGGGLRLRYY"
FT                   /protein_id="YP_001109988.1"
FT   gene            33235..34179
FT                   /db_xref="GeneID:4947612"
FT                   /locus_tag="Bcep1808_7582"
FT   CDS_pept        33235..34179
FT                   /locus_tag="Bcep1808_7582"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287824"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="GeneID:4947612"
FT                   /translation="MSEQFGFDFGDAAKAFALHEPGTWLDPKYTVEQYRAMFASGAAAV
FT                   TRIAGPARPLFVRGLALAGDELEKMVERCGDDNEPRHLWRVTCNPTDDEFDGFVAHCRA
FT                   MVGAAFDGIEYKVRDEDGCVTTAAMYVRNVGTLIAWRWSETNRAIDFQPWRDTFFLESY
FT                   RDGIQAIEAPYATWGRAYCADKLANSNDGIASVPTFVVNGREYINDGGFSRGPYRECEG
FT                   WSFTAFADWKGPTFSYRSQCRAWDDGSLERGDRRGLVVRVRGQLCVLDGAVKVYDTQAS
FT                   DAAWQADEFDDVGAEEDVDHDDENELEEEEVAV"
FT                   /protein_id="YP_001109989.1"
FT   gene            34314..34571
FT                   /db_xref="GeneID:4947613"
FT                   /locus_tag="Bcep1808_7583"
FT   CDS_pept        34314..34571
FT                   /locus_tag="Bcep1808_7583"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287825"
FT                   /db_xref="GeneID:4947613"
FT                   /translation="MIAVPPIDLKQGHVARWESTTRFYELRLFRDFFGSPVALRSWGQK
FT                   DGTRIRTLQTILEADHECAPLFRLVIKRMRGRPYTLCKIC"
FT                   /protein_id="YP_001109990.1"
FT   gene            34597..35520
FT                   /db_xref="GeneID:4947614"
FT                   /locus_tag="Bcep1808_7584"
FT   CDS_pept        34597..35520
FT                   /locus_tag="Bcep1808_7584"
FT                   /gene_family="HOG000229222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_4219 hypothetical protein"
FT                   /db_xref="GI:134287826"
FT                   /db_xref="GeneID:4947614"
FT                   /translation="MAATPVPKGQYKPYTQTELFAANMLEWPVKDDLASMEFPLFSLSK
FT                   RPDTKVREYVSPSTHKRVKVIPSVLGAATVFDKDLLLYVGSQIIEARQAGLPISRTVKI
FT                   DTYAFLTGTERDPGGKAYDNMLDMLRRLKGTTIETNIATGGEEETRGFGWIEDYTVTRR
FT                   TKNGKGVLEVVVIVAEWLYKAFLHYEVLTIDRRYFLLTQSLERRLYELARKHAGDKAIW
FT                   KCDIEIMRQKSGSIQTLRHFRSDVRDIIRRDALPDYRVALDSSKKPHKIVFYTRDSKAL
FT                   TKELQRIDGFTWFEQLERQGTLQLDD"
FT                   /protein_id="YP_001109991.1"
FT   misc_feature    34684..35376
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="Bcep1808_7584"
FT   gene            36086..36385
FT                   /db_xref="GeneID:4947615"
FT                   /locus_tag="Bcep1808_7585"
FT   CDS_pept        36086..36385
FT                   /locus_tag="Bcep1808_7585"
FT                   /gene_family="HOG000263369" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287827"
FT                   /db_xref="GeneID:4947615"
FT                   /translation="MANMKYFHGDRQLTAIASMPNAEFAKRFPGATGRRYDGYQMLVGS
FT                   PVDARDQVLPVERVIEYKANPSRHECDARCLNATGKIMRCECSCGGKNHGRGSL"
FT                   /protein_id="YP_001109992.1"
FT   gene            complement(36627..37964)
FT                   /db_xref="GeneID:4947616"
FT                   /locus_tag="Bcep1808_7586"
FT   CDS_pept        complement(36627..37964)
FT                   /locus_tag="Bcep1808_7586"
FT                   /gene_family="HOG000106819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_5544 transposase IS116/IS110/IS902"
FT                   /db_xref="GI:134287828"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:4947616"
FT                   /translation="MAMRKRDDEVVFPNAAGIDVGASSHWAAVPRHFAEQAGCEPVREF
FT                   GAMTDDLNALADWLLACGIDTVALESTGVYWIPVYEVLEQRGLKVWLVDARQLKYVPGR
FT                   KSDVQDCQWLQKLMSLGLLRAAWRPGSEVCVVRAVARQREVLLTEQASWVQRMQKALVQ
FT                   MNIQLTEVLSDVMGQTGQAIIRAIVAGERDPKILARHRHSRIKASAEEIIKALTGNWRE
FT                   EHLFVLGQALAMYDDIGRHLVECEAKLRELLAERSERRVDLGKAPKAGAKARMEFDVRQ
FT                   ALANWAGVDLTRINGLGVTVVMKLLSEIGPDLGRFANVKHFCSWLGLCPGTKISGGKVL
FT                   SSGTKRSANRARQALKMAAMSLSHSDSALGAFYRRLCARMDKPRANTATAHKLARMVYF
FT                   MLTRGEAFVDQGQQRYEEQQHQRSVASLRRRAAALGFQIHPVEVVA"
FT                   /protein_id="YP_001109993.1"
FT   misc_feature    complement(37446..37718)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="Bcep1808_7586"
FT   misc_feature    complement(36843..37094)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Bcep1808_7586"
FT   gene            38237..38458
FT                   /db_xref="GeneID:4947617"
FT                   /locus_tag="Bcep1808_7587"
FT                   /pseudo
FT   gene            38864..39502
FT                   /db_xref="GeneID:4947618"
FT                   /locus_tag="Bcep1808_7588"
FT   CDS_pept        38864..39502
FT                   /locus_tag="Bcep1808_7588"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   xcv:XCVc0005 putative partition protein"
FT                   /db_xref="GI:134287829"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:4947618"
FT                   /translation="MTKYAVVNTKGGVGKTTTGVHLATHLAYSEPTLLIDGDPQETAAT
FT                   WAAWRRDSDAVKGKPSPTTTCLRGKAIFDEGKQLSKGFVHTVVDAGGRDAPGLRNALLL
FT                   ADLAIVPVGASGFDAAAMTDLLEVVDLAKDYNPELRVKILLTRIDPRTKDGKEMLEFLQ
FT                   ESKLDVLNARVCERVAFRRATSEGSTVEEIGKDSQAVAEMAAFYEEVKA"
FT                   /protein_id="YP_001109994.1"
FT   misc_feature    38924..39409
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   Region: CbiA; pfam01656"
FT                   /db_xref="CDD:145019"
FT                   /locus_tag="Bcep1808_7588"
FT   misc_feature    38924..39301
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7588"
FT   misc_feature    39128..39130
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7588"
FT   gene            39499..39756
FT                   /db_xref="GeneID:4947619"
FT                   /locus_tag="Bcep1808_7589"
FT   CDS_pept        39499..39756
FT                   /locus_tag="Bcep1808_7589"
FT                   /gene_family="HOG000263370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287830"
FT                   /db_xref="GeneID:4947619"
FT                   /translation="MKKKPSLDEFRSGGSEGAVEASAPAAAAPTVPVVAERTNKTIRIR
FT                   KTFEAKLKEDAFHRSQAEGRRVTESDIIDEALEFYWAQNK"
FT                   /protein_id="YP_001109995.1"
FT   gene            40406..41086
FT                   /db_xref="GeneID:4947620"
FT                   /locus_tag="Bcep1808_7590"
FT   CDS_pept        40406..41086
FT                   /locus_tag="Bcep1808_7590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_2106 transposase"
FT                   /db_xref="GI:134287831"
FT                   /db_xref="GeneID:4947620"
FT                   /translation="MATLERTAYPRFPEVLARRELQACYTPLSDELEWARRSTRGERPR
FT                   LGLLVLLKVFQQLHYFPPLDTIPTAIIDHVRAAADIGGTVHFGYDTETSPTLFRHYAAV
FT                   RAYLDVKPVYGTDANAIATRAAHTASVTMDQPVDIINATIDELIARDIELPAFSTLDRL
FT                   TEQIHARAQSRLFKRVTRRLTDEQKLALDRLLARDLSSRQTAYNRIKRHAKRRDVRLSS
FT                   SFSR"
FT                   /protein_id="YP_001109996.1"
FT   misc_feature    40412..>40969
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_7590"
FT   gene            41221..41718
FT                   /db_xref="GeneID:4947621"
FT                   /locus_tag="Bcep1808_7591"
FT   CDS_pept        41221..41718
FT                   /locus_tag="Bcep1808_7591"
FT                   /gene_family="HOG000116010" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_3260 hypothetical protein"
FT                   /db_xref="GI:134287832"
FT                   /db_xref="GeneID:4947621"
FT                   /translation="MAWPIAPRPFLEEAFGGWLGRIAARYQTSVDLIWESGTGVAMPSL
FT                   TKAGWILFPPVPSPTLSRLSRAARLNDGILSMIQTPHEWVFDQKYLVYCFRCLVLNDAD
FT                   VTASRWKREWLDPSADYCRVHHSLLETVPQSIFARAPNFDAALRAISRYRCPPLRLSKT
FT                   LR"
FT                   /protein_id="YP_001109997.1"
FT   gene            complement(41783..42016)
FT                   /db_xref="GeneID:4947622"
FT                   /locus_tag="Bcep1808_7592"
FT                   /pseudo
FT   gene            42398..42622
FT                   /db_xref="GeneID:4947623"
FT                   /locus_tag="Bcep1808_7593"
FT   CDS_pept        42398..42622
FT                   /locus_tag="Bcep1808_7593"
FT                   /gene_family="HOG000229496" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase subunit; KEGG:
FT                   rme:Rmet_1331 phenol hydroxylase subunit"
FT                   /db_xref="GI:134287833"
FT                   /db_xref="InterPro:IPR010353"
FT                   /db_xref="GeneID:4947623"
FT                   /translation="MHKQAALEAEPRFDPNLRFVSVTAINTQGFVQFEFSVGTPELCVE
FT                   LMLPVAAFEEFCLAQKVTRLDAFGEIVRH"
FT                   /protein_id="YP_001109998.1"
FT   misc_feature    42419..42598
FT                   /note="Phenol hydroxylase subunit; Region: Phenol_hyd_sub;
FT                   pfam06099"
FT                   /db_xref="CDD:147972"
FT                   /locus_tag="Bcep1808_7593"
FT   gene            42710..43705
FT                   /db_xref="GeneID:4947624"
FT                   /locus_tag="Bcep1808_7594"
FT   CDS_pept        42710..43705
FT                   /locus_tag="Bcep1808_7594"
FT                   /gene_family="HOG000219896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; KEGG:
FT                   rme:Rmet_1330 methane/phenol/toluene hydroxylase"
FT                   /db_xref="GI:134287834"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="GeneID:4947624"
FT                   /translation="MTIDLKTREIKPLRHTYTHVAQYIGADKAASRYQEGTVGAQPAAN
FT                   FHYRPTWDPEHELFDTSRTAIQMKDWYALKDPRQFYYASWTMTRARQQDAMESNFEFVE
FT                   SRGMIDLVSDEVRQRALSVLVPLRHAAWGANMNNSQICALGYGTTFTAPAMFHAMDNLG
FT                   VAQYLTRLALVMSGPDLLDEAKQAWMTSPDWQPLRRYVENTLVLQDPVELFIAQNLALD
FT                   GLLYPMIYGAFVDDYIALNGGSAVAMLTTFMPEWHDESSRWVDAVVKTMATESEDNKAL
FT                   LIHWLRTWEDQAASALLPVAEMALAENGHDALEEVRQQLRARVAKAGIVL"
FT                   /protein_id="YP_001109999.1"
FT   misc_feature    42779..43687
FT                   /note="Aromatic and Alkene Monooxygenase Hydroxylase,
FT                   subunit B, ferritin-like diiron-binding domain; Region:
FT                   AAMH_B; cd01058"
FT                   /db_xref="CDD:153116"
FT                   /locus_tag="Bcep1808_7594"
FT   misc_feature    order(42968..42973,42980..42985,42989..42994,43001..43006,
FT                   43022..43027,43031..43033,43388..43390,43400..43402,
FT                   43412..43414,43424..43426,43439..43441,43451..43453,
FT                   43460..43465,43469..43471,43478..43483,43490..43492,
FT                   43652..43654,43664..43669,43673..43681)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153116"
FT                   /locus_tag="Bcep1808_7594"
FT   gene            43745..44014
FT                   /db_xref="GeneID:4947625"
FT                   /locus_tag="Bcep1808_7595"
FT   CDS_pept        43745..44014
FT                   /locus_tag="Bcep1808_7595"
FT                   /gene_family="HOG000219897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   rme:Rmet_1329 monooxygenase component MmoB/DmpM"
FT                   /db_xref="GI:134287835"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="GeneID:4947625"
FT                   /translation="MSNVFIAFQANEESRPVVEAILADNPKAVATESPGMVKIDAPGHL
FT                   TINRQSIEDRIGMKFDLQQIHINLITLSGYIDEDDEQFTLSWKH"
FT                   /protein_id="YP_001110000.1"
FT   misc_feature    43745..44005
FT                   /note="MmoB/DmpM family; Region: MmoB_DmpM; pfam02406"
FT                   /db_xref="CDD:145512"
FT                   /locus_tag="Bcep1808_7595"
FT   gene            44037..45596
FT                   /db_xref="GeneID:4947626"
FT                   /locus_tag="Bcep1808_7596"
FT   CDS_pept        44037..45596
FT                   /locus_tag="Bcep1808_7596"
FT                   /gene_family="HOG000219898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS domain
FT                   protein; KEGG: rme:Rmet_1328 methane/phenol/toluene
FT                   hydroxylase"
FT                   /db_xref="GI:134287836"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="GeneID:4947626"
FT                   /translation="MDTSVQKKKLGLKDRYAAMTRGLGWQTSYQPMEKVFPYDKYEGIK
FT                   IHDWDKWEDPFRLTMDAYWKYQGEKEKKLYAVIDAFAQNNGQLSISDARYVNALKVFIQ
FT                   GVTPLEYMAHRGFAHIGRHFTGEGARVACQMQSIDELRHFQTEMHALSHYNKYFNGLHN
FT                   SIHWYDRVWYLSVPKSFFEDAATGGPFEFLTAVSFSFEYVLTNLLFVPFMSGAAYNGDM
FT                   STVTFGFSAQSDESRHMTLGIECIKFMLEQDPDNVPIVQRWIDKWFWRGYRLLSIVAMM
FT                   QDYMLPNRVMSWRESWEMYVEQNGGALFKDLARYGIRKPKGWDQACEGKDHISHQTFAV
FT                   FYNYNAAAPIHTWVPTKEEMGWLSEKYPETFDKYYRPRWDYWREQAAKGNRFYNKTLPM
FT                   LCTTCQIPMIFTEPGDATKICYRESAYLGDKYHFCSDHCKEIFDNEPEKFVQSWLPPQQ
FT                   VYQGNCFKPDADPTKEGFDPLMALLDYYNLNVGRDNFDFEGSEDQKNFAAWRGEVLQGE
FT                   AK"
FT                   /protein_id="YP_001110001.1"
FT   misc_feature    44094..45515
FT                   /note="Aromatic and Alkene Monooxygenase Hydroxylase,
FT                   subunit A, ferritin-like diiron-binding domain; Region:
FT                   AAMH_A; cd01057"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Bcep1808_7596"
FT   misc_feature    order(44250..44255,44262..44267,44271..44276,44286..44288,
FT                   44304..44306,44700..44702,44712..44714,44721..44723)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Bcep1808_7596"
FT   misc_feature    order(44337..44339,44349..44354,44565..44567,44658..44660,
FT                   44868..44870,44877..44882,45048..45050,45084..45086,
FT                   45090..45092)
FT                   /note="putative path to active site cavity; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Bcep1808_7596"
FT   misc_feature    order(44364..44366,44454..44456,44463..44465,44637..44639,
FT                   44739..44741,44748..44750)
FT                   /note="diiron center; other site"
FT                   /db_xref="CDD:153115"
FT                   /locus_tag="Bcep1808_7596"
FT   gene            45593..45949
FT                   /db_xref="GeneID:4947627"
FT                   /locus_tag="Bcep1808_7597"
FT   CDS_pept        45593..45949
FT                   /locus_tag="Bcep1808_7597"
FT                   /gene_family="HOG000219899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase region"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase conserved region; KEGG:
FT                   rme:Rmet_1327 phenol hydroxylase conserved region"
FT                   /db_xref="GI:134287837"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="GeneID:4947627"
FT                   /translation="MSVVALKPYKFPARDARENFPAPLLFIGWEDHLLFAAPVALPLPS
FT                   DTLFGALCTQVLPGTYGYHPDFSKIDWSQVQWFKSGQPWHPDPAKSLAENGLTHKDVIR
FT                   FRTPGLNGLSGSCN"
FT                   /protein_id="YP_001110002.1"
FT   misc_feature    45629..45826
FT                   /note="Phenol hydroxylase conserved region; Region:
FT                   Phenol_monoox; pfam04663"
FT                   /db_xref="CDD:147023"
FT                   /locus_tag="Bcep1808_7597"
FT   gene            46028..47092
FT                   /db_xref="GeneID:4947628"
FT                   /locus_tag="Bcep1808_7598"
FT   CDS_pept        46028..47092
FT                   /locus_tag="Bcep1808_7598"
FT                   /gene_family="HOG000263662" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase FAD-binding subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: rme:Rmet_1326 oxidoreductase FAD-binding region"
FT                   /db_xref="GI:134287838"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="GeneID:4947628"
FT                   /translation="MTYQLNIQPLGATIEVEEGQTILDAALRQGIYIPHACGHGLCGTC
FT                   KVQVCDGEVDLGDANPFALMDFEREERKALACCATLLDDTTIEADIEEDPDAEVIPVED
FT                   FNAEVTRIEQLTPTIKAVFLRLDQPIHFQAGQYVQLEIPELRQTRAFSIANSPADVAAT
FT                   GEIELNIRRVPGGQGTGYIHEQLAVGNILHVTGPYGRFFVRRSADQPMVFMAGGSGLSS
FT                   PRSMILDLLQSGWSKPITLIYGQRNEAELYYDEEFRELGQRYSNFSYVPALSEKAEGAT
FT                   HPLAQGFVHEVAKAHFENNFSGHKAYLCGPPAMIDACVTTLIQGRLFERDIYFEKFISA
FT                   ADAQQVRSPLFKRV"
FT                   /protein_id="YP_001110003.1"
FT   misc_feature    46028..47056
FT                   /note="CDP-6-deoxy-delta-3,4-glucoseen reductase;
FT                   Validated; Region: PRK07609"
FT                   /db_xref="CDD:169034"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    46037..46273
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46124..46129,46136..46138,46145..46147,46151..46162,
FT                   46253..46258)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46136..46138,46151..46153,46160..46162,46256..46258)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    46322..47038
FT                   /note="Phenol 2-monooxygenase (phenol hydroxylase) is a
FT                   flavoprotein monooxygenase, able to use molecular oxygen as
FT                   a substrate in the microbial degredation of phenol. This
FT                   protein is encoded by a single gene and uses a tightly
FT                   bound FAD cofactor in the NAD(P); Region:
FT                   phenol_2-monooxygenase_like; cd06211"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46436..46438,46472..46483,46532..46540,46544..46546,
FT                   46556..46564,46679..46681,46688..46690,47030..47032,
FT                   47036..47038)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46472..46474,46478..46483)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46553..46555,46562..46564,46571..46573,46592..46594,
FT                   46616..46618,46622..46624)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46664..46666,46676..46687,46691..46693)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   misc_feature    order(46679..46684,46757..46765,46955..46960)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99807"
FT                   /locus_tag="Bcep1808_7598"
FT   gene            47095..47451
FT                   /db_xref="GeneID:4947629"
FT                   /locus_tag="Bcep1808_7599"
FT   CDS_pept        47095..47451
FT                   /locus_tag="Bcep1808_7599"
FT                   /gene_family="HOG000219890" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferredoxin"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; KEGG: rme:Rmet_1325 ferredoxin"
FT                   /db_xref="GI:134287839"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="GeneID:4947629"
FT                   /translation="MTTQDGKVYVTVKQTGERFSCALGESLLSGMARLGRRGIPVGCLS
FT                   GGCGVCKVAVCRGSVRKTGAMSRAHISEAEEAQGVVLACRVAPTDDVELEVVGKMQKPF
FT                   FKGFSFQVAQDSTK"
FT                   /protein_id="YP_001110004.1"
FT   misc_feature    47116..47379
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7599"
FT   misc_feature    order(47209..47214,47221..47223,47230..47232,47236..47247,
FT                   47341..47346)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7599"
FT   misc_feature    order(47221..47223,47236..47238,47245..47247,47344..47346)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_7599"
FT   gene            47470..48414
FT                   /db_xref="GeneID:4947630"
FT                   /locus_tag="Bcep1808_7600"
FT   CDS_pept        47470..48414
FT                   /locus_tag="Bcep1808_7600"
FT                   /gene_family="HOG000219891" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rme:Rmet_1324
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:134287840"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR011588"
FT                   /db_xref="GeneID:4947630"
FT                   /translation="MSVMRIGHASLKVMDMALAIKHYENVLGMKRTMEDEHGNVYLKCW
FT                   DEWDKYSVILTPSDQAGLNHVAYKVEHDADLNALQKRIEAYGIKTQMLPEGTLPSTGRM
FT                   LQFNLPSGHEMRLFATKEYVGTGVGTTNPDPWPDDVKGAGAHWLDHCLLMCELNPETGV
FT                   NRVAENTRFMKECLDFYLAEQVMVGPDSSIQAATWMFRTSTPHDIAFVGGPRNGLHHIA
FT                   FFLDSWHDVLKSADVMAKNKVKIDVAPTRHGITRGETIYFFDPSGNRNETFAGLGYLAQ
FT                   PDRPVTTWTEEHLGSGIFYHTGELVQSFTEVYT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110005.1"
FT   misc_feature    47473..47838
FT                   /note="N-terminal domain of catechol 2,3-dioxygenase;
FT                   Region: 2_3_CTD_N; cd07265"
FT                   /db_xref="CDD:176686"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    47476..48411
FT                   /note="catechol 2,3 dioxygenase; Region: catechol_2_3;
FT                   TIGR03211"
FT                   /db_xref="CDD:163184"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    order(47479..47484,47605..47607,47614..47616,47674..47676,
FT                   47836..47838)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176686"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    47893..48351
FT                   /note="C-terminal domain of catechol 2,3-dioxygenase;
FT                   Region: 2_3_CTD_C; cd07243"
FT                   /db_xref="CDD:176667"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    order(47908..47910,48001..48003,48070..48075,48079..48081,
FT                   48139..48141,48148..48156,48163..48168,48175..48180,
FT                   48187..48189,48214..48216,48220..48222,48235..48237,
FT                   48241..48243,48304..48306,48316..48324,48328..48339,
FT                   48346..48348)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176667"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    order(47917..47919,47923..47925,48061..48063,48085..48087,
FT                   48127..48129,48133..48135,48223..48225,48229..48234,
FT                   48250..48252,48280..48282,48349..48351)
FT                   /note="active site"
FT                   /db_xref="CDD:176667"
FT                   /locus_tag="Bcep1808_7600"
FT   misc_feature    order(47917..47919,48127..48129,48133..48135,48250..48252,
FT                   48280..48282)
FT                   /note="Fe binding site; other site"
FT                   /db_xref="CDD:176667"
FT                   /locus_tag="Bcep1808_7600"
FT   gene            48436..48885
FT                   /db_xref="GeneID:4947631"
FT                   /locus_tag="Bcep1808_7601"
FT   CDS_pept        48436..48885
FT                   /locus_tag="Bcep1808_7601"
FT                   /gene_family="HOG000195938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   rme:Rmet_1323 protein of unknown function DUF336"
FT                   /db_xref="GI:134287841"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="GeneID:4947631"
FT                   /translation="MTQADSLHSVEARLINWPAANRVVEAAAMHAQRLGVCVNIAVVDV
FT                   AGNLAAFLRMPGAPLHSIEIAIDKAYTAASFGLPTSRWSEALLSHSEAVRQGIVRRPRF
FT                   IAFGGGLPIVESGHRIGGIGVSGGTEEQDEHCAQAGLSLLGLTQT"
FT                   /protein_id="YP_001110006.1"
FT   misc_feature    48472..48867
FT                   /note="Domain of unknown function (DUF336); Region: DUF336;
FT                   cl01249"
FT                   /db_xref="CDD:174597"
FT                   /locus_tag="Bcep1808_7601"
FT   gene            48951..50462
FT                   /db_xref="GeneID:4947632"
FT                   /locus_tag="Bcep1808_7602"
FT   CDS_pept        48951..50462
FT                   /locus_tag="Bcep1808_7602"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rme:Rmet_1322
FT                   aldehyde dehydrogenase"
FT                   /db_xref="GI:134287842"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4947632"
FT                   /translation="MLITDPQATASTGNQSDAHAKEIHNFINGEYVPGQRWFEKRSPLN
FT                   NAVIAKVAEAGRAEVDAAVAAAQAALKGAWGRMSLAQRVEVLYAVADGINRRFDDFLAA
FT                   EVEDTGKPMSLARHVDIPRGAANFKIFADVVKNVPTEFFEMPTPDGVGAINYAMRRPVG
FT                   VVGVICPWNLPLLLMTWKVGPALACGNTVVVKPSEETPQTAALLGEVMNTAGVPPGVYN
FT                   VVHGFGPNSTGEFLTTHRGINAITFTGETRTGAAIMKAAADGARPVSLEMGGKNAAIVF
FT                   ADCDLDAAIEGTLRSCFANCGQVCLGTERVYVERPIFDRFVSALKKGAEGMQLGRPEDL
FT                   ATGMGPLISQEHRDKVLSYYKKAVEAGATVVTGGGVPDMPEALKGGAWVQPTIWTGLGD
FT                   DSVIAREEIFGPCALVMPFDSEEEVIRRANDNDYGLATAIWTTNLSRAHRVAGAIEVGI
FT                   AWVNSWFLRDLRTPFGGAKQSGIGREGGAHSLEFYTELKNVCIKL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110007.1"
FT   misc_feature    49026..50447
FT                   /note="delta-1-pyrroline-5-carboxylate dehydrogenase, group
FT                   2, putative; Region: D1pyr5carbox2; TIGR01237"
FT                   /db_xref="CDD:130304"
FT                   /locus_tag="Bcep1808_7602"
FT   misc_feature    49074..50453
FT                   /note="Human aldehyde dehydrogenase family 8 member
FT                   A1-like; Region: ALDH_F8_HMSADH; cd07093"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Bcep1808_7602"
FT   misc_feature    order(49455..49463,49479..49481,49533..49535,49539..49544,
FT                   49632..49634,49647..49652,49692..49700,49707..49709,
FT                   49716..49718,49761..49766,49863..49865,50169..50171,
FT                   50175..50177,50367..50369)
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Bcep1808_7602"
FT   misc_feature    order(49464..49466,49761..49763,49854..49856,49863..49865)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143412"
FT                   /locus_tag="Bcep1808_7602"
FT   gene            50465..51247
FT                   /db_xref="GeneID:4947633"
FT                   /locus_tag="Bcep1808_7603"
FT   CDS_pept        50465..51247
FT                   /locus_tag="Bcep1808_7603"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: rme:Rmet_1321
FT                   hydratase/decarboxylase"
FT                   /db_xref="GI:134287843"
FT                   /db_xref="InterPro:IPR002607"
FT                   /db_xref="GeneID:4947633"
FT                   /translation="MDKTQITQLGDALYQALTTRTVLDPLTERHPDMMIEDAYHIQQRM
FT                   IERRVQAGETIIGKKIGVTSAAVMNMLGVYQPDFGYMLDGMIYNEGQSIEIGTLIQPKA
FT                   EGEIAFILKKDLMGPGVTNADVLAATECVMPCFEIVDSRIRDWKIKIQDTVADNASCGV
FT                   FVLGDHAVDPRKLELTLCGMVMERNGEIIATGCGAAALGSPVNAVAWLANTLGRLGIAL
FT                   KAGEVILSGALAAMFPAKAGDSFRVSIGGLGGCSVRFH"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110008.1"
FT   misc_feature    50477..51241
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="Bcep1808_7603"
FT   gene            51326..52237
FT                   /db_xref="GeneID:4947634"
FT                   /locus_tag="Bcep1808_7604"
FT   CDS_pept        51326..52237
FT                   /locus_tag="Bcep1808_7604"
FT                   /gene_family="HOG000052149" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="catalyzes the formation of acetyl-CoA from
FT                   acetalaldehyde"
FT                   /db_xref="GI:134287844"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="GeneID:4947634"
FT                   /translation="MKKIKCALIGPGNIGTDLLAKLKRSSVLEPVWMVGIDPESEGLKR
FT                   ARELGVKTTAEGVDGLLPHVLADGVQIAFDATSAYVHAENARKLNALGVMMIDLTPAAI
FT                   GPYCVPPVNLKEHLGKREMNVNMVTCGGQATIPMVAAVSRVQPVAYAEIVATVSSRSVG
FT                   PGTRKNIDEFTRTTAGAVEKVGGARKGKAIIIINPAEPPLMMRDTIHCLTETEPDQQRI
FT                   TESIHAMIEEVQKYVPGYRLVNGPVFDGKRVTVFMEVAGLGDYLPTYAGNLDIMTAAAA
FT                   RTAEMFAEEMIAGNLTLEPVVA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110009.1"
FT   misc_feature    51326..52150
FT                   /note="acetaldehyde dehydrogenase; Validated; Region:
FT                   PRK08300"
FT                   /db_xref="CDD:169356"
FT                   /locus_tag="Bcep1808_7604"
FT   misc_feature    51338..51682
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcep1808_7604"
FT   misc_feature    51713..52126
FT                   /note="Prokaryotic acetaldehyde dehydrogenase,
FT                   dimerization; Region: AcetDehyd-dimer; pfam09290"
FT                   /db_xref="CDD:150078"
FT                   /locus_tag="Bcep1808_7604"
FT   gene            52257..53303
FT                   /db_xref="GeneID:4947635"
FT                   /locus_tag="Bcep1808_7605"
FT   CDS_pept        52257..53303
FT                   /locus_tag="Bcep1808_7605"
FT                   /gene_family="HOG000048047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-hydroxy-2-ketovalerate aldolase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of pyruvate and acetaldehyde
FT                   from 4-hydroxy-2-ketovaleric acid; involved in the
FT                   degradation of phenylpropionate"
FT                   /db_xref="GI:134287845"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="GeneID:4947635"
FT                   /translation="MNLQGKKITVHDMTLRDGMHPKRHLMTLEQMKSIACGLDAAGVPL
FT                   IEVTHGDGLGGSSVNYGFPAHSDEEYLGTVIPLMKQAKVSALLLPGIGTVDHLKMAKEL
FT                   GVHTIRVATHCTEADVSEQHIALARKLEMDTVGFLMMAHMNSPEGLVRQAKLMESYGAN
FT                   CVYITDSAGYMLPDDVRARLGAVRDALKPETELGFHGHHNLAMGIANSIAAVECGATRI
FT                   DAASAGLGAGAGNTPMEVLVAVCDRMGIQTGVDVWAIQDVAEDLVVPIMDFPIRIDRDS
FT                   LTLGYAGVYGSFLLFAKRAEQKYGVPAREILVELGRRGMVGGQEDMIEDTAITLAKARA
FT                   SKAQKVAA"
FT                   /protein_id="YP_001110010.1"
FT   misc_feature    52269..53279
FT                   /note="4-hydroxy-2-ketovalerate aldolase; Validated;
FT                   Region: PRK08195"
FT                   /db_xref="CDD:169272"
FT                   /locus_tag="Bcep1808_7605"
FT   misc_feature    52278..53069
FT                   /note="4-hydroxy-2-oxovalerate aldolase, N-terminal
FT                   catalytic TIM barrel domain; Region: DRE_TIM_HOA; cd07943"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Bcep1808_7605"
FT   misc_feature    order(52302..52307,52314..52316,52395..52397,52668..52670,
FT                   52674..52676,52764..52766,52851..52853,52857..52859)
FT                   /note="active site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Bcep1808_7605"
FT   misc_feature    order(52302..52307,52395..52397)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Bcep1808_7605"
FT   misc_feature    order(52305..52307,52851..52853,52857..52859)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163681"
FT                   /locus_tag="Bcep1808_7605"
FT   misc_feature    53073..53270
FT                   /note="DmpG-like communication domain; Region: DmpG_comm;
FT                   pfam07836"
FT                   /db_xref="CDD:149094"
FT                   /locus_tag="Bcep1808_7605"
FT   gene            53300..54088
FT                   /db_xref="GeneID:4947636"
FT                   /locus_tag="Bcep1808_7606"
FT   CDS_pept        53300..54088
FT                   /locus_tag="Bcep1808_7606"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: rme:Rmet_1318
FT                   hydratase/decarboxylase"
FT                   /db_xref="GI:134287846"
FT                   /db_xref="InterPro:IPR002607"
FT                   /db_xref="GeneID:4947636"
FT                   /translation="MKLDRATIARLAEHLENCELHAQDTLKITDEHPEMDWDDAYAIQD
FT                   EIRRRKLARGGKIVGLKAGLTSHAKMKQMGVESPVFGFMADYYAIPDGGTCKTEALIHP
FT                   KVEPEIAFVTKAPLKGPGCHIGAVLAATDFVMPGIEVIDSRYRDFKFDLKSVVADNTSA
FT                   ARFVVGGRALPVSEVDLRTVGIVLEKNGEPVAFGAGAAVLGHPAAAIAMLANHLGARGE
FT                   EIPAGSLILSGGITEAIAVRAGDAIALRVQGMGSTGLRFV"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110011.1"
FT   misc_feature    53300..54082
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="Bcep1808_7606"
FT   gene            54100..54291
FT                   /db_xref="GeneID:4947637"
FT                   /locus_tag="Bcep1808_7607"
FT   CDS_pept        54100..54291
FT                   /locus_tag="Bcep1808_7607"
FT                   /gene_family="HOG000077848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: rme:Rmet_1317
FT                   4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="GI:134287847"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="GeneID:4947637"
FT                   /translation="MPIAQLYIIEGRDAEKKERLIAEVTEAIHRAIDAPVESIRVLITE
FT                   MPKEHFGIAGQSARKRGR"
FT                   /protein_id="YP_001110012.1"
FT   misc_feature    54103..54273
FT                   /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
FT                   isomerization of unsaturated ketones. The structure is a
FT                   homohexamer that is arranged as a trimer of dimers. The
FT                   hexamer contains six active sites, each formed by residues
FT                   from three monomers, two from one...; Region:
FT                   4Oxalocrotonate_Tautomerase; cd00491"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Bcep1808_7607"
FT   misc_feature    order(54103..54108,54211..54213)
FT                   /note="active site 1"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Bcep1808_7607"
FT   misc_feature    order(54103..54123,54157..54159,54166..54171,54178..54180,
FT                   54190..54195)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Bcep1808_7607"
FT   misc_feature    order(54112..54114,54118..54120,54148..54153,54160..54165,
FT                   54172..54174,54205..54210,54214..54228,54232..54237,
FT                   54244..54270)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Bcep1808_7607"
FT   misc_feature    order(54118..54120,54250..54252)
FT                   /note="active site 2"
FT                   /db_xref="CDD:29603"
FT                   /locus_tag="Bcep1808_7607"
FT   gene            54351..54860
FT                   /db_xref="GeneID:4947638"
FT                   /locus_tag="Bcep1808_7608"
FT   CDS_pept        54351..54860
FT                   /locus_tag="Bcep1808_7608"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; KEGG:
FT                   rme:Rmet_1316 methane/phenol/toluene hydroxylase"
FT                   /db_xref="GI:134287848"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="GeneID:4947638"
FT                   /translation="MALLNRMDWYDLARTTNWSPKYVTESELFPPELSGDHGIPMEKWE
FT                   TYDEPYKQTYPEYVKVQREKDAGAYSVKAALERSQIYERSDPGWLTVMKQHYGAIALAE
FT                   YSASSAEARMMRFSKAPGMRNMATLGSMDEIRHGQIQLYFPHEHVSKDRQFFHFRKTDL
FT                   SLHHRT"
FT                   /protein_id="YP_001110013.1"
FT   misc_feature    54387..>54815
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:176577"
FT                   /locus_tag="Bcep1808_7608"
FT   misc_feature    order(54660..54662,54750..54752,54759..54761)
FT                   /note="dinuclear metal binding motif; other site"
FT                   /db_xref="CDD:153097"
FT                   /locus_tag="Bcep1808_7608"
FT   gene            55101..56087
FT                   /db_xref="GeneID:4947639"
FT                   /locus_tag="Bcep1808_7609"
FT   CDS_pept        55101..56087
FT                   /locus_tag="Bcep1808_7609"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rso:RSp1179 TIS1021-transposase protein"
FT                   /db_xref="GI:134287849"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:4947639"
FT                   /translation="MKRQISFAEAECTGKKRVTRRQRFLTEMNSVVPWARLLAALEPYY
FT                   PKGTRGRPPIGLERMLRIYFLQQWYGLSDEGLEDALYDSIAMRAFAGIDLAVENVPDAT
FT                   TLLKFRRLLLEHDLTRRLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAEKQRDP
FT                   EMHQTRKGNEWHFGMKAHVGVDADSGLVHSVVGTAANESDVSQAHALLHGHEAHAFGDA
FT                   GYTGVEKREEMQGATVKWHVAIKRGKIKTMREGALKDLLIAAERTKAQIRARVEHPFHV
FT                   IKNLFGHRKVRYKGLAKNTAQLFSLFGLANLVLAKKSLLASHGSSPS"
FT                   /protein_id="YP_001110014.1"
FT   misc_feature    55251..55478
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bcep1808_7609"
FT   misc_feature    55287..56066
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bcep1808_7609"
FT   gene            56301..56540
FT                   /db_xref="GeneID:4947640"
FT                   /locus_tag="Bcep1808_7610"
FT   CDS_pept        56301..56540
FT                   /locus_tag="Bcep1808_7610"
FT                   /gene_family="HOG000263372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287850"
FT                   /db_xref="GeneID:4947640"
FT                   /translation="MLRVIRGRQTMFDESNILTLGDAKHLQAWTNAWFEAAVELGFIRW
FT                   PYVPDKEVVKRLHGYFNAGLMPMEAAQACFAAKH"
FT                   /protein_id="YP_001110015.1"
FT   gene            56633..57463
FT                   /db_xref="GeneID:4947641"
FT                   /locus_tag="Bcep1808_7611"
FT   CDS_pept        56633..57463
FT                   /locus_tag="Bcep1808_7611"
FT                   /gene_family="HOG000028063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rme:Rmet_1306
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="GI:134287851"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4947641"
FT                   /translation="MSDSLEIANTVTANGIKTNYHDRGQGVPVLLIHGSGPGVTAWANW
FT                   RLTIPELAKQFRVIAPDMVGFGYTERPVGIRYDMDTWVGHALGLLDALGIDKAHVVGNS
FT                   FGGALALALAIRAPERVRRLVLMGSVGISFPITEGLDKVWGYVPSIDNMRELLDVFAFD
FT                   RNLVNDDLARLRYEASIRPNFQEAFSSMFPAPRQRWVDAMASREEDVGSLPHETLIIHG
FT                   REDQVIPLSNSYTLLRLIPRAQLHVFGRCGHWTQIEHGERFNRLVGDFFSEEAL"
FT                   /protein_id="YP_001110016.1"
FT   misc_feature    56681..57445
FT                   /note="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase;
FT                   Region: biphenyl_bphD; TIGR03343"
FT                   /db_xref="CDD:132386"
FT                   /locus_tag="Bcep1808_7611"
FT   misc_feature    56798..57439
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcep1808_7611"
FT   gene            57637..59472
FT                   /db_xref="GeneID:4947642"
FT                   /locus_tag="Bcep1808_7612"
FT   CDS_pept        57637..59472
FT                   /locus_tag="Bcep1808_7612"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-54 dependent trancsriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; 4-vinyl reductase,
FT                   4VR; Activator of aromatic catabolism; ATPase associated
FT                   with various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: rme:Rmet_1305 sigma-54 factor, interaction region"
FT                   /db_xref="GI:134287852"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:4947642"
FT                   /translation="MKEEKGKAGEIDRGIPLFVPDVVADLHFPDIRDLAERLRFNPADG
FT                   RIWLDDRRMVLIHTDAFASLRQELIEALGIDAARGLLTRMGYLSGSRDAALARKVRGQD
FT                   SAFDAFAVGPQLHALEGIVLVEPVRVDIDSTTGQYYGEFLWKDSSEDEAHISVYGIGSE
FT                   PACWMQIGYACGYTSAFMGRRILYREVECRAMGNTLCRIIGKPVEEWDAPDADLRYMLP
FT                   QSLEKRRFVELKSSGPAPTDSTDHECVPCKLDEVPVKEGPIGASAGFNAVMHKIFRVAP
FT                   TSATVLLMGESGVGKSLFARELHNRSSRVGKPFVELNCAAIPDSLIESELFGAERGAFT
FT                   GASDARVGRFESANEGTIFLDEIGTLSLTAQAKLLRVLQTGEMERLGSSKTVKVNVRVI
FT                   TATNDNLKQAIKSGRFREDLFYRLNVFPIFIPPLRERKDDIPVLLEFFIKKFSRRHGRP
FT                   LKGLSNRALHLLLDYSWPGNIREMENVLERGVILAEAGGTLDVCHLFSSDDTVECKGAF
FT                   GLSDLGSLVLDSISTSAPPETIGKSGEGPEGLEDWAALAVQMNKATLREVEDALVRAAL
FT                   KAANGNISEAARLLGLTRAQLDYRVKKSNSWLWCK"
FT                   /protein_id="YP_001110017.1"
FT   misc_feature    57733..58038
FT                   /note="Activator of aromatic catabolism; Region: XylR_N;
FT                   pfam06505"
FT                   /db_xref="CDD:115177"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58066..58254
FT                   /note="V4R domain; Region: V4R; cl08369"
FT                   /db_xref="CDD:158277"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58168..59445
FT                   /note="Transcriptional regulators containing an AAA-type
FT                   ATPase domain and a DNA-binding domain [Transcription /
FT                   Signal transduction mechanisms]; Region: PspF; COG1221"
FT                   /db_xref="CDD:31414"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58477..58932
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58504..58527
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    order(58507..58530,58717..58719,58843..58845)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58705..58722
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    58900..58902
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7612"
FT   misc_feature    59323..59445
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Bcep1808_7612"
FT   gene            59670..59903
FT                   /db_xref="GeneID:4947643"
FT                   /locus_tag="Bcep1808_7613"
FT   CDS_pept        59670..59903
FT                   /locus_tag="Bcep1808_7613"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rso:RSp0557 ISRSO16-transposase orfA protein"
FT                   /db_xref="GI:134287853"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4947643"
FT                   /translation="MTLSSRPGGHAVKKSKFTEEQITYALKQAELGTPVAEVCRKMGIS
FT                   DATFYNWRTKYGGLSPSELRRLKVSAQFSTPQ"
FT                   /protein_id="YP_001110018.1"
FT   misc_feature    59706..59885
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Bcep1808_7613"
FT   gene            complement(59949..60118)
FT                   /db_xref="GeneID:4947644"
FT                   /locus_tag="Bcep1808_7614"
FT                   /pseudo
FT   gene            60235..61404
FT                   /db_xref="GeneID:4947645"
FT                   /locus_tag="Bcep1808_7615"
FT   CDS_pept        60235..61404
FT                   /locus_tag="Bcep1808_7615"
FT                   /gene_family="HOG000068956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, mutator type; KEGG: bxe:Bxe_B0295
FT                   transposase"
FT                   /db_xref="GI:134287854"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:4947645"
FT                   /translation="MSKFTEKEVVGLSEVGLGLDDLVRQGARQVIQQAIEAELSALLER
FT                   FENVKTLHGQRAVVRNGYLPEREVLTAAGPIPVKVPKVRDRSGSGVKFNSLIVPPYVRK
FT                   SPRVSAALPWLYLKGISTGDMSEALSVLLGEDAKGLSANVVSRLKAQWADEHVNWSRRD
FT                   LSKSRYVYWWVDGIHTGLRSENSDGQCLLVIIGVRPDGRKEHVAIGDGYRESKASWQEL
FT                   LLDLKSRGLQAGPLLAVGDGAMGFWAALEEVFPATRGQRCWFHKMGNVLNALPKSQQGR
FT                   AKADLQAIWMAATRADAYTAFDRFVTVYEAKYPKATETLKKDRESLLAFYDFPAEHWQH
FT                   LRTAAGAIDLTSVTAAANEHLRAAAGAQEETARGQHPTGSIAFGHRRSP"
FT                   /protein_id="YP_001110019.1"
FT   misc_feature    60244..61263
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Bcep1808_7615"
FT   misc_feature    60814..61047
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Bcep1808_7615"
FT   gene            complement(61776..62042)
FT                   /db_xref="GeneID:4947646"
FT                   /locus_tag="Bcep1808_7616"
FT                   /pseudo
FT   gene            62346..63902
FT                   /db_xref="GeneID:4947647"
FT                   /locus_tag="Bcep1808_7617"
FT   CDS_pept        62346..63902
FT                   /locus_tag="Bcep1808_7617"
FT                   /gene_family="HOG000289215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bxe:Bxe_A1795 putative transposase"
FT                   /db_xref="GI:134287855"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4947647"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT                   /protein_id="YP_001110020.1"
FT   misc_feature    62763..63164
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7617"
FT   misc_feature    63120..63884
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="Bcep1808_7617"
FT   gene            63919..64668
FT                   /db_xref="GeneID:4947648"
FT                   /locus_tag="Bcep1808_7618"
FT   CDS_pept        63919..64668
FT                   /locus_tag="Bcep1808_7618"
FT                   /gene_family="HOG000113194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A1794 putative transposase-related
FT                   ATP-binding subunit"
FT                   /db_xref="GI:134287856"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="GeneID:4947648"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT                   /protein_id="YP_001110021.1"
FT   misc_feature    63919..64641
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    63985..64074
FT                   /note="IstB-like ATP binding N-terminal; Region: IstB_N;
FT                   pfam08483"
FT                   /db_xref="CDD:117060"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    64162..64590
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    64237..64260
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    order(64240..64263,64420..64422,64519..64521)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    64408..64425
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7618"
FT   misc_feature    64585..64587
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7618"
FT   gene            complement(64684..65817)
FT                   /db_xref="GeneID:4947649"
FT                   /locus_tag="Bcep1808_7619"
FT   CDS_pept        complement(64684..65817)
FT                   /locus_tag="Bcep1808_7619"
FT                   /gene_family="HOG000263373" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_2106 transposase"
FT                   /db_xref="GI:134287857"
FT                   /db_xref="GeneID:4947649"
FT                   /translation="MATLERTAYPRFPEVLARRELQACYTPLSDELEWARRSTRGERPR
FT                   LGLLVLLKVFQQLHYFPPLDTIPTAIIDHVRAAADIGGTVHFGYDTETSPTLFRHYAAV
FT                   RAYLDVKPVYGTDANAIATRAAHTASVTMDQPVDIINATIDELIARDIELPAFSTLDRL
FT                   TEQIHARAQSRLFKRVTRRLTDEQKLALDRLLARDLSSRQTAYNRIKRHAKRPSRQHLD
FT                   LLIDQVAWLDELGDFSLAIAGIPASKLRSLANQAMALDASALRNDTLPEKRYTLIVALL
FT                   NRMRVRARDDLADMFVRRMGAIHKRASDELDAIQRKQRDQVEDLVGLLDGVVDILADES
FT                   DETAIARAVRMRISAMVINRFGERDQSGRWCCAVNGL"
FT                   /protein_id="YP_001110022.1"
FT   misc_feature    complement(<64861..65811)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_7619"
FT   gene            65891..66208
FT                   /db_xref="GeneID:4947650"
FT                   /locus_tag="Bcep1808_7620"
FT   CDS_pept        65891..66208
FT                   /locus_tag="Bcep1808_7620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287858"
FT                   /db_xref="GeneID:4947650"
FT                   /translation="MIAAIFITIKPMIGICAYLVHPPEGFPCQPRKYLEEGSDHIRFGF
FT                   EHGGVYVTALYNTVSGRAFGEYELPRRKRKLDEKGIEFSTDDKLDGTPWFDALLSFLYV
FT                   A"
FT                   /protein_id="YP_001110023.1"
FT   gene            complement(66423..67751)
FT                   /db_xref="GeneID:4947651"
FT                   /locus_tag="Bcep1808_7621"
FT   CDS_pept        complement(66423..67751)
FT                   /locus_tag="Bcep1808_7621"
FT                   /gene_family="HOG000106819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_5544 transposase IS116/IS110/IS902"
FT                   /db_xref="GI:134287859"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:4947651"
FT                   /translation="MAMRKRDDDVVFPNAAGIDVGASSHWVAVPRHATDDPVREFGAMT
FT                   DDLHAVADWLLACGVDTVALESTGVYWIPVYEVLEQHGLTVWLVDARQMKYVPGRKSDV
FT                   LDCQWLQKLMSLGLLRGAFRPDHEVCVVRAVVRQREVLLGEQACWVQRMQKALVQMNLQ
FT                   LTEVLTDVMGMTGQAIIRDIVAGERDPKVLAQHRHGRVKANVADIQRALTGNWREEHLF
FT                   VLAQALAMFDSLAQRILECDAKIEALLAPLGCHEVELGGPGKRRGKNTPAFDLRTALAR
FT                   WAGVDLTRINGVAVTSVLTVLSEIGPDLSRFANVKHFCSWLGLCPGTKISGGKVLSART
FT                   RRSTNRVRQALKLAAMSLSRNRSALGAFYRRLCARMDKPRANTAVAHKLARMIYFMLTR
FT                   GEDYVDQGQQKYEEQQRQRSIAALRRRAADLGFAITPATVAPA"
FT                   /protein_id="YP_001110024.1"
FT   misc_feature    complement(67245..67517)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="Bcep1808_7621"
FT   misc_feature    complement(66642..66893)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Bcep1808_7621"
FT   gene            complement(68029..69366)
FT                   /db_xref="GeneID:4947652"
FT                   /locus_tag="Bcep1808_7622"
FT   CDS_pept        complement(68029..69366)
FT                   /locus_tag="Bcep1808_7622"
FT                   /gene_family="HOG000106819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_5544 transposase IS116/IS110/IS902"
FT                   /db_xref="GI:134287860"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:4947652"
FT                   /translation="MAMRKRDDEVVFPNAAGIDVGASSHWAAVPRHFAEQAGCEPVREF
FT                   GAMTDDLNALADWLLACGIDTVALESTGVYWIPVYEVLEQRGLKVWLVDARQLKYVPGR
FT                   KSDVQDCQWLQKLMSLGLLRAAWRPGSEVCVVRAVARQREVLLTEQASWVQRMQKALVQ
FT                   MNIQLTEVLSDVMGQTGQAIIRAIVAGERDPKILARHRHSRIKASAEEIIKALTGNWRE
FT                   EHLFVLGQALAMYDDIGRHLVECEAKLRELLAERSERRVDLGKAPKAGAKARMEFDVRQ
FT                   ALANWAGVDLTRINGLGVTVVMKLLSEIGPDLGRFANVKHFCSWLGLCPGTKISGGKVL
FT                   SSGTKRSANRARQALKMAAMSLSHSDSALGAFYRRLCARMDKPRANTATAHKLARMVYF
FT                   MLTRGEAFVDQGQQRYEEQQHQRSVASLRRRAAALGFQIHPVEVVA"
FT                   /protein_id="YP_001110025.1"
FT   misc_feature    complement(68848..69120)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="Bcep1808_7622"
FT   misc_feature    complement(68245..68496)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Bcep1808_7622"
FT   gene            69617..69934
FT                   /db_xref="GeneID:4947653"
FT                   /locus_tag="Bcep1808_7623"
FT   CDS_pept        69617..69934
FT                   /locus_tag="Bcep1808_7623"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6882 hypothetical protein"
FT                   /db_xref="GI:134287861"
FT                   /db_xref="GeneID:4947653"
FT                   /translation="MGLGSSEGVRGLPRCARHHRQVGRRLNSPSLLQETMMTTAYDLLL
FT                   DAPDTQVKRCQLAWKAIAVGNWRDAAHFLLNAAAEEGATAWATEARALAEACQVKANQD
FT                   A"
FT                   /protein_id="YP_001110026.1"
FT   gene            70430..70908
FT                   /db_xref="GeneID:4947654"
FT                   /locus_tag="Bcep1808_7624"
FT                   /pseudo
FT   gene            70994..71986
FT                   /db_xref="GeneID:4947655"
FT                   /locus_tag="Bcep1808_7625"
FT   CDS_pept        70994..71986
FT                   /locus_tag="Bcep1808_7625"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: net:Neut_2536 hypothetical protein"
FT                   /db_xref="GI:134287862"
FT                   /db_xref="GeneID:4947655"
FT                   /translation="MNQELKERIFAAADELYAENGEFPNVEAVRQRARAGMNYVVEALK
FT                   EWRQKQRMLVQSVREPLPAELHDAMTGFGNHIWEVAQRLANDALESARAAFEAEKNDLA
FT                   RLSTEQSEAYEVLAAEHDRTVEDFTRLQGRAAQLEEERSALADQLRAAQQEAHVAATET
FT                   REKAALVDRLEKDLERARAEVDGLREELNAARRELADERGKAATAETRHVAEREAMQRE
FT                   IDVLRGHEKEQSKELAESQRAVTRAEAERDKLTEQLSDVRKRTADEIHRALEKVQQREA
FT                   EAVQARKEARAAGEQLARTSGELDAAKAQLADLRTIIKDLSSTKRTPKA"
FT                   /protein_id="YP_001110027.1"
FT   misc_feature    71003..71362
FT                   /note="Plasmid replication region DNA-binding N-term;
FT                   Region: KfrA_N; pfam11740"
FT                   /db_xref="CDD:152176"
FT                   /locus_tag="Bcep1808_7625"
FT   misc_feature    <71240..>71956
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bcep1808_7625"
FT   gene            72010..72516
FT                   /db_xref="GeneID:4947656"
FT                   /locus_tag="Bcep1808_7626"
FT   CDS_pept        72010..72516
FT                   /locus_tag="Bcep1808_7626"
FT                   /gene_family="HOG000263374" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287863"
FT                   /db_xref="GeneID:4947656"
FT                   /translation="MENTLKRPMFQLSIGGLLGLGTISAIEARSWGSFLSTALMALYLF
FT                   AFAASRQAARASKPPIRLAGNIVTALCAVLLLGTFLLVAERIYLVNGSGYPQWLARDIG
FT                   AANYAELDRLHSTECKGESMEIYGKRSGQWVIRCGFTWIGGRTYISSTNPYGHMLDDIK
FT                   PEGKQ"
FT                   /protein_id="YP_001110028.1"
FT   gene            72513..73196
FT                   /db_xref="GeneID:4947657"
FT                   /locus_tag="Bcep1808_7627"
FT   CDS_pept        72513..73196
FT                   /locus_tag="Bcep1808_7627"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287864"
FT                   /db_xref="GeneID:4947657"
FT                   /translation="MSTLRRFFIDYLMVPLGIPLVCAAASVYHVSKETTATGYATLAMA
FT                   WPHLHQSTRDAIVSAMRGDGGRISQWEFVRLSDLALRDAGALELPIAGDDVSLQRERLV
FT                   RTMTDTAPAGAILRATSFKCMPLQTVSALLDMRDNTAVQCSTMSDVADSTGRVLIARKA
FT                   QLFGWKKGTSVEWTSWTTNDGIVVGEKVLHGVAFTSALQPTPDESLTVMALHDISVPSL
FT                   AAPAN"
FT                   /protein_id="YP_001110029.1"
FT   gene            73201..73506
FT                   /db_xref="GeneID:4947658"
FT                   /locus_tag="Bcep1808_7628"
FT   CDS_pept        73201..73506
FT                   /locus_tag="Bcep1808_7628"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone-like nucleoid-structuring protein H-NS"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B1226 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:134287865"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947658"
FT                   /translation="MPSSRPTTYQRLLTELAELDVRIEQARARERVRAIETIHELMDTY
FT                   GIKHRDLVGRNGRRGSYQVSALPAKYRDPATGREWCGRGNVPLWIRGKDRTRFLID"
FT                   /protein_id="YP_001110030.1"
FT   misc_feature    73228..73497
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep1808_7628"
FT   gene            73518..74528
FT                   /db_xref="GeneID:4947659"
FT                   /locus_tag="Bcep1808_7629"
FT   CDS_pept        73518..74528
FT                   /locus_tag="Bcep1808_7629"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mgm:Mmc1_2079 hypothetical protein"
FT                   /db_xref="GI:134287866"
FT                   /db_xref="GeneID:4947659"
FT                   /translation="MSEEVQRLNYSTHALEQFEQLIPTIRRDMPGMRAGFEAVTHLLRL
FT                   SVKYLLPNCAELIDVSELRQVHIDSMRLPHPVAALEAPWVLPDGEGGDKGNLRCPKRIA
FT                   LCVELDEDVARLLPGTEHLLDEPDGGVCVIPIYWTEAGQWQLAPGGAFVPHSNELSAYV
FT                   PEQADERTRLLNEPLREAGLSARKMRQFQVSAFVILPEQYEFLVTQLGSLRVAHSETLA
FT                   NARDDILALIQTGCVVNCSNIETPTLEAPAKLNKKRQQNGKVPFFDYRVLALRPTKAGD
FT                   GQGRGGQHASPRAHIRRGHIRRLEHKTVWVSDTLVNAGSARGVVVKDYAVRPLKP"
FT                   /protein_id="YP_001110031.1"
FT   gene            complement(74536..75201)
FT                   /db_xref="GeneID:4947660"
FT                   /locus_tag="Bcep1808_7630"
FT   CDS_pept        complement(74536..75201)
FT                   /locus_tag="Bcep1808_7630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A2573 hypothetical protein"
FT                   /db_xref="GI:134287867"
FT                   /db_xref="GeneID:4947660"
FT                   /translation="MLDVEASFEKLLGRQPTEREVQSLYRVKNALNIRDNDALWLVLMA
FT                   LESYDALYRKYPAMISDHVGKILDEQRVAMAAIADAETKKALGTLADAVSKTSEQVAVR
FT                   LVDASRWLSWGWAWFAFAAFGTLCVFVGFVLGSGRLPYWAVPTAGDGPLTMILGALART
FT                   PAGWLAAAGGAAAAVGAAWRARDDLRAGRRLGLLAGCIGLLAASAAFLWPLVAAVKLF"
FT                   /protein_id="YP_001110032.1"
FT   gene            complement(75194..75874)
FT                   /db_xref="GeneID:4947661"
FT                   /locus_tag="Bcep1808_7631"
FT   CDS_pept        complement(75194..75874)
FT                   /locus_tag="Bcep1808_7631"
FT                   /gene_family="HOG000263160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C0474 hypothetical protein"
FT                   /db_xref="GI:134287868"
FT                   /db_xref="GeneID:4947661"
FT                   /translation="MKPIYMVGGSKGGVGKSAVSIGVIDTLQARSEKILLIESDTSNPD
FT                   VWKMYKGEVKAELINLDEANGWIDLVNVCHENSDAVVVVNTAARNNKGVAAYGETLNST
FT                   LGELGRKLVTLWVINRQRDSLELLKEYMESLPGSAIHVVRNTYFGDEQKFELYNTSKTR
FT                   KAVEDNGGKSVNLPDLADRVSDDLYSKRLSISAAMKELPIGNRAELTRWRNEVRKALGE
FT                   VLDA"
FT                   /protein_id="YP_001110033.1"
FT   gene            complement(75888..76325)
FT                   /db_xref="GeneID:4947662"
FT                   /locus_tag="Bcep1808_7632"
FT   CDS_pept        complement(75888..76325)
FT                   /locus_tag="Bcep1808_7632"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287869"
FT                   /db_xref="GeneID:4947662"
FT                   /translation="MKYTVGQIKLMLDELDKEFPEIDENERAADRAQTIKLMAGVVNEW
FT                   LTRGYSYAQIAEKLRMKGFIRISEKALRQAATQPKRRRKAVTPKPSEKGEARAKTSIDQ
FT                   GSESAVKAAKAQTPKAQAKEEASEPSQRSGGFTPRADSDDI"
FT                   /protein_id="YP_001110034.1"
FT   gene            76614..76874
FT                   /db_xref="GeneID:4947663"
FT                   /locus_tag="Bcep1808_7633"
FT   CDS_pept        76614..76874
FT                   /locus_tag="Bcep1808_7633"
FT                   /gene_family="HOG000263375" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mobilization protein MobB"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_1092 mobilization protein MobB"
FT                   /db_xref="GI:134287870"
FT                   /db_xref="GeneID:4947663"
FT                   /translation="MVRVTPEQLATLREKANDSGVTVPEYLRACGLGRPTRSKMEAHIV
FT                   NELRRLGGLQKHLFTEGGGVLSKEFAAVLVEIRAAIARVGE"
FT                   /protein_id="YP_001110035.1"
FT   misc_feature    76617..>76781
FT                   /note="conjugal transfer relaxosome component TraJ;
FT                   Provisional; Region: PRK13877"
FT                   /db_xref="CDD:172397"
FT                   /locus_tag="Bcep1808_7633"
FT   gene            77505..79094
FT                   /db_xref="GeneID:4947664"
FT                   /locus_tag="Bcep1808_7634"
FT   CDS_pept        77505..79094
FT                   /locus_tag="Bcep1808_7634"
FT                   /gene_family="HOG000263376" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="relaxase/mobilization nuclease family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: pst:PSPTO_1093 relaxase/mobilization nuclease domain
FT                   protein"
FT                   /db_xref="GI:134287871"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="GeneID:4947664"
FT                   /translation="MKAVAAQNPRVKDPVYHIVLAWQPSESPTDQEMFEAGQHALAAVG
FT                   MVDHQYVFAVHRDTQHVHLHMAVNRVNPDTFAAIYPERDYFKLDRAMRELELKYGWNHS
FT                   NGPFAVFERNGQTVIDWASKDPNTKGKRPTRAADMERHADQESLFSYARGEPRKALLAA
FT                   LKNDKLTWRQLHNLLAKFGLELREKGQGFAIYDLNSSDTTPIKASDMHEALGKSRLEKR
FT                   LGPFEASTSTTDAILTYDKQRPLKRDPRVREERRQARADARRDLRARYEEYKKGFVYRR
FT                   LDPADVRARFAAIRADARQRRLEVRQTVSDLAARQALYSVIAFETLRARDRLQREIRKE
FT                   RQALRDDQSNRRQSYREWVERQAAAGDTAAISQLRGFAYSEKRLAKELERALANDGADG
FT                   IIHPDDADPAARDIAEGVYYRVRRDGTVVYRLDDGRDAFVDLGRRIDVLAKGEADTAAI
FT                   AAALQLAGEKYGGTFELTGSEEFKRRAIDVMLEYKIDVRLKDAAQEALRRARAAEIARA
FT                   SRDAKARQQRRK"
FT                   /protein_id="YP_001110036.1"
FT   misc_feature    77505..78182
FT                   /note="Relaxase/Mobilisation nuclease domain; Region:
FT                   Relaxase; cl01584"
FT                   /db_xref="CDD:174650"
FT                   /locus_tag="Bcep1808_7634"
FT   misc_feature    <78441..>78632
FT                   /note="conjugal transfer relaxase TraI; Provisional;
FT                   Region: PRK13878"
FT                   /db_xref="CDD:172398"
FT                   /locus_tag="Bcep1808_7634"
FT   gene            79169..79618
FT                   /db_xref="GeneID:4947665"
FT                   /locus_tag="Bcep1808_7635"
FT   CDS_pept        79169..79618
FT                   /locus_tag="Bcep1808_7635"
FT                   /gene_family="HOG000263377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraH protein, putative"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0050 TraH protein, putative"
FT                   /db_xref="GI:134287872"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947665"
FT                   /translation="MPRYTVAGLLIGLALTGCATQPKTDNAQIEIDRQILDASQKIQSA
FT                   QADLYQAGALNQPTTKVPVSIVDDQHRVTLSWQGDALQLLNKLAHDRGLAFSFMGVRMP
FT                   LPVNIDVKDASYDAVMQMVRAQIGYRADVTQYPDKLVLQYNRPQS"
FT                   /protein_id="YP_001110037.1"
FT   sig_peptide     79169..79228
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.508 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_7635"
FT                   /product="hypothetical protein"
FT   gene            79633..80658
FT                   /db_xref="GeneID:4947666"
FT                   /locus_tag="Bcep1808_7636"
FT   CDS_pept        79633..80658
FT                   /locus_tag="Bcep1808_7636"
FT                   /gene_family="HOG000263378" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0051 TraI protein"
FT                   /db_xref="GI:134287873"
FT                   /db_xref="GeneID:4947666"
FT                   /translation="MKRFVVAAIPLLVAGMAHAAETPAPAAASAPQAQSPAAASSASVP
FT                   TAQAPAVPSPEVQAATPAPEEQPITLDSLLNPPSQASTGLSDLRVQMLTDAGKTVGFRG
FT                   GMAARARVLRDALNARAERLDTIFQFSPLINRNGTIPPVIVEARDLSSFSPDQIRTANR
FT                   VYKIEREERFVSVPPTWRDYLFVGLPIKGGVDLPTFETRPKDGKEEAVWRDAVKKGWDA
FT                   GEQQADAILAANFNRLTRDYTGMLRYSTLVQEGMISTTRVAESRQTVTGDGRQLMLGDT
FT                   LRRVTSRATFETNPNNWRPTVNRGEQPAPKVAPVPQSAVVPATEPPATQIEGRPQGDDG
FT                   K"
FT                   /protein_id="YP_001110038.1"
FT   sig_peptide     79633..79692
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_7636"
FT                   /product="hypothetical protein"
FT   gene            80655..81818
FT                   /db_xref="GeneID:4947667"
FT                   /locus_tag="Bcep1808_7637"
FT   CDS_pept        80655..81818
FT                   /locus_tag="Bcep1808_7637"
FT                   /gene_family="HOG000263379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid transfer ATPase TraJ"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: plasmid transfer ATPase TraJ; PFAM: type II
FT                   secretion system protein E; KEGG: pst:PSPTO_B0052 type IV
FT                   pilus biogenesis protein"
FT                   /db_xref="GI:134287874"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR013364"
FT                   /db_xref="GeneID:4947667"
FT                   /translation="MSDLVQFEPYDFRGDVTAHTFKQFLKYCADYGASDILVQGGDYAW
FT                   VEIHGRQRQASTHTIKQGHLSNLISTVWQAEVENNVRAGHGADRSLELAGEELGIDRGK
FT                   FLRFRCNFIQGRVARYDMAYAVTMRLIPFDLPDITKMGIEQELFEAFYPGMGLVLVCGP
FT                   TGSGKTTLQSAVYGYAGIHMPDRKVITYEDPIEFVLGGPHWKGPQPHQAQIGRDIESFA
FT                   TGLRNAMRRKPSIIGIGEMRDLETIDAAIEAGLTGHLTYGTMHTESCAETINRAIQVYP
FT                   PQQQSAVASRLLGCLRVIVVQRLLKTTDGKRVAVREFVIFDRDFKNELQSQPYDQWAPM
FT                   IRARLESEKATLDDKAWALYEAGRIDKSEFIELAGHKAFRIRSQEAA"
FT                   /protein_id="YP_001110039.1"
FT   misc_feature    80712..81776
FT                   /note="Tfp pilus assembly protein, pilus retraction ATPase
FT                   PilT [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]; Region: PilT; COG2805"
FT                   /db_xref="CDD:32636"
FT                   /locus_tag="Bcep1808_7637"
FT   misc_feature    81117..81716
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7637"
FT   misc_feature    order(81138..81143,81153..81161)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7637"
FT   misc_feature    order(81141..81143,81153..81161,81222..81224,81228..81233,
FT                   81369..81374)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7637"
FT   misc_feature    81357..81371
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7637"
FT   gene            81857..82084
FT                   /db_xref="GeneID:4947668"
FT                   /locus_tag="Bcep1808_7638"
FT   CDS_pept        81857..82084
FT                   /locus_tag="Bcep1808_7638"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraK protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0056 TraK protein"
FT                   /db_xref="GI:134287875"
FT                   /db_xref="GeneID:4947668"
FT                   /translation="MLGIPCIAYMPIFVWLFHMRWWSFWTAIGVIVFFAVLAKFGLSFK
FT                   VLWQKFLHLLRGSRIYARPWWYRNRFQDHD"
FT                   /protein_id="YP_001110040.1"
FT   gene            82090..82758
FT                   /db_xref="GeneID:4947669"
FT                   /locus_tag="Bcep1808_7639"
FT   CDS_pept        82090..82758
FT                   /locus_tag="Bcep1808_7639"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p1B345 hypothetical protein"
FT                   /db_xref="GI:134287876"
FT                   /db_xref="GeneID:4947669"
FT                   /translation="MKKKELRRLPVDIALPQRVLLENGTMFAAFENLEDLEVFWLANRF
FT                   PFACESAESAEGQAVFLRPGEWVFGPSKAAVVKTAMRWDEWGIRCEYQNYGNDEFIDGW
FT                   LADLTIDRSKRIANGTWTEGDELKYTRRSSKQFPGCWRLTNLPNGFDAEDWLTNDFNVE
FT                   GTLDDPRTPIGQVVTALQEATFDDWGEHNSQVLSFYDQYGVDRCIDYLREEAALGYAYP
FT                   "
FT                   /protein_id="YP_001110041.1"
FT   gene            82778..82996
FT                   /db_xref="GeneID:4947670"
FT                   /locus_tag="Bcep1808_7640"
FT   CDS_pept        82778..82996
FT                   /locus_tag="Bcep1808_7640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287877"
FT                   /db_xref="GeneID:4947670"
FT                   /translation="MTLQRIYTSNARAADVRNLERQVTTSPRARASSIYEITRDRAVWR
FT                   VPVPGQSDRYMSASAGHVGDDHFQDHE"
FT                   /protein_id="YP_001110042.1"
FT   gene            83007..83333
FT                   /db_xref="GeneID:4947671"
FT                   /locus_tag="Bcep1808_7641"
FT   CDS_pept        83007..83333
FT                   /locus_tag="Bcep1808_7641"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287878"
FT                   /db_xref="GeneID:4947671"
FT                   /translation="MSTPFTPMDVIADLDQVHEHLVSSGHTSDASIVLQAAIRTIELIA
FT                   RVDTLTRFQLRGMEGLSLKERAELLAKVDAMSRAQRAIVGHGDVLAREAREILEAVAPS
FT                   RRGD"
FT                   /protein_id="YP_001110043.1"
FT   gene            83333..83935
FT                   /db_xref="GeneID:4947672"
FT                   /locus_tag="Bcep1808_7642"
FT   CDS_pept        83333..83935
FT                   /locus_tag="Bcep1808_7642"
FT                   /gene_family="HOG000267272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7581 hypothetical protein"
FT                   /db_xref="GI:134287879"
FT                   /db_xref="GeneID:4947672"
FT                   /translation="MLERIRLSIARASELRNLERQVATSPRARACSIHEITRNRAVWRV
FT                   PVPSQPGRYMSASAGHVGDEMFAVHVDADAFYLAWLRSDEQCVVRAQRPRDYKYAYAVD
FT                   GFAQGSANPVPLADVGAWNDERGRTRIGFTNGITRSFWLIANRAPSFPVQVYGRESAEL
FT                   LHRTAGATQGPICYADLFTSAAPRSAPVRALSRAPRP"
FT                   /protein_id="YP_001110044.1"
FT   gene            complement(84096..84584)
FT                   /db_xref="GeneID:4947673"
FT                   /locus_tag="Bcep1808_7643"
FT   CDS_pept        complement(84096..84584)
FT                   /locus_tag="Bcep1808_7643"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0058 TraL protein"
FT                   /db_xref="GI:134287880"
FT                   /db_xref="GeneID:4947673"
FT                   /translation="MKIFVRALFVLLLCSAAGVQAATCRSGSAAAAGSQSGYERDKQAA
FT                   QQTAQSERSSSDILGKCVGGITSVLTAPQFPSLSDIFDQIKNKVCQIASDQVNGVVNDV
FT                   NGQISGVMNGINGQINNAVNGTGAGQVIGSVPQLSGPSLQQTSAGSSQSSTFWSNIWK"
FT                   /protein_id="YP_001110045.1"
FT   sig_peptide     complement(84519..84584)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.714 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7643"
FT                   /product="hypothetical protein"
FT   gene            complement(84621..87116)
FT                   /db_xref="GeneID:4947674"
FT                   /locus_tag="Bcep1808_7644"
FT   CDS_pept        complement(84621..87116)
FT                   /locus_tag="Bcep1808_7644"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTOA0049 DNA primase, putative"
FT                   /db_xref="GI:134287881"
FT                   /db_xref="GeneID:4947674"
FT                   /translation="MSAESEALMQQFRQAVYERLVNPGTGSQLSPEGAIEQRSIAFRDW
FT                   RIATQNANESVELAPDFVRHWAVADLTSWREMPGDRHDIAAEDIFQNLSANVSYAEILQ
FT                   TIDAGMVDRVKSLAAENERRSAEKEARKAREFEDSRAALLAEQQAALRIAESFNGSGHI
FT                   PDEEWARLGRAVDHVYLGGDRADLGAALELASAMARVDTSRPCPFPDSPVQRAFEGERA
FT                   YQASKGAANHEQVIDDLALRAGNEGDPAPRYVLERRQAVEHYAFGLELRIEALRAAGAD
FT                   AVALRETQERLAVAHARAKELADDAPASTPTDTERVEQEAPAKAGGDSEAAKSVSPTEP
FT                   SAPVQSEATKSPTVEEADGFAGGTDADADDKPFDPELAISKLLESVTYKAQKDGSVLYM
FT                   VSERPAFIDHGQQIVMADKANEDEEAILAAVLLAKEKYGGAFELTGSEAFQRRAIEIML
FT                   KHKVDVTLKNPQQDALRRELAKAKPEASEKQEAAKAAAPEPRIGKPAAEEPSTDTTAAA
FT                   NSPSDTPVEAPQGRLAADLVPIRALDWWTVQREAIHVWAKTDLELRADFDALGPQPSPD
FT                   LVYWFDKAGKPCEAPADAGAYLASVNPEVPGFSDGSQSELRARVAMSSAESRAEVVSDI
FT                   NEKELGMATSDNSAEKEPHAVIRSVKKLDNGEWDTNVLLFKGKGDFLQGFIKVGDEKRH
FT                   VIAHLNERKPDQETGEIKPNFITLTEAQNTGDETTWKQIGYGNAVNRRTDNKPVYFDEV
FT                   LFSVGNQLVGGRVTRHCDDELHRKLGFIEDRKPRPPKEDNKSSANKEDTSPKPTAPAAK
FT                   PKEDAAGAPKARRSSRAKA"
FT                   /protein_id="YP_001110046.1"
FT   gene            87327..87866
FT                   /db_xref="GeneID:4947675"
FT                   /locus_tag="Bcep1808_7645"
FT   CDS_pept        87327..87866
FT                   /locus_tag="Bcep1808_7645"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287882"
FT                   /db_xref="GeneID:4947675"
FT                   /translation="MNVDMRNEQLQPICGTDLERWRIENGLTKVAAADAFGLQKAKWEE
FT                   LTSAENSAKQIADPVVAMLLHLYRQYPESAPVQLPPDVKEFYDYLGLQDTPQDRDKFAT
FT                   LIGRSPPSVYRLLLHDGKPGRPVMRWIEAVRRLKLTPKKTLRLMADVVSSVGDRQHVEK
FT                   VLIQGWTKQGDTGEHE"
FT                   /protein_id="YP_001110047.1"
FT   gene            88030..88548
FT                   /db_xref="GeneID:4947676"
FT                   /locus_tag="Bcep1808_7646"
FT   CDS_pept        88030..88548
FT                   /locus_tag="Bcep1808_7646"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287883"
FT                   /db_xref="GeneID:4947676"
FT                   /translation="MAARAYADKNRLQFTVIDLLVKLDQKQNPLMMKPEDLPQHDFITF
FT                   QRLSRSMTDELGGILKQQLEREGGDTSALDPSKPHLLLMQRPDLIAAVINEPGWEHMKV
FT                   VTYPAKIALSEKPLNVGTVPFRHWDSIQKATCRLNPNIQITLDPPGQRAKDAPASAPPS
FT                   DRPRGPRMK"
FT                   /protein_id="YP_001110048.1"
FT   gene            89029..89352
FT                   /db_xref="GeneID:4947677"
FT                   /locus_tag="Bcep1808_7647"
FT   CDS_pept        89029..89352
FT                   /locus_tag="Bcep1808_7647"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287884"
FT                   /db_xref="GeneID:4947677"
FT                   /translation="MNDRAPIFFFDKLAALADFTTFDVRATEEGGMPVSWSVVGILPNG
FT                   EIWPVLTDLLTEQHAQMVVSLCELAAIAPDVVRALNTLPRQKLSGHYGDTYELVAALER
FT                   ITR"
FT                   /protein_id="YP_001110049.1"
FT   gene            89416..90006
FT                   /db_xref="GeneID:4947678"
FT                   /locus_tag="Bcep1808_7648"
FT   CDS_pept        89416..90006
FT                   /locus_tag="Bcep1808_7648"
FT                   /gene_family="HOG000263380" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287885"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947678"
FT                   /translation="MLRRITTAAVARHVAAAAAVLALSCALTACDADQQPPKLPESVFN
FT                   QKLTDEVRSKWTLPPDVDRMLCWPEHRMLGGDRVACTVTLRGRAVSDMSTPVIRWEIPL
FT                   RAPSPWDDPYSNDYLDPSFDIKLLDWTSFKMVLTNIPQGVVSVGLIVDESRVPFKDAQM
FT                   FVLDVTDAVSRAMFAELNRARAAAPDAIRDTWR"
FT                   /protein_id="YP_001110050.1"
FT   sig_peptide     89416..89505
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.653 at
FT                   residue 30"
FT                   /locus_tag="Bcep1808_7648"
FT                   /product="hypothetical protein"
FT   gene            complement(90066..90626)
FT                   /db_xref="GeneID:4947679"
FT                   /locus_tag="Bcep1808_7649"
FT   CDS_pept        complement(90066..90626)
FT                   /locus_tag="Bcep1808_7649"
FT                   /gene_family="HOG000222239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthases and related enzymes-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_1481
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes-like protein"
FT                   /db_xref="GI:134287886"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:4947679"
FT                   /translation="MMQRRFFRSLIAAAALAVASTGSFGAQPLPAGAGYDLGFSPASGS
FT                   ASALDVVLRAIDSARSSIVVVAYSFTSKPIATALLAAHRRGVKVAVVADRGQNAKSYSA
FT                   VWFLANQGVPVRLNDRYEATHDKFMVVDGMHVETGSFNYSSAAANRNAENALVLWNVKP
FT                   LADRYGAEWARLWQEGVELKPAY"
FT                   /protein_id="YP_001110051.1"
FT   sig_peptide     complement(90549..90626)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7649"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(90078..90521)
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7649"
FT   misc_feature    complement(order(90168..90170,90201..90203,90207..90209,
FT                   90246..90248,90252..90254))
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7649"
FT   misc_feature    complement(order(90201..90203,90207..90212,90231..90233,
FT                   90246..90248,90252..90254))
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Bcep1808_7649"
FT   gene            complement(90646..91947)
FT                   /db_xref="GeneID:4947680"
FT                   /locus_tag="Bcep1808_7650"
FT   CDS_pept        complement(90646..91947)
FT                   /locus_tag="Bcep1808_7650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287887"
FT                   /db_xref="GeneID:4947680"
FT                   /translation="MTQILIGHDFWKLRDSTSGAGKTHWIRQFVTGMPDDVEIDIFDYH
FT                   GDIEIEGAKTVLFSEATRYGYNPLVLNTDPHYGGVRRAVNDVIEAINSTARQLGGNQEG
FT                   VLRHLLTDSYMMKGIFADNPRSWARREASEAEIREMMEARNWSGLREVYPTLGDVIGFA
FT                   KRKLKALWMGIEDKDNGRAALTAFDEYCRSMAAVNQLRTKLAKSGAKDDEDMERLQKRM
FT                   EAAKAKAFDTHATFLNSLENGREFEEAMRYNSKDVLLSVITRLENLNATGIFNPNPPPF
FT                   GNARVRRYVLKPLAQSEDELKMFVRFRMRAIIREMMQRGESGGKLRRLIVLDESKKFND
FT                   EDASNPINVVVNEMRKFGLAILLAGQSPAHFSSDFIKNAGTLLLLNLATADWDEAARKL
FT                   KIEVKDLKYLKPQETGAVRMLEKGQSASFRQVRF"
FT                   /protein_id="YP_001110052.1"
FT   gene            complement(91959..94175)
FT                   /db_xref="GeneID:4947681"
FT                   /locus_tag="Bcep1808_7651"
FT   CDS_pept        complement(91959..94175)
FT                   /locus_tag="Bcep1808_7651"
FT                   /gene_family="HOG000263381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0076 TrbC protein"
FT                   /db_xref="GI:134287888"
FT                   /db_xref="GeneID:4947681"
FT                   /translation="MALDPNHEIDSSRLTVDTRSAEQRFFAALYRPSTFSNVLVLFVGL
FT                   QIYLPALWPVWVILLWMMVMSFQDQKFQMPLRMPKDVGGLDRTDYYEELVEENMLWGFV
FT                   RRSKTLRKYLVAGGILYLGFMRSRALHDQGRELWLTNSDARTHMFVDGTTGSGKSETLM
FT                   GTFHNAICWGSGACYGDGKADSNLAFCLWSLSRRHGREDDFLILNYLTGGMDPFQRMVD
FT                   EELGRFADRAVLAQSNSMNPFGDGSADFLLQLMASLLPRASGDGAQWQQKALNMIDALL
FT                   RTLCYKRAKGELDISIGVIRHYLALQNLVQFYIEGREGKIPELAFLPIKAYFETGLPGF
FT                   NPAQAHDPTQWDPEVFNQHGYLTGQFARTLSMMMDTYGFIFADKYPEIDMLDVLLNNRL
FT                   LVVMIPSLEKSASEAASLGKLYISSIRLMMAQNLGYRLEGTKAEVLDSKATNAPNPSVI
FT                   ISDELAYYFAEGIAVMFAQARSLGFMMIAAVQDVQGLKRGEASEESASMIANTKVKWTL
FT                   ALEDPEDTFELIKKAGGDAYYSVLSGHDATVGTFTTSNQAQAQSSVERREKITLNELKK
FT                   LNSGEGFVIFKDAVVPSASYYIPDEHKKTSKLRARINRFLQIERPQFKRLPRSAEKISS
FT                   ADVHSADYIFAQLRRSEKPYYPSLDDPILSAVVGAAAHMNDIQRFEVTPTERGIVLFEA
FT                   ARKAMKQAEAAGRTGYMHDPRHDDPDELIPMDDDDDIPESAFDE"
FT                   /protein_id="YP_001110053.1"
FT   gene            complement(94228..95508)
FT                   /db_xref="GeneID:4947682"
FT                   /locus_tag="Bcep1808_7652"
FT   CDS_pept        complement(94228..95508)
FT                   /locus_tag="Bcep1808_7652"
FT                   /gene_family="HOG000014483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA primase"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_2387 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="GI:134287889"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR006647"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="GeneID:4947682"
FT                   /translation="MAKYIRFSDEFLERIRGETDLPALIERDVKLKRAGQDFVACCPFH
FT                   EEKTPSFRVSADKNTYRCWGCGARGDAIEWMRNKHHLSFQDAVVHLAGVSGIPLPVEER
FT                   DSDEDKAQRKRLAGLYQALKEAARVFSRGLAKSPAARAYLEQKRGLSAETIERFGLGVV
FT                   AKGVVELLGGSTSREALLGSGLAAQRDDGEIYDRFRHRIMFPIHNESGNLVGFAGRSMI
FT                   EKPDKTPKYVNCPETEIFHKGRELYALHLAKPAIRSGRVAVIVEGYFDVISLHQAGDER
FT                   AVAPMGTALTNLQVRRLLVHADTIVFAFDGDAAGRKAALGAAAVLLDEMKDGKTARFLF
FT                   LPEGEDPDSFVRAHGLEAWHAATEQAAPLSAFLADYVAHGLDRDVPESQVKAAEKAKAI
FT                   LARIQHAELFGRAMKAKFEEVVGVALD"
FT                   /protein_id="YP_001110054.1"
FT   misc_feature    complement(94300..95493)
FT                   /note="DNA primase, catalytic core; Region: dnaG;
FT                   TIGR01391"
FT                   /db_xref="CDD:162334"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(95200..95487)
FT                   /note="CHC2 zinc finger; Region: zf-CHC2; cl02597"
FT                   /db_xref="CDD:141551"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(94750..95103)
FT                   /note="DNA primase catalytic core, N-terminal domain;
FT                   Region: Toprim_N; pfam08275"
FT                   /db_xref="CDD:149368"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(<94582..94731)
FT                   /note="TOPRIM_DnaG_primases: The topoisomerase-primase
FT                   (TORPIM) nucleotidyl transferase/hydrolase domain found in
FT                   the active site regions of proteins similar to Escherichia
FT                   coli DnaG. Primases synthesize RNA primers for the
FT                   initiation of DNA replication. DnaG...; Region:
FT                   TOPRIM_DnaG_primases; cd03364"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(order(94699..94701,94708..94713))
FT                   /note="active site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(94711..94713)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7652"
FT   misc_feature    complement(order(94651..94653,94681..94686,94702..94707))
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7652"
FT   gene            complement(95517..96464)
FT                   /db_xref="GeneID:4947683"
FT                   /locus_tag="Bcep1808_7653"
FT   CDS_pept        complement(95517..96464)
FT                   /locus_tag="Bcep1808_7653"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sec:SC096 TrbB"
FT                   /db_xref="GI:134287890"
FT                   /db_xref="GeneID:4947683"
FT                   /translation="MKSNDIIRPFEKSLFVQFGSTGELQHVSTLRLDQGVTFIRSGNTI
FT                   EARYHDGAGEALVVERFSSESLATTAFQNLQAALKRYARVRRFAGFWKAAIKWGFAPLM
FT                   VAVLGLAVNMAATRAVGGSPAGGIGAAGAASMVPLPNNLGALQQPIARPAVASPAQLAQ
FT                   AMADGAKSGKYAVQFSKGNKGTLYVFSDPSCPHCQDLEPELDKLAKDYTIYIFPVTVIG
FT                   GEASSHRTAKLMCAKPEARAALWKKIVQGDDLPNAECADGSDAVARNDQMFRVMRFLGT
FT                   PTIINAAGEQTPDSIPNTADAINQWMSAAATARK"
FT                   /protein_id="YP_001110055.1"
FT   misc_feature    complement(95544..96035)
FT                   /note="DsbA family, DsbC and DsbG subfamily; V-shaped
FT                   homodimeric proteins containing a redox active CXXC motif
FT                   imbedded in a TRX fold. They function as protein disulfide
FT                   isomerases and chaperones in the bacterial periplasm to
FT                   correct non-native disulfide...; Region: DsbA_DsbC_DsbG;
FT                   cd03020"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7653"
FT   misc_feature    complement(96024..96035)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7653"
FT   misc_feature    complement(96024..96035)
FT                   /note="dimerization domain; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7653"
FT   misc_feature    complement(order(95874..95876,95883..95885))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7653"
FT   gene            complement(96468..97595)
FT                   /db_xref="GeneID:4947684"
FT                   /locus_tag="Bcep1808_7654"
FT   CDS_pept        complement(96468..97595)
FT                   /locus_tag="Bcep1808_7654"
FT                   /gene_family="HOG000263383" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TrbA-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sec:SC095 TrbA-like protein"
FT                   /db_xref="GI:134287891"
FT                   /db_xref="GeneID:4947684"
FT                   /translation="MSATQGKRDDMGLVYLGMLGLAAGFCWFMWYSSHADIVYYGLKFA
FT                   WYQLSALDWPFMPNAIRRWKQETAYLAMNPAAVSFEQFLAMMNKAGYLFVWIPVLLAIR
FT                   GIKLAVKHKANLTRRKVTVQTLPWIMSNHSPAIIPSLYYGDKDTLLLNVDPEEHRSSIN
FT                   PEEWVEQHGLLVNGVLDRERCRELLIADLGKPVKSLDELLPQEKAMFAIFGTRLLSDGK
FT                   DGAKAQELLDALNRSCHNHTWNGMKGYPDLSIASKAFAKYSQHPEAQRWLEKHPYPRTL
FT                   LHAMHKAAQGSGKLPSSHFRWLKGMDRGLWYALNTTGRKVPFLESAAVFTQTLWEDLAF
FT                   DSGYRLTEPYVDDAIDGVEAYLIKVGLMAPRKNQE"
FT                   /protein_id="YP_001110056.1"
FT   gene            complement(97605..98060)
FT                   /db_xref="GeneID:4947685"
FT                   /locus_tag="Bcep1808_7655"
FT   CDS_pept        complement(97605..98060)
FT                   /locus_tag="Bcep1808_7655"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   xcv:XCVd0040 putative lytic murein transglycosylase"
FT                   /db_xref="GI:134287892"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947685"
FT                   /translation="MLLKRVGVAVGLLAAAHMAHASVAAGVVAVPACVVQAANDYTLPV
FT                   RGLLAVWLTEGGRIGTVSRNKNGTADYGPMQINTVWAQRLESQFGVTRQMITDDFCWSV
FT                   RAGAYILRYEINQAGGSFWDGVGHYHSRTPQFKYQYIERVYRNSLKF"
FT                   /protein_id="YP_001110057.1"
FT   sig_peptide     complement(97995..98060)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.855 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7655"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(97626..97919)
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7655"
FT   misc_feature    complement(order(97674..97676,97731..97733,97827..97829,
FT                   97896..97898))
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7655"
FT   misc_feature    complement(97896..97898)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="Bcep1808_7655"
FT   gene            98205..100676
FT                   /db_xref="GeneID:4947686"
FT                   /locus_tag="Bcep1808_7656"
FT   CDS_pept        98205..100676
FT                   /locus_tag="Bcep1808_7656"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: dar:Daro_0018 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; SMART: DNA
FT                   topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="GI:134287893"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="GeneID:4947686"
FT                   /translation="MGKALIVAEKPSVAADIAKALGGFTKADGYFERDDAIVAPARGHL
FT                   VEQTVPAADAKGMWKIGVLPIIPDSFELEVIDGCTAEFSRLKKLMARDDVASVVNACDA
FT                   GREGELIFRLIYNKAGCRKPTKRMWIQSMVASAIRKAHDDLRPGAEFDHLSDAAFCRSE
FT                   ADWIVGVNGTRATTALRERKTQRREVSPVGRVQTPTLAMPVIREREIAAFVARDYWEIH
FT                   GTFRAEAGTYVAKWIGDADGDTSPAETEGDAEAEAEQTGARCFDKAKAQAIVDKCKGVD
FT                   PSSVVDESKPEERPAPALFDLTALQREANKRFKFSAKKTLDIAQALYEKHKATTYPRTD
FT                   SRALPEDYLETAAATLATFASTPLEAHAQRVIENGWVKPDKRIFNNADISDHFAIVPTG
FT                   QQPDGLSSDEQKIYDLVSRRFIAVFHPSAKYEKTVRTTIVAGETFRTSGKVLVEPGWLA
FT                   VYGEKAHDDTAAALCKVADGEAVTADAIELKALQTKPPKRYTEATLLAAMENAGRQVED
FT                   KDIRAAMKANGIGRPATRAAIIEGLLEDKDKNDNPKEPYLRRDDNELVPTPKAMELIAF
FT                   LEEAGIDFLVSPQMTGEWEQKLLRMEKGDYRRSTFMSEIADLSTGMVETIRAKYNELPE
FT                   PVAKALDAPCPRCGAAVHVDGRAYQCSGCDFKVWGEILGRRLTEAEASTLIANRKTSVL
FT                   SGFTSRTSGKKFSAALKLDVETGKVDFEFEDRAAPASNGEAKQLKAKCPKCSSGIEIQA
FT                   WNYACTGCDFKVRTEIASRKLSPGEAETLIGKGKTGVLAGFVSKSKRKFSAALKLDATT
FT                   GGVTFEFEDRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110058.1"
FT   misc_feature    98205..100673
FT                   /note="DNA topoisomerase III; Validated; Region: PRK08173"
FT                   /db_xref="CDD:169253"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    98211..98639
FT                   /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to topoisomerase III.
FT                   Type IA DNA topoisomerases remove (relax) negative
FT                   supercoils in the DNA by...; Region: TOPRIM_TopoIA_TopoIII;
FT                   cd03362"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(98229..98234,98241..98243,98511..98513,98517..98519,
FT                   98523..98525)
FT                   /note="active site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(98250..98252,98514..98516,98520..98522,98541..98546,
FT                   98550..98555)
FT                   /note="putative interdomain interaction site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(98511..98513,98517..98519)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    98520..98522
FT                   /note="putative nucleotide binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    98664..>98867
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cl11986"
FT                   /db_xref="CDD:143769"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(98664..98735,98748..98753,98772..98834)
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(98805..98807,98817..98819)
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    99042..100049
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99042..99065,99066..99089,99480..99524,99528..99584,
FT                   99654..99686)
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99090..99110,99114..99200,99204..99284,99375..99401,
FT                   99417..99479)
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99123..99125,99135..99143,99378..99380,99435..99437,
FT                   99444..99446,99456..99458,99795..99797,99801..99803,
FT                   99894..99896)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99177..99179,99189..99191,99216..99218,99801..99806,
FT                   99813..99818,99822..99824,99834..99839)
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99210..99212,99216..99218,99378..99380)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   misc_feature    order(99687..99734,99783..99842,99870..99884,99894..99938,
FT                   99957..100049)
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7656"
FT   gene            100686..103118
FT                   /db_xref="GeneID:4947687"
FT                   /locus_tag="Bcep1808_7657"
FT   CDS_pept        100686..103118
FT                   /locus_tag="Bcep1808_7657"
FT                   /gene_family="HOG000263384" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_B0039 hypothetical protein"
FT                   /db_xref="GI:134287894"
FT                   /db_xref="GeneID:4947687"
FT                   /translation="MQLPFELDPQIIHHIIYSQAGSIGKAIIELLMNSVDARATAVQLS
FT                   MTKEGFECSDDGNGFASREDVIRYFGRFGTPHEEGDATYGRFRLGRGQIMAHASTIWRS
FT                   NEWQMTVDTRVMGYNYDLEQLERARPGCSISGRWYEPLTDSELMSAVQEIRDLVRYTPV
FT                   SVELNGRVITRDPRAERWDAEDEFAWYRAKEDGAVSIYNQGVLVRHDPGHMWGAGGLIV
FT                   SKKAIALNVSRTEILRKTCPVWKAIAKQFGALADDVRSRLGEHRKTEASRERSARALLA
FT                   GDPNIVQIYEKEEVVTLLPGKRNLTMQAFLRKCRYSHNKRQGNRFTVVENGFDVPKGEA
FT                   IAREGIAVVVHPKTLERFGCYNAHDLLDCVDRIHANIREDVEKNGTRFWGLDTLELPEL
FT                   VDFATLRDAFVERTALVTERDALDKETRRAWTALRTILHHYAAVLTGGERRYHGSPIAR
FT                   GGKSFQILLGESNTAEAWTDGDTYIALTVDVVKRLKTVPLQAAAYIFGLVEHEVAHEGD
FT                   SLDCGHDEAFYQRFHDLTIRYAQERQWYMHAWLMRYTSSMEAEGKRARGSAWRERYLVD
FT                   RAGTGRTKRGLPRAIDDVATEPPVVTPEENMAFINYQNARLAQAGVCPPPPDWTEVLDR
FT                   ARDVQQQIESDLRAERERQAAQEAAEQEDFDAFYEEMQREEQAVRQRLALLLGINADEI
FT                   SDYALDYLTASDLSDDDVKALWQRKPWAEREREIYGYPVDHDDQGMRRQDDDADTAADD
FT                   ESPDNDPAALEAGAFYPPELRALIQPGETTWALERNAAAAGFYRVEDYLKWRAEVNS"
FT                   /protein_id="YP_001110059.1"
FT   misc_feature    100704..>100949
FT                   /note="DNA mismatch repair protein MutL; Region: mutl;
FT                   TIGR00585"
FT                   /db_xref="CDD:161941"
FT                   /locus_tag="Bcep1808_7657"
FT   gene            103115..103489
FT                   /db_xref="GeneID:4947688"
FT                   /locus_tag="Bcep1808_7658"
FT   CDS_pept        103115..103489
FT                   /locus_tag="Bcep1808_7658"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287895"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947688"
FT                   /translation="MKRYVIALALMATLAACDRKPPAEAEGQGARREVLQGFQTTFYRV
FT                   SDGKQRWVEIAIAVDGSKTFRMPVFFSDNGRLVQVSDDEARALIDKWLKQRAANVAAFG
FT                   SVDPQVGGNTPFLAIDRNTP"
FT                   /protein_id="YP_001110060.1"
FT   sig_peptide     103115..103165
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.795 at
FT                   residue 17"
FT                   /locus_tag="Bcep1808_7658"
FT                   /product="hypothetical protein"
FT   gene            103500..103880
FT                   /db_xref="GeneID:4947689"
FT                   /locus_tag="Bcep1808_7659"
FT   CDS_pept        103500..103880
FT                   /locus_tag="Bcep1808_7659"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287896"
FT                   /db_xref="GeneID:4947689"
FT                   /translation="MQERAYLEAVPAYHATSPDGRTVPFIVSLLLHDAENKPRITPAVE
FT                   RSIDRTIDITGREGLALAIIADDDEMPATARRYVERAMGIPGAIILFRCQSPETAERLM
FT                   QHLHAEYQLTLVRESAEPAPGP"
FT                   /protein_id="YP_001110061.1"
FT   gene            103944..104411
FT                   /db_xref="GeneID:4947690"
FT                   /locus_tag="Bcep1808_7660"
FT   CDS_pept        103944..104411
FT                   /locus_tag="Bcep1808_7660"
FT                   /gene_family="HOG000254028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu2371 hypothetical protein"
FT                   /db_xref="GI:134287897"
FT                   /db_xref="GeneID:4947690"
FT                   /translation="MHTLTLEQLRATTDAGGVAGVTLKAQGGAFYVKVDTRNGDEAVLA
FT                   KARSSEPRSFGNPAQALTLLRGLGLAVGSFDVQDWNPEDRATVRTRPDRAEALKRTHEA
FT                   AEHDKWFRAQVEQGLAEADDPNTKWVPHDVVKDDMQRQREALKARIAGGNK"
FT                   /protein_id="YP_001110062.1"
FT   gene            104411..104698
FT                   /db_xref="GeneID:4947691"
FT                   /locus_tag="Bcep1808_7661"
FT   CDS_pept        104411..104698
FT                   /locus_tag="Bcep1808_7661"
FT                   /gene_family="HOG000138822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="addiction module antitoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: rle:pRL110045
FT                   hypothetical protein"
FT                   /db_xref="GI:134287898"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR012753"
FT                   /db_xref="GeneID:4947691"
FT                   /translation="MELVWTPRARRAREEAIDYIAQDNPVAALGQLDEIERQTDMLIQH
FT                   PEMGRPGRVEGTRELVISRTPFIVVYRLRPRARRIELIRFLHGAQQWPKT"
FT                   /protein_id="YP_001110063.1"
FT   misc_feature    104417..104686
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Bcep1808_7661"
FT   gene            104729..105118
FT                   /db_xref="GeneID:4947692"
FT                   /locus_tag="Bcep1808_7662"
FT   CDS_pept        104729..105118
FT                   /locus_tag="Bcep1808_7662"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287899"
FT                   /db_xref="GeneID:4947692"
FT                   /translation="MKLKVRNAAGEQHTIDIDACDTAIINGAQGPTTSSLDWLTADERR
FT                   ELDEWCNNQTPSPNGSIAMNAWPGWHDVALRRFADTARSYRPNIQTVTQSFAQLVVGAP
FT                   ASGKSQMMNSFPITDPDAPNTTEGN"
FT                   /protein_id="YP_001110064.1"
FT   gene            105320..105574
FT                   /db_xref="GeneID:4947693"
FT                   /locus_tag="Bcep1808_7663"
FT   CDS_pept        105320..105574
FT                   /locus_tag="Bcep1808_7663"
FT                   /gene_family="HOG000263385" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:ebA95 hypothetical protein"
FT                   /db_xref="GI:134287900"
FT                   /db_xref="GeneID:4947693"
FT                   /translation="MTTWTDEQLADYECALETIGNVIALKARDIETEKTKPSPNSDRID
FT                   ELRRQQAELADERSRLRIGDHDAVARAIEQYGRLVRASA"
FT                   /protein_id="YP_001110065.1"
FT   gene            105587..107128
FT                   /db_xref="GeneID:4947694"
FT                   /locus_tag="Bcep1808_7664"
FT   CDS_pept        105587..107128
FT                   /locus_tag="Bcep1808_7664"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zeta toxin family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Zeta toxin family protein; KEGG: xac:XACb0057
FT                   hypothetical protein"
FT                   /db_xref="GI:134287901"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="GeneID:4947694"
FT                   /translation="MTVIHDNRPRGLSVEEAQKAVDEFLAEYNGNIPVTAVVRATQEEI
FT                   YGPQVSREKLGYRIDGAYHPARRIFTLAASNMGDEGAVRRALRHELLGHYGLNTFSPTE
FT                   KRALLDRVLETRHESSLSHIWKRVERDYASLPDLHKAEEVFAFVAEEERSFLGRAWDGV
FT                   RAALQRALRATGLSSGPLTLTELRDVARDIARGIRAGDREQQTFPQSDTAQFRLDPGRH
FT                   AEILRDIQTHALGATRPAQRPVAIILGGQPGAGKAGLASAALEELAGNAVKVDADELRK
FT                   NHPAYIALMREDDRAAADRTHGDAGPWAVKLTSAAMAARRNLIVDGTMRDPDNLAKLCR
FT                   KLREAGYRIEARVMAVNPLVSRLSIHERYERQVRANGFGRWSNRDKHDAAFSGVPLTVE
FT                   KLEAQQLVDRMTVFARNSDEPIYDNRLVAGHWEQPPAGRERVDAERARDWSPAERHQFA
FT                   DKLDAIARRMEQRGADESDLASLAELRADFERQHPTDRHAPRVTRRDAPKPGGRR"
FT                   /protein_id="YP_001110066.1"
FT   misc_feature    106280..106858
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="Bcep1808_7664"
SQ   Sequence 107231 BP; 21280 A; 33113 C; 32339 G; 20499 T; 0 other;
     TGATACAAAC GGATAGAGGG CGTACATCAT GGCAAAAAAG CGGCAGCGAG CCGACGATCT        60
     CAACCAACTC TCATTCGACT TCGAATTCAA TGCCACCGCC GACATCATCG ACAGCCTTCA       120
     GGCACAGATC GATGTCGACG AAGATGAAGG AGCACAGCAT GCTTACCGGT CAAACTCAGC       180
     CGCTGTCGAT CGCGGCGAAA ATCCTCAAGC CGACGACGAT TCAGGCCGTC CGGCGTTCAC       240
     CCTCATATCA CCTGCAGGGT TGGAAGATCC TCGACCGCTG GGCGTTCAAC AGCCCGGAGA       300
     AACTGCGCTC GCTGGAAGCG CAAGGCGAGG TGATCCTGCT GGGCAGGCTT CTGGAGCAGC       360
     AAACGATCGA GCACCAGGTC TTGAGCCGCT CGATCGACCA GAAGCAGAAC GGCCTGACGG       420
     AGCACGAGAT CCTGGCCAGC AACGAGATCA ACACCGAGCT GTAACACCAG CCGACTACAA       480
     CATCACCGCT GCGGACCGGC TCGGGGAGGG CGGCGCCAAG GCGAAATATC GGGACAACAT       540
     CGCTGCATTG AAGCTGCTCC TGCAGCTTCG TGAAGAGCAA CGCAGCGCGA CGCCTGACGA       600
     ACAGGCGATC CTCGTGCGCT ACGTGGGCTG GGGCGGCCTT CCGCAAGCGT TCGACCACCG       660
     CAATCAGGAC TGGCAAGACG AATACCTCGA GCTCGCCGGC CTTCTCTCCA AGGATGAATA       720
     CGAACGTGCG CGCCGTTCCA CACAGGACGC GCACTACACG TCGCAAACCG TCATCGAGGG       780
     TATCTACAAG GGTCTTCAGC GTATCGGGTT CGACGGCGGC CGCGTCTTCG AGCCGTCCGC       840
     CGGCATCGGC AATTTCCTCG GCCTCATGCC GGCACCGATG CGTGCCGCGA CCCACTTTAC       900
     TGCGATTGAG CTCGATCCAC TGACGGCCGA GATCGCGCGG CATCTGTACC CCAGCGCGAC       960
     GCATATCAAC CGTGGCCTGC AGGACGTCGT GATTCCCGCC GGTCATTTCG ATGCGTGCGT      1020
     CGGCAATCCG CCGTTCGGCA CGCAATCGCT CTACGATCCC CACCATCGCG AGCTGGGCGG      1080
     CTTCTCGATC CACAACTACT TCCTCGCGAA GTCGATCGAC AAGCTCCGCG AGGGCGGGGT      1140
     AATGGCCGTC GTCGTGAGCC GCTACTTCCT CGACGCGGCC AACACCGCGG CGCGCGAGCA      1200
     CATCGCGGAC CGCGCGCACT TCCTCGGCGC GATCCGCCTG CCCAACACGG CCTTTAAGCG      1260
     CAACGCGCTC ACCGAAGTCA CGACGGACAT CATTTTTTTC CAGAAGGCGG CCGCTGGCGA      1320
     GACACCCGAT CGGCGCTGGG TCGATGTCGG CGAAATACGA GATCATGATA CTGGCGAGCC      1380
     GATCACCATA AACCGCTACT TTATCGACCA TCCTGAACAG ATGGCCGGCC GCATGGTGAT      1440
     CACCAGCAAG ATGCACCGCG ACGCGGCGGA CCTGGTGCCC GAGGCTGGCG TCGACCTTGC      1500
     CGCCGCGATC GAGCGGCGCT TGCAGGCGCT CCCCGCCGAC GTTTATCGGC CCGCCGATGA      1560
     CGTGGCCACC GCAACCGATC GGGGCGAGGA CAAACCGGCG CTGACGCTGC CGGACACGCT      1620
     GAAGGTCAGC TCGTTTTTCG TCGCGCCAAA CGGAAGGCTC GCGCGACGCC TGCCGGACAT      1680
     CCTCGATGAG CACGACTATA ACTACGTCGA GCCAAAGAAC GAGCGCGCCG GCGCGCGCAT      1740
     CAAGGGCATG GTCCAGGTGC GCGAGGCGCT GCGCGATCTC ATGCAGGCCG AGCAGTCCGA      1800
     GCATGTGACC GACTTCGAAC TCACTTCGAA GCGCTCGAAG CTGAACCGCG TCTACGACGA      1860
     CTTCGTGCGC AGGTTCGGGC ACGTCAGCTC CCAGGCGAAC CGCCTCGCCA TGTCGGAAGA      1920
     TCCCGAGTAT CCGCTGTTGC ACGCGCTCGA AAGCGACTAC GACAAGGGCA TCTCGCCCGA      1980
     GACCGCGAAG AAGCACGGCG TGGAGCCGCG CCGGCCGAGC GCGAACAAGG CGGCGATTTT      2040
     CTCGAAACGC GTCATGAGCC CGCGCAAGGA AGTGACGCGC GTCGAGACGG CGAAGGACGC      2100
     GCTTGTCGTG TCCATGAACG AGAGCGGCCG CATCGACCTA GCACGCATGA TGCGCCTCAC      2160
     GGGCAAGCCC GAGGAAGAGT TGATTCGCGA CCTGAAGGGC CTCATCTACC TGAATCCTGA      2220
     GCGCGACCGC TGGGAGACGG CGGACCAGTA TCTGACCGGC AACGTGAAAG CCAAGCTACG      2280
     CGCGGCCGAA GCGGCCGCCG GCCAGAATCC CCGCTACATC GAGAACGTCG ACGCATTGCG      2340
     CGCCGTTCAG CCCGCCGACA TCGAGCCGGT CGACATCTCC ATCCAGCTCG GCTCGACGTG      2400
     GGTGCCTGAC CAGGTGATCG ACCAGTTCGT CGGCCACCTG CTCGGCGACG TGCGCCGTCG      2460
     CATCACGTAC CAGGAGACGC TGGGCAAGTG GCTCGTCGAC ATCGAACACG GCGATCGCAC      2520
     CACGGCACGC GTCACATGGG GCACCGAGGC ATATCCCGCC AACGAACTCA TCGAATCGAT      2580
     CCTCACTAAC CGACCGATCC AGGTCAAGGT CGAGGCGGGC AAGGATGCGA ACGGGAACAA      2640
     GATTTATCGC GTCGACGATT CGCAGACGGC GGCCGCCAAC CAGAAGGCAG ACGAGATCCG      2700
     GCAGGCGTTC CTCGATTGGG TGTGGGAAGA CAAGGACCGT CGCGAGATGC TCGCCCGCAT      2760
     CTACAACGAT CGCTTCAATA CGAACATTCC TGCGAAGTAC GACGGATCGC ACCTGGACCT      2820
     TCCCGGCGCG TCGCTCGACA TAACCCTGCG GCCGCACCAG AAAGACGCTA TCTGGCGCGG      2880
     CATTCAGGAT GGGACCGCGC TGTTCGATCA CGTCGTCGGC GCAGGCAAGA CGCTCGTGTG      2940
     CGTCGGCACC ATCATGGAGA GCAAGCGCAT GGGTCTGATG TCGAAGCCCA TGCTCGTCGT      3000
     TCCGAACCAT CTGCTCCTGC AATGGAAGGA CGCCTTTTAC TCGCTCTATC CCAACGCGAA      3060
     CATCCTCGTC GCCGAGAAGA GCGACTTCAA GAAGGAAAAC CGCGAGCGGC TGTTCGGCCG      3120
     CATCGCAACG GGCGATTGGG ACGCCGTGAT CGTCGCGCAC AGCTCGTTCA AGAAGATCGG      3180
     TATGCCCGAA GACACGCTTC GCGAGCTGCT GGAGGAACAG ATCGAAGATC TCTCAGACGC      3240
     AATCACGCAG ATCAAAGCGG AGCAGGGCGA CCGGATCACG ATCAAGGAAA TGGAGAAGGC      3300
     GAAGGAGCGC ATGACGGAGC GCCTCGAGCG CAAGGCCGAT ACCGGCGCGA AAGACCTCGC      3360
     GGTCAGCTTC GCCGACCTTG GCGTCGACGC GCTTTTTGTC GACGAGGCCC ATGAATTCAA      3420
     GAATCTGTTC ATCACGACGA CGCTCAGTCG CGTGTCCGGT CTCGGCAATC TCGCCGGCTC      3480
     CGAAAAGGCG TTCGACCTGT TCGTGAAGTG CCGTTACCTA CAGCAGCGCA ACGACGGCCG      3540
     CGGCGTCTTT TTCGCGACCG GCACACCGAT CAGCAATACG ATCGCCGAGC TCTACACGAT      3600
     GCAGCGCTAC TTGCAGTACG ACGAGCTCAA GGCCCGTGGC ATCGTCCACT TCGACGCATG      3660
     GGCGTCAACC TTCGGTCAGG TCGTCACCGG CTGGGAGCTG GACGCGACGG GCGTCAACTA      3720
     TCGGCTCAAT AGCCGGTTCT CGAAGTTCCA GAACGTTCCC GAGCTGATCT CGCTGTACCG      3780
     TACCTTCGCC GACGTCATCA CGAAGTCGGA CCTCGATCGC CAGGCAGAGG AGCGCGGCAC      3840
     CCGCTTCCCC GTTCCGAAGA TCAAGGGCGG CCGGCCGCAG AACATCATTG TCGATCGGTC      3900
     CGAAGCGCAG GCGCTGTTCA TGGGCGTGCA AACGCCCGTG CTCGACGGCA ACGGCGCGCC      3960
     TGTCCTGCGC GCCGATGGCA CGCCACTGAA GAACTGGAAC AACGGCTCCA TCATCCACCG      4020
     GATGGAGAAC TTGCCGAAAG ACCCGCGCGT CGACAATCCG CTCAAAATCA CGAACGACGC      4080
     GCGCAAGGCT GGCCTCGACT TCCGCCTCAT TAATTCGAAC GCAGCCGATG ATCCCGGCAG      4140
     CAAGGTCAAT ACGGCCGTCG ACAACATCTA CCGGATATGG GAGGCGTGGA AGGACCGGAA      4200
     GGGCACGCAG CTCGTGTTCT GCGATCTGTC GACGCCAAAG CTGTCGAAAA AGGCAGCACC      4260
     GGTCGCAGAC GCGGCGAACG ATGACGACAG CGATGATGAA GCGCCCGCTA TCTCGATGGA      4320
     CGAGCTGCTG GCCAGCAACT CCGACTTTTC GGTCTACGAT GACATCAAGG CGAAGCTGAT      4380
     CGCGCGCGGT GTTCCGGAGC ATGAGATTCG CTTCATCCAC GAGGCGACGA CGGATCTGCA      4440
     GAAGGCCAAG CTGTTCGATG ACATGAACCG CGGCCATTCG CGGATCATGA TCGGGTCAAC      4500
     GGCAAAGATG GGCGCAGGCA CGAACGTGCA GCGGCGCCTC GTCGCCGAGC ACCATCTCGA      4560
     CGCGCCGTGG CGGCCGAGTG ATCTGGAACA GCGCGAAGGC CGCATTCTGC GGCAGGGCAA      4620
     CCTGTTCTAC GAAGAAGACC CAGACGGCTT CGAGGTCGAG ATCCTGCGCT ACGCGACCAA      4680
     GCAGACCTAC GACAGCCGCA TGTGGCAGAC GATCGAATAT AAGGCCGCCG GCATCGAACA      4740
     GTTCCGCAAG GGCGACAGCC TGCAACGTGT GATCGAAGAC GTCGCGAGCG AAGCCGCGAA      4800
     TGCGGCCGAG ATGAAAGCCG CCGCGACGGG CAATCCGCTG ATCTTCATGC AGGTGAAACT      4860
     CAGTGCCGAC CTGAAAAAGG TCGAGGCACT GTTCTCGAAC TATAAGCGCA ATCAGCACAG      4920
     CCTCGAGAGC CGAATCGGCT GGCTCGCCGA TGCAGATCAG CGCGCGGATC GCGCTGTCGC      4980
     GCGATGGAAC CGCGAGATCG AGCTCCGCGA CAAGGCCACG ACCGAGCAAT TCCGGTTCGA      5040
     GACCAAGAAC CGCGTCTATG GTGAGAAGGA TCGGGAGACG CTGCTCGGCG AAGTCATGTA      5100
     CGCAATGAAG AAAGCGGTCG AGCGGCGAGC CGTCGGCATC CTCGATCGGC CCACCGAGAT      5160
     GCCGGTCGGA CGCTATCGCG GATTCGATGT GAAGGTGTAT GCCAGCCGAG ACGAGATTCA      5220
     GTTCACGTTG ACCGGCTCGG ACACTTACGA GCCTGAAAAT CTGAGCTATC GCGCCGAGGA      5280
     GAAGTTCAGC ATCACGGGCT TCATCCATCG GCTCGATAAT TTCATGGCCC GCTTCGAGGA      5340
     CTGGCGACAG GAGGCCGAAG AGACGCGGGA GAAGGAGCGG CGCGAGTACG CCAAGGCGGT      5400
     CGCGGAGCAG GGCAAGCCTT TCCCGCAGCA GGCGCGCCTC GAGGCGCTTC GCCAAGACGT      5460
     GCGCGACGTT ATGACGGAAC TGAAGCTCAT GCAGGCCGAC GAAAACTACG TATCGCAGTG      5520
     GCAGCCGCGA TCGCTGGCCA GCGACAGCAA TGCCGGTCAG CAACAGGACC GTTATCGCAT      5580
     GCGTGCATGA GAAAGGCAGC CACAAGATGT TGTGCCCGAC CAGCTGCTCA GAGGCACAAC      5640
     ATCTTGTGAT CCTGGCATCG CGGCCGCGAC GATTTCTACG CCTGCAGGCA GGCGCGCAGG      5700
     GGAGGGCCGC CGGCGGCGGC CGCACCCACC CATCCCCCCG CCCTTCCCGC CCTGCGGGAA      5760
     GGGAGCGAGT CGCCCTCTGT CGTCAAGGGT GCGGGGGAGA TGAACCCCAC CCCCACACCC      5820
     TCGACTGGAG CGTCTACACC GGCACGTCAG CCCCTCAAGG GCCGCTGCGC TGCCGTCCTC      5880
     ACCCGTTCGG TGCTCGACCT GGCCTGCGGC CAGCTCTGCG CTCCGCGTGC GGCTTCCGGG      5940
     CGGCCCCTTG ACCGTCTGCC ATGCCGAACA CCTTCCCCCA TCTTTTTACG CAATTACGTA      6000
     TTTACGTATG TACGTAAGTA GGCTATAATA GGCCATGCAG TGAGGTTTCA CCCTCGCCGC      6060
     ATCCCCGGCC GGATTCCCAC TGGCGGCTAC CAGTCTCCCG GCTACGTCGT TCACCGTCCC      6120
     GTCTAGGAGC ACTGGAATGA GCGCGAGTTT GTACACACTG CATCATTGCA TCGTCATCCT      6180
     AAGTTGCGCG TACATGGAGT ACACGTACAC GCCGTGGAAC GGCCGCAACC ACTACCGGCG      6240
     CACGGTCGAC TACGGTCGCG TCGTCTGGTG CTAACCACAC GTCGAAAATT CCCCTGATCG      6300
     CATTGGCGGC TACCGATGCG ATCGGTTCCT GCAACATCAA CGTCTAGGAG CAACCATGCA      6360
     CATCAAGTTC CCGGTGCAGA AGGGCACGGC ACTCGCCGAG CTCGGCTACG GCGAAAGCCT      6420
     GCTGATTCCG TGCAACGATC GGACGGTGCA GTCCGTCCAG TCGTCCATCC AATCGCTGTA      6480
     CGCGAAGAAG GGGCTTGCCT CGCGCGAGTT CTCGCAGCGC AAAGCGTTGC TGATCCTCGA      6540
     CGAACACGTG CTGCCGATCC CCGTCGTCGT CGTTACCCGT CAACACGTCG CAGTGCTCGA      6600
     GGAGGTGCCG GCATGAGCAA CCTCGTTGAC TGCGTGCAGA TCCGTGCGAT GACGGCGGCC      6660
     GACGCAGCGG CCGCGATGCG CACACTGGTC ACGAAGGTCG ACAGCCAGGT CGGCATCGGC      6720
     ATTTGGGAAG GCTCGATCAC CGGCAAGATC AGCGGCCAAA CCTACGACGG CAACGACGGC      6780
     AAGCACATTG CCGTATTCCA CGACACGAGT CTGGTCGCAC CGTTCGGACC GCACGGCGAC      6840
     GCAGAGAGCG AGGCGTGCGC CGCGCTGTTC TGCCTTGCCG TGAAGCATGC AGATGCGCTT      6900
     GGGAGCCTCG TAGAAGCCGC ACAAGCCGTT CTCGGCGCAT GGGAGATGGG CGATCTCGCC      6960
     GGCGCCGTGC GCGGCCTGTC TGCGGCCCTG GAACGCGTCA CTGAATAGGG GAGGCGGGCA      7020
     TGTCCAACGA ACAACGCATC GCGACATTCC CGTGCCGAAC TTCGAAATCC TGTTCCCCGA      7080
     CGTCGACGGC AAGGAGTAGG GCAGAGACAC GCCTGAGACG CCAAGCAAAA GGCCGGGTTT      7140
     CCCCGGCCTT TTGATTCGCC CTATTCGTCC TTTATCACGA AACGGCTCCG ATCTTGGTAG      7200
     GCGATCCAAG CCGGCACATG GCCCCGCCCG CTCCACGTTG CCCCACTCAC TGGATCGCGG      7260
     TAACGAGGCC GAGTTGGTTG GACGTTGTAC CGAATGTTGC GAGGCCGTCG CAGCTCGTTC      7320
     GGCTTGATGT CGAACTCGTA CATCAGCTCA GCGATCTGCG CTAGAGCGTC CTTGCGGGCC      7380
     TGCGCGCGGG CCGCGATGAT TTTGCGCTCA AGTTCCTTCA ACTCTGCTAC GAGTTGCGAA      7440
     TAGCTCTTGT CGGTCATCGC CACTTATGCC GGTCGCGGCG CGTTCTTGCG CTGTGCGCGA      7500
     GTTTCCTGAA GCCGCTGCAT CTGCTCGCTG GCCAGCCGCG AACGCGGCGT CATTCCGAGC      7560
     TGCGAATCGA TGGCATCGCA CGCAGCCTGG AAGCTGCTGT ACGTACCCTT GAGCACCTTG      7620
     TCGACGTCCT TCGGCATCGA CGGCATGCCG CTTCCATAGG TCGTATGCGT CTTCGTCATG      7680
     ACCTGATACA CGCCATAGCG GTCGACAACG CCATCGCCTT CGTGCTGGAC GTCGAGGCGC      7740
     TTTGCCGTGA CCTCGCGGCC CGGATCGCCC CGATCGTTCG GCACGTTCGC TCGCGCAACG      7800
     TGGTCGTACT CGCGCGAACG AAAAACCGTC TTGCCGACGA CGACGTGCTC CTGCATCCGC      7860
     GGATCGTTTT CAGGCGGCGT TGCCGGCTGG CATTCGACCA GGAACACGCG GTTCATCGTC      7920
     GGGTCTTCGA AGGGAGGCTT GCTCCCCGGC CCTTCGTGTT GAGCGAGCTG CGCGGCCACC      7980
     TGGCGGGCGA GCTGCGACGC CTCGCGATCC ACGCGATGAT TGTCGACCGC CTGGATGATC      8040
     GCCTTGTACT CGCTGCCGGT CAGGCGATGC CGGCGCTTTT CTCGGATGTC CTGCAGCAGC      8100
     TCTTGGCATT GCTCGAGCGA AAGTGTCAAC GTGCCATTCA TCGTCTTACC CCCGATCAGC      8160
     GGCTTGCAGC AAATGCACGC GCATCATGGA GCTCACCAGC TCCGCGAGGA CCGCCACTGC      8220
     GGCCATTACG ACGAGCGGCG TTGTTGTCCA CTGCGCGATG CTGTCGTCCA TGTTGAGCCC      8280
     CTTCGTGTGC AACACGATGC TGCTCACGAC GGCGACGAGC AGCACGAACA CGACGCCGGT      8340
     TTTCCCCAAG CGGGAAAGCC GACACAGGAA CAGGTACATC TCGTTGAGCA GCAGTCGGTT      8400
     CATCAGACTC TCCATTCATC CAAGCTATCG AAACGCCTAA TCCGATAGCT TAATTTTACA      8460
     TAATGTATAT TATCGGAAAT TCTGCAAGTG CTTGATTTTC AACGAAAATC AAGCGTGTTA      8520
     GGCCGCCGAG TCGATCGATG GCGCATAGCT GGACAGCCGC TTGATGAGTG GATGCGCGAC      8580
     CTCGAATCGC TCGATCGCTC TCAACGTCTC GCGGCGTTTT TCGAGTGCTG CGCGCACGGG      8640
     AGCGAATTGT TCGGCAACGA CTTGCTCGCC GTGTTTCTTG ACTCGGGCTT CGTAGCCCAC      8700
     GCCTTGGTCG GGCTGGGCGT CCTGCGCCGC TTGGAGTTCG GCATAGGCGG CCGCATCATC      8760
     CTCGTAGAGC TTCCGACGTC GAGCGAGCAG CTCTTGACGT TCTTCGGCCG AATAGAACGT      8820
     CTCCACGAGA CGCAGTGACG CGAGCGTCTC AAGCGCGCTG GCAATGCTTT TAAGTTGCTC      8880
     CAATGTCTGA TCGGTTTCCT TCGTATTCAT CAGCGGTCCT TGCTGTTCAA GTACACGGAG      8940
     ATCCCCACCC ATCCCCCGCC TTCCCGCCCT GCGGGAAGGA GCGAGTCGCC CTCTGTCGTC      9000
     AAGGGTGCGG GGGAGATGAA CCCCACCCCC ACACCCTCGA CTGGAGCGTC TACACCGGCA      9060
     CGTCAGCCCC TCAAGGGCCG CTGCGCTGCC GTCCTCACCC GTTCGGTGCT CGACCTGGCC      9120
     TGCGGCCAGC TCTGCGCTCC GCGTGCGGCC TCCGGGCGGC CCCCCCCTGA CCGCCTGCCA      9180
     TGCCAACATG CAAATACGTA CATACGCAAT TACGTATTAC TCCGGCAACC TACAACCTTT      9240
     TCGCTGCTCG ATCTGCTGAT CGCTCGGCCT CGTCGACGCG TCGAAGCGAA ACGTTCCATC      9300
     GTCGTACAAC TCGAGCCAGC CCCACACGCA TTCGAATTCG GATTGACCTG GTTGTGGTGG      9360
     TTTCTCCCAC CACGGCTCGC GACTCACCAG CGCCGGCATG GGCCTCTCCT CACCTGCAGG      9420
     TGTCGTTCGA GATCCCGCCA TCGGGATTCG TGTCGACGCA TACGGCTTTG CCCGTCGCGA      9480
     CGACGAAGTA GCGCGAGATC CCGGTCTGCG TGGCCACCAC TACCACCGCG GCCGCAAGAA      9540
     GCAGCCACAG CAGCCCCACA CCGATATTTC GCATTGCTCT GCCGCCCGAG GGAACGTTCA      9600
     TCGTTGCGTC TCCTGTTTGT TAAAGGTCGA AGCTCGCCAG CGGCGCTTTG GTTTGCGCGT      9660
     TCACCAGCTC GAGGTGCGCG CGCGAGACGA CGGCCAGCGC CGTACCGTTT TCCGCGCGAG      9720
     GCACGAACAG ATACAGCGTG CCCTGCAGCG CGAGAGCGTT CTGCGCACGT GTCGCCTCGA      9780
     TCAGCTTTGC TTGCTGCTCG TCCGAGACGG GCAAGCTACA TGGGAAATCC GACGGAAGGA      9840
     TTCTCAGCGT CGCCCCTTGC TGATTCCGCA GAATCCCTGC CCAGCAGTAT TGGCCGTAGC      9900
     TCGTCAGCGG AAAGCTCTTC GTGTTGAAGT CGTACTGTCC CACTGTCACG TTCGTGAGCC      9960
     CAAGCGGCTT CTGCGAGTAA CCGGACACCG GCAGCGTGTA GTAGTCGTGC TTGCGGTATT     10020
     CGTCCAACGC GGCGTTGATC CGAGGCAGCT CGGTCGCGGC AAGATCCTTC TTTTTGAAGG     10080
     CGTCCGTTTC GTTGTAATAC GACGGCGACA GGCGGTTGAG CTTATCTTCG TCGCTCACCG     10140
     TGCCCTGACT TTTCGCCGAG ACGATGTAGG TCAGCGCCAT GCCTGCCGCT TCGCCGTTCA     10200
     GATCGACGTA GCTGGTCGTC GGCACGTTGC GGTCCGGCTT CGGTAGCGAG GGCGCTTGCG     10260
     CGGCGGCCGA CGCCGGCACA GGGTCAGGCA GTTTCGGGCT GTTCAACAGC GATGCGGGCG     10320
     ACGCACTGGT CTGCCCTGCG CTGTCTTGCA CCGAGTCTTT TTTGCCATCG CATCCGGCGA     10380
     GTACAAGGCC AACGGCCAAC AGCATCGCAC CAGCTTTCAA AGTCATCCAT CAATCTCCAT     10440
     GCAAAAATGG GCATGGTCGC CTCACAGCAA CGCATGCCCA CGGGTTTGCC AATACGGCCA     10500
     GTTCTTAGCC GAAGATCGTG ACGAGGTTCG ACTTCCACTC GTCGGCCTTG CGACGGTCGA     10560
     TGCGCAGGCC CACAACCGGC AGCGCGGGCA CACGCGTCAG CAGCTTGAGC AGTGCCGGCT     10620
     TGCTTTTCTC GACGTCCAGC TCCCACGCGT TCACGCTATC GAAGTCGACC AGCTCTTCGG     10680
     TGCCGTCGTT GACGTCGACG TAGAGTGCCT TACGCGCCTT CGGATCGAAG CCGACGTAAC     10740
     GGTTGTAGAT CACCGACACG ACTTCCCACT GCGGGGCGAA TCCCTTCGCC TTGAACGCTG     10800
     CGACACGGGC CAGCACCCGG CCGCGCAGGA AGTCCGGCAA CGCCTTCAGC AGCAGGTACC     10860
     CGAGCGCGAA ATAGCCCAAG CAGCCGACCA GTAGCGGCAC CGACACCTCG AGATCCTTGC     10920
     CGGCGTGGTT GGCCACGATG AAGAACAGCG GCACAGCCAG CACCAGGCCA AGCAGATAGA     10980
     ACGGGCGGAG CACATACCAG ATGATGTTCA TTTTGTCCTC CTTGGTATGC AGTAAATTTT     11040
     GTATCACGGC CTGCATACGG AATTTCTACG AGTTCATTCT AGCATGTGCT ATTGACAAGG     11100
     GCTAGCACTA TTGATATGGC AGGAATCCAC GGTTGATTCC TGTTCATTCA TGGCAGGTTG     11160
     GCGGTGGCGA CTCGTCAGGA GAACCCCATG TAGAGAGCCA CACAGACACC TCTTCGAGCG     11220
     TTAAATGCAA GCCGGTTCGC TCGTATTCCT CCCAAGCCAG TACGGCATCT TCGTTCAACG     11280
     ATTTTCGCAT CTCATCTCGG GTTGCCATCG TTCTCACCTC ATAGAAGGCA GAAAGGCCGA     11340
     CCGGTAGGTC GGCCTCGCGC AAATCACGTC GATGCTTTTA TCCCGTCGCC GCCTTTACCA     11400
     CCGCCGCCTC CTTTTCCGCC TGCGCTGCGG CCGCCACCAG GTAGCAGCTG CTCCAGCTTG     11460
     CTCCCGAAGA CACGGATTGC GTTGTGCATC CGATCATTGT CGTCACGTCC AATCGTTCCC     11520
     GACGCATGAC CGCCGACCCA ATTGATCACT TGATCTGGCA CGATAAAGAT CAGGTTGAAG     11580
     CAGCTATGCA CTAGGTTCAG GCACATCGAC GCGTAGATCG TCAGGAAGAA GATGATGCTG     11640
     AAAAGCCCCG TCACCGAATC GAACTGCGCG TTGGCAAGGG CGATGCCAAA CGTCTGGTTC     11700
     AGCAGCGTAC CGCCTGCAAT GATGCCTGCA CCGCCAAGGA AGAACCCGAT CACCATCAGG     11760
     ATCGGACGCA CCATCACGTT CAGCAGGAAA ATGTAGCCGT GGGCCGTGCG ATGACCGAGG     11820
     CCATCGCCCT CGCCTCCCAG GTGTGTGATC GCCCACAGCG GCGCGGCAAT GATCGCCTCG     11880
     CCAACCACGA CCAGCCAGTT CACGGCCGCA CCGAACCAGA TGATGAATGG GACCATCGGT     11940
     AGGTACGTCG ACAGGGTGCC GCCGAGGATG AACAACGCGA TGATCGCCAT CACGAGGAAC     12000
     GGCGACATCG CATCGAGCAC GCCCTGCAGG GCATCGCCGA TCGACGACAC GGCGTTCGCC     12060
     ACCTTGGCGA ACATGCCGGC GACGCTCCAC CCTTCCTTGA CTTGCGCGAT CGCCTTGGCC     12120
     GTCACGTAGG CTCCGAGGCC AGTCTCGGCG GCCGCCATCG TATAGTCGCC GAGGTTCTTC     12180
     ATCTTGATGA GCGGATTGAC CTGGCCACGC CCTTCGCCAC CGGCGTTGAT GTCGATCATG     12240
     TAGTTGACGA TCCGCTGTCC CGGCGCGTTG AAGAAACTGC CGATGATCTT GTTCGCATCC     12300
     GACCCGGCGG CGCCTTTCGA GTAGTTGCCC GTGCTCGTCG TGCCGAGCGT CGGCGTGTAC     12360
     GTCGACGTGG CCTGTTGCGC CTTGTACGCC GCCATCGCGC TTTGGTAGAC CGTCAGCATC     12420
     GAAGGGTCGC CCTCGGACGA CATGCCATAG ACCGATGCTT TGGCCGCCAC TGCGTCCGAC     12480
     AGTTTCGTAT TGGCCTGCGC GAATGTCTGG TACCACGCGC CGAGCGTCCA CCACCCGCCT     12540
     TCCTTGATCG ACGAGCTCAA CTGGCTCGCG AGCGCCGCAA TGTTGCCCTG TTTCGTGGCG     12600
     GCCATGCTGC TGATGGTGTT CTCGTACTGC TGCGCCGCCG ACTGGATGGC AATCTCCGCA     12660
     TCCGGCAGTG CCCCTCCTCC CCCGCTCTGC TTTTGCACCA CAGCGTTGAC GAAGCCTTGC     12720
     GCGGCTGACG TCAGGCTCGA CTGCATCGCC TGAAGCGCCT GCAGATGCGC GCGCCGAAGA     12780
     TCGGACGTGT CGATCGTGCC GCTGAACCAG CCGGTCGACT GCGACTGCGG CTGCAGATCG     12840
     TTATTGATGT CGGCACCGCC GCATACGAAA CTCGAATTCT TCAACACGAA GCCGGAGTTC     12900
     GTCGGCGACT GCTGGATGTA CCCGTCCTGA GTTACCAGCG CGCCGCTCGA CTCAGCTTGT     12960
     GCGAGGCCGG CGTTAATCGC GTGCATGCAC AAGTTCGATT CGAACACGCT ATGCGCGAGA     13020
     TTCACCGTGC TCGGCATCAC CGGTTGCACG ACCATCGACT GGCCATTCTC GAACGCGGAA     13080
     ACAGACGCGT CCACGCCGAG ATTGGCGATG CCTACGCCCA TCAGCGAAGC ACCCCACAGC     13140
     ATCAGCAGTT GCGCGAGTGA CCAACCGTTC GCGGTCGGAA CGAGCGACGC AAGGCCCCAC     13200
     ACGATCCGAA TCGGCCCCCA CATCGTGTGC TTCTCGCGGT CGAACACGGC CCCATCGTGG     13260
     GCCGTCTGCG ACACCTTTTT GAACATCACG TAGCACGCGA AGAACGCGCC GACGACAAGC     13320
     AGCGCGCCGT TCGCGACCTG GAAGATCCCG GCCAAGATCG TATCGCTGCC GCCGGCGCCG     13380
     CCCGTGGCGA GCGGATTGTT CACGACGTTG CCGTAGATCG ACACGAGCGC TTCGCGCGAT     13440
     TTGTCGCCGG AGCGTTGCGC CGCCTGCGTG ATCTCGCCAA GCGACGTGCT TTGCGCCAAC     13500
     GCCGGCAGCG ATAGCAGGGT GGCCATGCCG GCCATCAGGC CAGCGAGGAT ACGGGAGGTT     13560
     TTCATGCGTG CGTTCCCCCT TTGCGACCGA ATTCGGGATC GAGCGTCACC CACCACCATC     13620
     CCTCCACTTC GCGCATGAAG TCTTCAAGGC CGCCCTTTTC TTCTTTCGAG AGCCGGTGCG     13680
     TGCGCAACTG CCACAGGCGA AGCTGCGCAC CCAACGCGAC CATGAAGAAA ACCGGCTGGC     13740
     TGGCAACGAG CGAAATTGCC CCCAGCGCGA TGCCGCGGTT ATGGCCGAAC CAGATCCCGC     13800
     CGAGTACGCC GTAGAGGCCC ATCAGCGCGA AGAACGCGGC CGTGCCGATC GCGATCCGCT     13860
     TCTTCCCAAG AAAATAGCGG TACAGCTCTT CTTCATTGAG CGCATTCGCC GATCGTCGGC     13920
     TCATTGCATC GGCGAACGAG TCGTTGCGCT GCTCCTTCGG CCCCTTGATG CCTTCGACGA     13980
     TGGTCTTGCG TGCATCATCA CCCAGCTCTT TCAAAGCGCC GAGGCTTTCC TTCGTCCGCT     14040
     CGACCTCCTT CTTCGCGAGC ACGACGGTCC GCTTCATCGC CGAAAACGGC AGGAACACTC     14100
     GCCACGCGAC CTTGCCGGTT GTCCGCAGCG CGTTCTTTTT CTGTTCCGTG GCCATCACTG     14160
     ACCTCCCATG CGGCCGCCAA TTGTCCGGTA CTTCTGCGTC AGGATCGGCT CGTATTCCTG     14220
     ACGCGCCACG CTCGCGAGGA CCTCGCCGTT GATGACGTTA CCCTTGCGCA GCTCGTTCTT     14280
     CACCTCGAGC AGCAGCCAGT TGTTCAGCGA TGCCACGCGG ATCTGCTCGC GCAACAGGTT     14340
     GTCGCCGCTC ATCGCCTGCA GGTCCGTCTG ATATTGGGTA TTGGCGTAAC GCCGGCCGAC     14400
     CTCGAATGCC TCAAACTCCC GAGCCGACAT CAATCCCGTG GCCTTGGCTT GCGAGGATGC     14460
     AACCTGGTTG TAGTACGAAG CTGCCGAAGG CGCCTGCAGC GCGTCGGCCA GCAGATCCTT     14520
     GGTCGCCGGG TTCGGCTGGC TGTCGGCGAT GAGCTGGTCC TGCGGATCGG ATGCGGCCGA     14580
     GATGATCGCG TTGTACTGAG TCATCAGACC GACGTACTGC GCGCCGGCCA CGGTATCCGC     14640
     TTCGCCTTTG CGGAGCTGCG GACCGATCGA GCGACGGATC GAGTTCTGCG TGTACATCCG     14700
     CGCCACGTCG GTCTGCTGTT GCGAGAACGT CAACTCCGGC GCTTTCCCGT TCGGGCCCGC     14760
     GCCGCTCAGA ACAGAGTCGA TACGCTTGTC CGCTCCCGGC AGGCTGCCGA CCGACGGGCA     14820
     CGCCCGAGCT CCGCCGTAGG CCGAGTAATC GTCGGCGTCG CAATATTGCG CGTGAATCTT     14880
     CGCCGCGCGA GACGCGTCAA TCTCCGGCGC CGGTGGGGGC GAGTTGATCG CCTGCGCGAT     14940
     GGCGGAATTG CCGATCGCGG CACCGCCGCC GGGGCGGATG CCACCCTTCG CGGCGCCGGC     15000
     GGCCGCGCCG ACCTGGACGG CACCGCCCGA ACCGGATTCG CTGCAGATAT TGTCGGGCAC     15060
     TTGGTAGCGT TGGCGCGCGT CCTCGATACG ACGATTCATT TCCATGTTCA CGTCGTTCTC     15120
     GCGCTGCGCG CGTGCGGCCG CCTCGATGGT GCTGGCCGTC TTGTTACCGT TCTCGTTGAC     15180
     CGCCATGCCG AGGTTGTACA GCAGAGTGCT GACCGACGTG TTCATCGCGG TAATCGCCCC     15240
     GGTAATCATG GTGCTGGCCG CATTGACCGC ACCCACTACG CAGCCGTCAC AAATTGCGAA     15300
     CGCCGGCGTC GACGCTACCA GCCCACCGGC CAGCACCGCA GCAGCGAGCG GCCTCATTAC     15360
     GATCTTGTTC TTCATTCGAC CAGCTCCCGT TGCTTCGTGA TCTTGCGCGT GTACCGTTCG     15420
     ACCAGCTTGC TTGCCAGCCT CTCAATGACA GACACGTCTT CTTTCTCGGA CGACTCGGCA     15480
     CGCATGTGCT CGATCGTTTC CAGCGCGGTG CCCAACGGGA AGTGCTCCGA GAGCAGCTTG     15540
     CGCGCCTCGT AAGGCCCGAT TCGCTTATAG AGGCGGTTGC GCAACGCGAC GTCTTCCTGC     15600
     GTTGTCGAGA ATGCCCACAA TTCGATCGGA CCGACGGTGT TGGTAAGGAG CTGCACCACG     15660
     AAGCCCACCT TCGTCTTGAA CAGCGCGAGG AAATTGCCGC CCTCGGGGCC GGGGCCAACC     15720
     GCTTCGCGTT GCAGTCGCCT GATTGCTTCC TCGGACACGC TGTACACGGA ACGCAGGATC     15780
     TCTTCGTCGG CCGCGTTGCC CCCACGCATG ACATAGACGG CCGTGGCCGC GTTAAGCAGC     15840
     TCGGTCGGAT AGTCCGCCAG GTATTGCGAG GCATTGACAA TGCGGATGCC CCACTTACGA     15900
     CCTTCCCGGC CGTCCTTAAT CATCGTCTGC ACGAACGCCT CTTGCCCGCC CGTGTTATGC     15960
     ACTTCGTCGT AAGCGATGGT CTTCTGCTCG TCCTGCACGT CCGCAACCCG CTTCAGGTGA     16020
     TACTCCTGAT ACATTTGCGG GACCACCGGC AACACCACCT CATCTCGAAG GAAGTAGTTT     16080
     TTGGCGGCCA TCTGCCGCGC GAACATGTAC ATCGCCGCGG TGCGAAGCAT GCCTTCGGGC     16140
     GTCTTGCCGC CAATGACGTC GTTCAGGTCG ATCGAGATGA TGCGAGTCTC GCTGTTGAGC     16200
     TCGAAGCGCG TGCGGCCCGC GAACAGAGCA TAATTCGACG TCGCGACCGT GAAGCAGCGG     16260
     TACATGTACT TGAGCAGCGG CTCGTTCGTG CCCGGAACCT TGGCCTCACC GAACAAGTCG     16320
     CGGATCGATT CGTCGTTCAG ATACGCACCA AAGTCCGGCA GAATCGGAAC AGCTTGGCGC     16380
     TGCGCAAGCG ACGCCTCGCG TACATAGCCG GCCTGGAACA GCATGTCGGT GACTTCCCAC     16440
     CATTTCGCGA CCGACCACCA CTCTTCCGAG TATTGCGTCT TCAACCCGGA CGATTCGAGC     16500
     ACCGCGTCGA CCGTCCGGTC GATATGCGGC TCATACATGT GCGGATTTTT CGTCGCGCGG     16560
     TCTTCATAAG CGATCCGCAA CAGCATTTCG TTCACCTGCG AGCACCCGGA CGGCGCCTTC     16620
     TTCGTCGCCG GGTCCGTGCA GAACAGCGTC AGCAGGTCGA CCAGGAACTC CTGCTCGCGC     16680
     GACGTCGGAA AGCGCGCGCC GAGTTGCGTG TCGAACGGGT TGGTCGCGTA CTCGAGGGAG     16740
     TTCTGCAGGC GAAGATACGC CGCTTCGCTT TTGCGATGCT CGGGCAGCGA GTCCTTGATC     16800
     AACTGAATCA GACCGGACGA CGACGGGCCG ACGTCGATAA TCGTCATCAA CGGCAGCCGC     16860
     ACGTTGCCCG GCCGGTGGAC GGTCGCGCTG TTCATCGAGT TCATCAGCAC CGATTTACCG     16920
     CTACCCGGTG GCGCACTGAT GAGTTCGATC CACGTGTCCT GCAGACGGCT GCCCAACTGG     16980
     ATCGGATAGA TTTTGCCGTC GGGAGTCCGC ACGATGAGCG AGCCGCCGTC GCCCCACGGC     17040
     GTCGCCGGCC GCTGCAACGG CAGCAGCGCG AGCGCGTCTG GAAGCGGCGG CACCATGCGA     17100
     TTGGCCACGT TTTTTGTCGT GAAGCCCGGA ATCGTCGACG CCCACGCGGC CATTGGGTCG     17160
     CCGTGTACCG ACGTGACCTG GCAAATGCCC CACGACTGGA TCGACTTCTC CAGCGCGGCC     17220
     ATTCGGCGCT TCGTCACGCT TTCGCTCGGC GACCACGTGG ACACCGCGAA CTTCATCGAG     17280
     CAGATCGCGT CCTCCTTCGA GCGCTCGTTG AGATCGATGA ACGACTGGCG AATTTGGCGG     17340
     TTGCTCGGCA GCATGCCGAC GAACGCCACC ATCATTTGCC GCGCCCGCAT CTCGTTCAAT     17400
     CCGCCCGGAT TCAAATCGAT GCGAACGCGC CACGGAATCT CGCGATCGAT CGACGCGAAC     17460
     AGCGACGAAA ACGGCTGCGG CTCTTGCGGC CCGAGCTCCA TCGACAGGTT TCCGTGCCAG     17520
     AGTTCATCCG TCTTGATGAG CTCGCGATGG TTCGTCACAT CGTTCGTGCA GATCTGGTAA     17580
     TTGACCGGGG GCGCCGTCAG GTCCGAATGA TCTCGCTTGT CTTCTCGCCC GCGCGGAATG     17640
     AAGCGGTCGC CGGGAAGCAC CGGCCGGAAT TTCTGCGACG TGCGCTCGCG ATTGACCATG     17700
     ATGCGCACGC GCTTGATTGC TTCGTGGGCG CTGATCGGCC GGAGCATGAT GCCAGGGCGC     17760
     CCGTCCGAGC CACAGCGCTC GAAATCATGT CGCACGCGCT CGATCATCGT GTCATGGCGA     17820
     TACTTCATCG CCATCAGGAC CGACGCGGGG TTTTGGCCGA AATCGATACG CGGCAGCCCG     17880
     TGCTTTTGCG CCTCCTGCGA CCGCTCCTTG AGCTCCCGCT TCATTTCTTC GGGGCTCATT     17940
     ACGTTCATGT GCGTGTACAC GATCATCAGG TTCTGTTCCC ACGCGACGAG CGGCGCGTTG     18000
     CGGCGCACGC GGTCCAGAAT GATGTCCTCC GACTTGAGGC CAATGCGGCG AGCGGCGTTG     18060
     ATCTGCGGCT CGACGAGGCG CATCAGCTCG TCGAGCGAGC GATCGGGATC GCGCTCGAAC     18120
     CCGAACGTGA TCGAGTGACC GTACCGCTTC ATGTAACCGT TCATCTTCAC GCGCAGGTTG     18180
     TCGATCATCT TGCCGAAGTC TTGATCGGAA AGGATCTGAT AGGTGCCCTG CACGTCGAAC     18240
     GCGGTCAGCA GCGCGAGCTT GTTATCGACC ACGATGTACG GGTCTTTCAG GCCCGGGTGC     18300
     CGCTTGATGT CTTCTTCCGT GAGGCCCACG GCCGTCGCCA GCTCGCAGTA TCCGGCGAAG     18360
     TCCTTGCCGA TCCAGTAACG CGCGAGATAA GCGAGCGTGT CCTCGATCGC GGTTACACCC     18420
     TTGTCCAGAA AGCCCATATT CGTTCCTCTT ATGCAGGCGC GTTCATAACG TCGTGATACA     18480
     CCTGGCCCCA CTTGCCGACC GGCAAGGTGC CGTAAGAGAC GGTTTCAAAA AGGCCCCGTG     18540
     GGGCTGTTAA CTTTCGCGGT GAGCTGTTAA CCTCAGGCAT CGGAACAACC GAGACTGAGG     18600
     AGATGGCCAA GCCGATCATC GACGATGAAT TGTGGACACT GATCGAGCCG TTACTGCCGC     18660
     CACCCAAGCC GCGGCGCGAG AAGAACCCGG GCCGCCTGCC TGTTTCGAAT CGCGCCGCGC     18720
     TGACCGGCAT CCTGTTCGTT CTCAAGACCG GACTACGCTG GCGCGACCTG CCGGCCGAGA     18780
     TGGGATGCGG CTCGGGCGTG ACATGTTGGC GCCGGCTGCG CGATTGGCAA GCAGCCGGTG     18840
     TCTGGGATCG CTTGCACGAG CTACTGCTCG CAAAGCTGCG CGCAGCGGAC CAGATCGACT     18900
     TCTCACGAGC CGCCGTCGAT TCATCATCGA TTCGCGCCGT TGGGGCAGGC CAAAAACTGG     18960
     GCCAAACCCC ACCGATCGCG CGCGACCCGG TTCCAAGCAC CACATCGTCA CCGACGCCAA     19020
     CGGTACGCCG CTCGCCGCGA TCCTGACCGG CGCGAACGTC AACGACGTCA CGCAATTGCT     19080
     GCCGCTGATC GACGCGATTC CGCCGATCCG CGGATTGCGT GGCCACCCAT TGCAGCGGCC     19140
     GCGTGTGGTC TACGCGGATC GCGGTTACGA CTCCGAGCGA CATCGGCGCG CGTTGCGCGA     19200
     TCGCGGTATC GAGCCAGTGA TCGCCAAGCG CCGTACCGAA CATGGCAGCG GCCTTGGCAA     19260
     ATATCGCTGG GTCGTCGAAC GCACGCATGC CTGGCTGCAT CACTTCCGTC GTCTCCGTAT     19320
     TCGTTTCGAG CGCCGTGCAG ACATTCACGG CGCGTTCCTC AAACTCGGTT GCTGTCTGAT     19380
     CTGCTGGAAT ACCCTTCGGC GGGCCGATCA GTCTTTATGA AACCGTCTCT AAGATTCGCG     19440
     CGCCCATGTC GCAGCGACTT GCGTGTACGG ACCAGGGTTG AAAACTACAG CGAGGTCTTC     19500
     GAACACAACC TCGCGCTTTT CCCGGTCTTG CTCCTCGAGG CGAACGATCG CCTCGGCGAA     19560
     AACGGCCGGG TCGCTCGTGC CCCACGCGTC TTTCGCGTAG TCGCGATGCG AGGCCATCCA     19620
     GTTCAGCAGC TTCTTTGCAT CCTCCCGCAC CACTGGATCG TCGGATCGCA GTGCGACGAT     19680
     GATCGTGCGT TGCAGATGGT TTGCGTCCTG CGCACTCAGC CCCGGCAGGT AGGCGATCAC     19740
     GGCATTGCCT TCGCCGAGTT CGCCGAGATG GTTCCAGCCG TGGCACAGAT GATCCGCGGC     19800
     CCGCAGGTTC TCTGCCCGCA CGTCGCGATG GTTGTCGCTC AGGTTGTGAA CCTGGTTCTG     19860
     CGACGAGTAG AAGCCGCAGA ACATGCAACG GTGCCCGTCA GCGACGAGCG CTTTGCGGCG     19920
     CAAATCCTGC CGCTCGAATT CGGGCTCCGT CGGCTCCACC GCGTCCGGAT GCTTGTCGCC     19980
     CCACACGCGG CTCTTCGTCG AAAACAGCAG CGTTGGATAC GCGGCCTTCT CGAAGTTGCT     20040
     GCCCAAGTTG GGCTTGGGCA GCACCTTGTC GAGCTCGACG GCGGCCGGGT CGTGAATGTC     20100
     GGTTCGGTCT GTCGTCATCG CTAATTGGGG CGGTCAGTTG ACCGCCCTCC CCCGTCTGAG     20160
     AGCGGTCACT GCGGAATCTG GCCTTGCGAC GAGCTTTGGA TGCCCACCGT TTCGCCGGCC     20220
     TTAATCATCA CGAAGCCTGT CGCGCCGAGG GCGGCGCCGG CAAGGATCGG AACGAAGATC     20280
     TGTCCGCCCT TGATCTGGCT ATGCTCGCCC TCCTTGCCCT TGCGCCACCA GTTGTAGCCA     20340
     CCGTAACCGG CACCGCCGAA GCCGACGACG GCGAACAGCT TCCCGAGGTT GGTCTTGATC     20400
     GAGTCGCCCT GCTGGGCCGC CGTGTCGACC ATTCCCGCGA TACCCTGACC GTCGGCATGG     20460
     GCAGCCGTTG CCATGCACAG GCCGGTGAAC GTCATCGCCG CGCTGGCCAG CATGATCCGA     20520
     CGCTCGCGCG GCGTGCGCGA TTCAACATAG TCAGCGCACT TCGCCGCGGC GGTTATGTGC     20580
     GCTTTGCGCC CCAGGTCCCC GAGCCACTCG ATGGGCTTGA GCATTGCCTT TTTCATTCAC     20640
     TTTCTCCTAT CAAGATGGAA CTACCAGTAG AGGCCGAAAG ATTGCCGGAA CGCCTCGATT     20700
     ACATCCGGGA TCTGAACGAG CATCGCCCCA CCCACCATGT GCGTGAGGGC GCGCCAGACA     20760
     GAATCATCGG CACCATGTGA CGACTGCCCG TCCATCGATG CCTTTTTCAG AATGACGACG     20820
     CCCCGGAAGA AGAAGACGCC GCCTGCCACG CTCGCGATCG TTAGCACTGC ATTGATCGCG     20880
     TCCGCGAAGC GTCCGAAATC GGACGCCCCA CTGTACGAGA TCGGCCCGTA GCTCACCGTG     20940
     CCGGTACCAA ACGAGTTCCA CGTCGCGTTG ATGAACTGCG ACAGGTTCAA CAGCAGCCCA     21000
     CCGATCAAAA TGATCGGCAG GATGTCGCCG ATCGTCACCG GAGACTGGCC CGGCAACCGC     21060
     GACGCGCGCT GCATGCGCAA CAGCGAGTTA CCGACATACA GGATGCCGAC GACTGCGCCG     21120
     AGCACCCAAA GGAATCGCCA CATCGCCACC GAAAACGTGC TGGCGAAATG GACGACCATC     21180
     TGAGCCAGAT CCATAGCGCG ACGCTCCTAT CGAATGGTGC CGAGCGACGT CACCACTTGG     21240
     CGCGTCGAAG CATCGACGCG GATGATGCGC ATGCCGTCGA TCACGTCGCC GGCCTGGACG     21300
     ACATATGTGC GTTCGGCGTT CTGAATCCAC GCCTGATCCC GATAGACCGT GTTGAGCGTG     21360
     AAGTCGCCCG GCTTCGTGGC TCCAGTGCCG ACGTGCGACG TCGTTGCGCT AGTTGCATAA     21420
     CGACGCGGCG AGGTCGAGGT GTGCCTCACG CGGTGCTTCG GCTTGCTGAC GCTCGCGGTT     21480
     GCTGCGGCGG CCGGTGCGGG ACACTTCGCC GCCTGAGCTT CCGCGGCGGC CAGCTTGCCC     21540
     TGTAGGTCAT CGACTTTCGC TTGCAGCTCT GCTTCCTTCG TCGACGGCGC CTGCGCTGCT     21600
     GTCTCGCTCG CCGGCAACGG CGACGATGCG GCCGTAACAG CCGTCGCCGC TGAGGCCGCG     21660
     CTGGCCGACG GCGCATCGGT CGTGGCCACG CTCGACGCCG AAGTCGTCGG AGCTGACGCT     21720
     GCCGCCTGGT TGGCGCTCGC CTGGTACTGC TGTTGTGTTC GGCTTGCGTC GCTCATTGCC     21780
     TGATCGGGGT TGAGCATGCG GGTCGTCGTG GATGTATCCC GCGACGATCC ACCGAACATA     21840
     TGCGGCCACG CGATCCATGC CGCTGCGATG ATCGCCGCAA CAACCGCGAA ATGCACCGGC     21900
     CCCAGCTTCG AAGCAAAGCC CTGCAATGCT GGGGCTTTCG ACTTGGCAGT CTGAGCCGCA     21960
     CCGTCGTGCG TCTTACCGGC CTGATTCGAA CTCTTCGTGT CCGGCTTCAT GTTGAAAATG     22020
     TCCACGCCGG AATCCGGCTG TTTGTCCTTG TCTGTCGGGT CGCTCATATC GGGCACCTTT     22080
     TCGTATTGTA GACATTATAC GGAGTTAATA CCGAGGATAG TAGCCGTACC CCGACGGCTG     22140
     GTAATAGCCC GGAGGCGTAT AGCCCGGCAT GTTGTACGGC GTGCTGCCGT AACCGCCATT     22200
     CGGAGCCGTC GGCGGAAAGT TTTGGCGAGG CGGCTGCGAT GCCGGTTGGC CAACCGCGCC     22260
     CAGCGGGTCG GTACCGGGTT GCATCGGCTG CACCGGCTGG GTCGGACCTG TCGCGCCGGC     22320
     GGCCACGTCG TCGCTTGCCA GCACCGGACC GATAAACTGA ATCCAGATCG GCGTGTCTTT     22380
     CGGAATGAGA ACTTGCTTCA CCGGCATGTT GGCCGCATCG TTGGCCAGCA CCTGGCCCGC     22440
     CTGGTTGCCC ATGCCCCCCG CGATCGTCCC GCCCACCGCG CTCCATTTCG GCGTCGACGG     22500
     ATACGTCTGG ATCACACCGC CTTGCGGCGT GATGATGTTC TGCGCCGCCG ACTGTTCGAA     22560
     GAGTTGACCA GTTCGTCCGA TACCCATCGC GATCGCCGGA ATGATGATGC GCGAGAAGTA     22620
     ACGGTTGTTG ACCTCGCCCG ACAGCGCCGT GCGCATCGTG TCCTGATCCA TCGCTTTCGC     22680
     CGTGATCTTG TACGAACGCC CTTGCCACTT CATGTAGCTG AAGGTCATGT CCACCGTGTT     22740
     GGTGATGCGC TTGTAGCCCA TCGCGAACAA CACCGCCCCC GCATATTGGC CGCTCGGGAT     22800
     ATACGCCCGC ACCACGGAGT TCTCGTCCGT ATCGATAGCC GTCTGCAGCA TTGCTGGAAT     22860
     CAGCGCGAAG TCATCAACCA CCTTGACCTT CGCGGCCGCC GCTGCGGCAG CCGCTGCCGC     22920
     CTGCTGAGTA GCTTCGCTGG CCGACACGCG CGTCAGTGAC TTCGCGTAAT CAACACTGTC     22980
     CGTTGAGACG CGCGCAGTAC CGTGCGCCAC CGGCGCCCAG TTCGCCATCA AGCCCTGCAT     23040
     CTGGTCAGTG ACTTCCTTCT GTCGCTGCTG GTCTTGCTGC GGATTCTGCT GCTGGGCCGG     23100
     CTGCTGGTAA TAGACGACCT GCGGTTGGGC TTGCGGTTGG GCCTGCGGCG CACTTGCAGG     23160
     CTGCTCGGGG ACGTTGCTCG TGCGGCTCGA AAGCACCGAC AGATACGACT GTCCGCTTTG     23220
     CTCTGCGTCG GTCGCTTTGG CACGGTTGTA CTTGTCCAGA ACCTGCGAGT ATTGCTCGCT     23280
     TTCTTTGGTC GGTGTCCCGC GCCCTTGCGT CTGCAAGTTG CTGATCTGCG ATTGCTTGCG     23340
     GGAACTATCT GCGAAGTACG TCGCAGCGAT ATAGCCGATA GCCGCAACCG CCACGATGAC     23400
     CCCGATCGCG ACGACTTTGC TTTGGCGGCC GACGTCCGAT TGTGTACTCA TGCTCTGGCC     23460
     TCTCAGTTGA TGTCGAGTTG GAGCGTCACG GACCGGCCCA TCTCGGACAA CGTGACGTAA     23520
     GGGGTCGGCG GAAGCCGATA CACGCGCGTA CCATCAGCGG CGGACATGCT CTGATCGAAT     23580
     GCCGTCTGAA TGTCGTAGTT CGTGCGAACG AACATCGCGT CGCCGTACTG CCACACCTGC     23640
     GTGCGCGCCG GCACATCGCC ATGTGCCGTC ACGCGCTTTG CGTCGCGAGG CGGGATGCCG     23700
     TCAAGAAATG CCTGCATCGT GTCGTCGTAC AGCGCGACGC GCCCCGCCCC GAGGAACGGC     23760
     GCTTGCGCAT TCGGGCCTCT GCCCGGCACG CGCAGATCGA GGCGATAGTC GACGACGCGG     23820
     CTCTTTTCTT TCGAGTCCGG CTCACCCGTT GCCAGCTTCA CGACCACGGG CGTCGCCATG     23880
     CCCTGCAGGA AGACCGTGGC GTTGCCGTCT TCATAGGCCG ACAACGCCGA GATCACGACG     23940
     GACGGCGTGC CTTGCAGCCA CTCGACATCG AAGTAGCGCG GATCGGAGAC ACGCGGCGCG     24000
     ACTGCGAGCG GCCACGGCGC GCCGGTCGAA TCCACGAACA CGAGCGTCGT CTGCTCGCCA     24060
     GGCAACACAC GTGCGATCGG AAGCGCTGCA CCCGGCGAAA GGTCGACCGA AATACTGCTG     24120
     ATCCGCGGCA CGGTTCGAAC GGGGTGATAA GCCTTTGCCT TGCGAGAGTC ATCGAGCTGC     24180
     TGACGCAGCC TGACGATCTC GTCGTTGCTG AACGGCGAGA CGACTTGCTC CGCGCGCTCG     24240
     AAATTGCTCG GAGGCGCAAG CGGCGGCATC GGCGCGACGC CGTTTTGAGG TGCGGCTCCC     24300
     GCCGGATACT GCTGCGGGTA GCCCTGCGGG GGTTGTCCGG CCACAGCATA ATTCGCCGCT     24360
     CCATAGTTGG TTTGCGGGAA CGCAGCTTGG ATTTGCTGCT GCGAGCTCAT CGGCGCTTGA     24420
     CCAGGCGGCG GCGGAAAGCC GCCGTTCGGC GCGGCTGCAT TCACCCACTG CGGCGCCTGC     24480
     TGCGCCTGCG GTGCCGGTGC TGCTGGCGCC GGCGAAGCGA CACCTTGCGC GGCCGGTGCG     24540
     GCGCTTTGCT GCGCCGGTTG AGATTGAGGC TGCTGCGCGT TCTGAGCCAT CGCCGGTGCG     24600
     AGCGAGCTGG CCGCCAACGG TGCAACGAGC AAAAGGGCGA GTCGTTTCAT CGTTCGAGTC     24660
     CTCAAAGCGG CTTCGTCACC AGTTGGCCGA CGCCGATGCC TTCAATGGAG TCGAGCGTCG     24720
     AAACCCGCTC GATCCGAACC GTTGCGAGGA AGCGCTGCGC GGGAAGCTCA GATGTCTGCC     24780
     CGGAGAGCTT GACCTCGATC GGCATCTCGA CGTACCACAC GTAGACGCCG TTCTCGACGC     24840
     CCTCCTTTGT GAGAACGCCA GTGCCGGCAG TGACCGACAT GTTCATTCGG CGATCGCGAA     24900
     CGGTCGCGAG CACGCCAGAG GCTTGCAGCG ACGCGATAAA CGACTTGAAG CCGTCGCGCG     24960
     TGTAGTTGCC GCGCACGTCC TCGAGCTGTT GACGCCAGTT CAGGAAGTCC ATCGTGAAGG     25020
     AGCGATTCAT CGTGTCCTTC GCGTACTGGA TTACATCGGC CGCTTTGCGG TACGGCTGCG     25080
     ACATCGGGAT CAACGGGAAG ATGCGGCCGT TGTCGGAGGC GAAATACTGA CGGTCGGGGT     25140
     TGAACGCACG CCAGCCGAGC ACACCGTTCG CAACCACGCT AACGAGCAGG GCGGTTGCGA     25200
     GAATGAAGTT CAGCCTGACC GCCGAGCCTG CGATGAATTG CAGGTGCTTG CGATCCTTTT     25260
     CCATCCGTAC CGCTGGCTCG ACAGCATCGG CCGTCTGATG GAGTTCGGCG GCGATCTCTG     25320
     CGAGCTGCTC GTTCGCCGCA TTCGGGGATG CTGCATCGGG CTCAGTCTGG TCCCTCGGAG     25380
     GAAGCGAGCC AGCAGCTACG GCCCGTTCCT GGTTTGCTTC GTTCAGTGCG GTCATCGAAC     25440
     CACCTCCATT TTTCCGTATT ATAACCATGA TGCAAAAAAC GACAAGAGCG TGCAAGCACG     25500
     AGAATAGGCG CCTTTCATTT CATCAGGGGA GATAGCCGCA GCTTCCCATG CAGGATTGAA     25560
     TACGGAATGG AGGGAACGCT TCCAGGGGCC GGTCGGACAC TCGTATATCG CCGACGTTTT     25620
     GACGCCGGTT TCGTATATCG CCGACATGAC GGGAGGCTGC TCGATGCTCG CGAGACCGCA     25680
     TAAATCAAGG GAAATGCGCG AATCTCGCTC CCTACGGCTC TACTGGGGAT CTACGCCGGA     25740
     ACCCCAGAAA ATTCCGTCGT TCCACATTGT GAACATTAAT CGGCTTATTC CAGCCGAAGA     25800
     ATGTTGGAGC GACGTCCGGT GAGTGACATG ACGGTCTCGG TCACACGGAC CATCAGGACC     25860
     GTTACGCGGG GCCCAGTTCG ATTACATTGT GGGACAGGTC GAGACAATCT TCGCAGTCCC     25920
     GGCAAACCCA GTGCAGCATC GGCCCGACCG GATCTGGATG GTCGCTGAAC GTTGTCAGCG     25980
     CCGCGTCGTA CTGAGCATCG GACGTGCTCG AGCGCAGTAT CCGCTCGAGA TTAGACTCGA     26040
     TGCTGTCCAG GCTGCATTCA CCGATGCCGG ACTTGAACAC CGTCACACCG CCTGACGGGT     26100
     TGACCGCGAA GAAGAAAAAC GCCTTCGTGT CGACCATGTG CGACAGGATT GTCCTGGCGA     26160
     TGAAGTTGCT CGGATTGATC AGCGCATTGA AGATGCGGTA GCCGTAAAAC TCTAAGCCGA     26220
     AGTGTACGAC CTCGAAGTCG TCGGTGCCGC GTATCGAGTG GCCAAAGTTG AAACCGCTGC     26280
     GTGTTACGTC GTTCGGAATG TCATCCACCG GCCGCAGTGC CAGGCAAGCA TAGTGCGTCT     26340
     GGCCCTCGGC CACGAGTCCC ATCGCAAAGC AGGGCGCGCG CTCGGCCAGC AAGGCCTCGA     26400
     CAAAATTCCG GTTCATGCGG AGCGTTGGCA GCATCGGGCA TCCTTCATCG TGAATCAAAT     26460
     CAACATTTGC CGACCTGGCT GTGCGGTGCG TCGACGTCGA ACATCAAAGG CTATACATCG     26520
     TCGAGCTCGA ACAGCGCGCG ATCGGCGGGC CGCGACAGAT AATCGTCCAT CATCGCGCGG     26580
     AAATCGGCTT CATCCCACTC GCCGCGATCG ACACGCCGCA GCAACGCCTC GCCGGCCAGC     26640
     ATGATCTTTC GCTCGCGATC CGCGCGCGTT TGCTTGACCT GCTGGCGCTG CGCCTTAGCT     26700
     GCCGCTTTGC GGGCTGTTTT CAGCTCCTGC AGCTTTTCGT CTGTCGCATC GAGACGACGT     26760
     TTCAGCATGT TCATTCTGGC GTCCTGTTCG AAGAAGCGGT TTGCGCGGGA AACCGGCGCG     26820
     CCGGCGTGCG CCGGTTCGTT ACATTCGCGC CGTACTGTCG CGCCCAGGTG CGTACCGAGG     26880
     GAGCGATATC GACTAACGTC GGCGGCATGT TCGGCAACAC ATCCATCGTC CAGCCACCCA     26940
     GCCGCTTTGG CGCAATATAC GCCGGTCGCC AGCTGCCGTC GGCCAGGATA TCGATCACGA     27000
     ACAGCGACGT GCCGACGCTC AGTCGCCAGG TGTTGACCAC GGCTGGGGGT AAAGGATTAC     27060
     CTGGTTGTGG CATCGTATTC CACCGTAACA GGAATAAGGG ATTCCAAGCC AGAACCGCCG     27120
     AAAATTCGAT CACTCCAATT CGAGCCCTGC AATGAGCGCG TCCAGGTCGA TTTTGTTGTC     27180
     GCTTTGAAAA GTGTAGTGCC CGTTCAAAAG GATATGCCGC CAGGCTGCCG GTGATATCTG     27240
     CGTAAGCCGC GCCAGCGCCT TGGCGTTGCC ACTGGCCTCC CATTTCGTCA GTAGATGCGA     27300
     CAGAATCGCC GAGTTGTAAA AAATGATGAC GTTGGCGATC AGCCGGGCGC ACTGGTTGCT     27360
     GATCTCGATT TCGATGTCGG TGCGGCCGGT CAATTCCTTC TTGCCGCCGA CCTGGGCGAT     27420
     GGTCGAACGA AGCTGATGGT AAGACTCGAG GCGGTTTTGG GAGCGATGCA CGTTTCGCTC     27480
     GAGCTGCGGG TCGCGCAGGT AACGCAACGT GTAGATGGTA CGAATGAGCT TATCGAACTC     27540
     AAAAATCGCG CGACGTGTCG GGTTTTCCTG CGAGTACGTA CATAGTTTGC GGATCAGCGA     27600
     GCCCTGCGTG ATCTCTTTGA GGCCCAGCGT GGCGACGATC TGATCGATAT TTGTCTTCTC     27660
     ACTGGTGATG AGCTGCCGAT CGATTTGTCC GATCGGCTGA ATCAGGCATT TCTCGTACAG     27720
     CGCCGGGTCG TCGATACAAT ACAATTCCTG CAACTGGTCA TCGAGGTTTG TGAAGCGAGG     27780
     CTCGAAGCGC AACCCGAACC AATACAGGAT AGCGAAGTTG GCTTTGTTGA TGCTGTGCAT     27840
     GTCGCCGGTG ATCGCAGTCG GCACTATATC CGACGTGTTG CGATACCAGA TGTCGAACAC     27900
     GTGATGCGCC TCGTACTCGT GCGCGCCGAT TAGGTAGCCG TTCAACGGGA CATGATTGCA     27960
     CAGCAGCGTG TAGGCGACGA CGCCTTTGCC TCGTCCGAAG TATTTGCGCG AGTAACGCGC     28020
     CTTCACAGTC GGTCGCTCGA CGCCGAATTT CTGCCCATCG ACGGCGCTGT ACAGCGCATC     28080
     GAGATCGAAC GAGTAGTACG GGAAGATCGG CAGCGCGGCG ATGGCGTTGC TGATGCAGTC     28140
     GTTGGCCGCA TGCAGCGTCG CCTGACGCAG ATACTGCTGG TAGGTGCTAT CCAGAACGTG     28200
     GTACGGAATG TCGCTGGTGC GCGCCATGAC ATGGTTGCCA TGGTTCATTG CCTGAGCGAT     28260
     GATAACCGCC ATCAGGCTAT CGGCGTCCGC TACCTTCTTC GCGTAGCGCG GCTGCAATGG     28320
     CGTCAGCGCC GACAGGAACT GGCACTGGCC GTTGACGAAG CGGAACACGT CGGCAACATC     28380
     GCAGAATGGC AGTTGCTCGT AGAATGCCTG CTCACGCACC TTCTGGTTCT CGGTTTTCGG     28440
     TTTGCGCCAA ATCAGCTTCT GCGTATCCTT GTCGTATTCC AGGTGCGTAA GCTTGCCCTG     28500
     TTTCAGCTCT CGGTTGAAGG CCAGCCATTG TGCATGCAAC TCGGCCGCTA ACGCATCGAG     28560
     TTGGGCATCG ATTGGCTGCT GCAGGAACGG GATCTCCATC TGCGCCAGCG CGTCGGCCTT     28620
     CTCGTTCATC GAAACAAGCT CGTCGGAGAA GTGACGATGT TGCAGACTGT CGTCGAGATA     28680
     GATCTCTCCC GACTGGAAGC GCTTCCGGAT CTGGCGGTAC AACCAGAATT CGTAGCGATC     28740
     GGCGTGCAAA CCGGTCGGCT GACCATCAGC GCCGAAGATC AGCAGGTACG GTCGCAGGCG     28800
     CTTCGGCAGC GTGGCCGCGG GACATTCGGC GAGCGGTCGT TGTGACAGGC GCTGCTGTTT     28860
     GGCGAAGGCC CCCTTGACCC AAGCCAGCGC CGCGAGCCAC GGGTTGTCTG GGGAGGTGCC     28920
     GACGAAGTCG AGCTCGACGT ACAAGGGGCG CAGGTGACGG CGAATACGTT TGGCTAGGCC     28980
     GTCCACCGCC AACCAGTGTA GTGCCAGTTG ACTCAGCGGC TTGACCGTCA TGCGTTGCGC     29040
     CGTGTTTTGT AGCACATCTT TGGCCATGAT TTTATAGGCG CGCTGACGCA CCTCGCCGAA     29100
     CGGCGTCGGA TCGGCTACGC TGTCGTCCAC ATAGAGCGAC AACAGGCGGC CGATCTGCGG     29160
     CGTTTCCCGA TGGCGTTTTA CTTGCTCGGC GATGAGTGAC TGTTTCGCGC CCGCGCTGCT     29220
     TTCTTCCTCG AGCTGCTTCA TGTGGAAGGC CATCGCATCG ACCAGGTTGT CGGTGAGCTG     29280
     TCGGAAGCGC ACCCAGGCGT AACACAGCAG GTAGAGCTGC GCCTGATCCG CCTTCAGGTT     29340
     GCGCAGGTCG TGGACGGTAT AGAAGTTCGC CAGGCTTGCG TAGTACAGCA CGTTCTGCTG     29400
     CGAGATATCC AGCCGGGGCA GCAGCGTCCT GGCGATTTCG TGCAACGGCT GCAGCGTGCC     29460
     GCGCTTTTCG CGTTCGCGGA CCATCTGACG CCAGCCGAAA TTCTTGGCAT CCTGTTTCAG     29520
     CGCCGCCAGT TTCGACAGAG TATCATCGCG CACCAGAAGT TGGTCTAGCG CGGTTTGGGT     29580
     CAATTCGTCC AATACGCCGG TGAGCAGGTC GCCCAGCCGC CGACGTTCGA CGGACAGGGC     29640
     TTCGCTGACT AGCTCTTGCA AGGTCGTGTA GCCGGGCCGG ATCATCTTGT GCTCATTGAG     29700
     CCACACGATG AGCTCGGCGG CGACGAATCC CGGTGTCACG TCGCGACGTA CGATCTGCGC     29760
     GGCCTGCTGC ATGAGTTGCG GCAGGAAGGC GGCCACCCAC GGTCGATAGC CGTACAGTTC     29820
     AGCGATCTGT TCGCGCTGGG CGTAGTACTC GTGCCGGGTG ATCGGCTTGC GTTCGAACGG     29880
     CTCGCCGTGG AAATAGCGGC TCAACACGAA ATCGTAATCG TCCTCAACCT CGTCCCAATC     29940
     GAAGCGGAAG AAGGCGTGCT TGGACTTGAA GTAGCCAATC TGCAAGATGC AATAGACCTG     30000
     CGCGGGTATG GAGGGCCGGC TACTGGCGAG CGCCAGTTCG GATTCGGTCA ATGCCAGGTA     30060
     TTCCAGCCGC TGCGCATCGT CGAAATCAGG CAGGCCATAC AGGGCTTCCT GTTCGGCGTC     30120
     GGAAAAGACG CTGAGCAGCT TATTCTTGTT GATCATCGAC CATCCTCTCC ACGCAACGTC     30180
     AGATCCTTCA ATTTTGTGAT ATCACGACAT GGGGTACGAC AGAAATATTG AACTCCCGCA     30240
     TTCTACAGAG ATAAGCTTTA TTATCTCTGT GGCATTGTTT CCATATTAAA CTCGATGACA     30300
     TGAAAACGCG CCCCACGAGC CCGTCCGCCG CCGACATCCC GACCGACTTT CCTGATGCTG     30360
     ATGCACTGGC AGCGCTGCGT GCCTGGTACG AGGGCGCATC CTCGCGTGAG GCGGCACACC     30420
     GGTACATGCA AGATCGGCTC AGCCACAGCC AGTCAGCCCG CGGCGTCATC GGCCAGATCC     30480
     GCCGGCAACT GGCACTTTAT GCCCGTAACC GACAGCGGGC AGATCTGGCC ACGCTGTTCG     30540
     AATGCCCGGC CCAAAAGCGT ATGCATCATG CGCGCGCCAC CACGCAGGCT GTCGAGCTAC     30600
     TGCGCATCAT GCCTGCGCCA GCTCCGCAGA TCGGCGACGA CATTGCGCAC TGGCTGCCGA     30660
     ATCGCGCTGC CCGCACCCTG CACGCGGCCG GCATCCGGAC CCTGGCCGAT CTCACGGTAC     30720
     GGATTCCGCG TCGCCGGCAG TGGTGGACCG TCATTCCGGG TCTCGGGCCG GCCAGTGCAA     30780
     GAAGGATCGA GGCCTTCTTT GCCGCGTACC CGGCGCTCAC GGAGCGGGCC CGCGCACTGA     30840
     TCATCGCGGA TCGGCAGTCA GTCGTGACGC CTTGGGAGCA ACTACGGCTA CCGCACGAGA     30900
     TCGACGGATC CGCCGGCGCC TTCCGCGCAC CGGTGTCGGC CTGCATCCTC GGCGTCGACA     30960
     ACGATTACGA CGCTATCCAG GCATGGCTCG CGTTGCACGA ATCCCCGGCC ACGCAGCGGG     31020
     CCTACCGCAA GGAAGCCGAA CGGCTGATTC TCTGGGGCAT CGTTGCTCGC GGCAAGGCGC     31080
     TGTCTTCGCT GACCACCCGG GATGCCACCG ACTACAGGGC GTTTCTGCGC AGACCTACAC     31140
     CGCGAGAACG CTGGGTCGGG CCACCGCGGC CGCGCACATC AACGGACTGG CGCCCGTTTG     31200
     TCGACAACCT CTCGGCCCGT TCGATTGCGC ATGCGCTTGC CGTGCTCAGC GCCATGTTCC     31260
     GCTGGCTGGT CGAGCAGCGC TACGTCGTGG CCAACCCATT CTCCGGCATC AAGGTACGCG     31320
     GCAGCAAGCG CGCCATGGCT CTTGAAACCT CGCACGCTTT CACCGAAGGA GAATGGATGC     31380
     TGACGCGCAC CATCGCCAAC GGGCTCGAGT GGTCGTACGG CTGGCAGGCG CCCGCTGCGC     31440
     AACGGTTGCG GTTCATGCTG GATTTCGGCT ACGCAACGGG ACTGCGGATC AGCGAACTGG     31500
     CTGACGCCAC ACTGCGCAGC ATCGAAGTCG ACGCAGCCGG TGATCACTGG CTGCACGTGG     31560
     TCGGCAAGGG CGGCAAGCCA GCCCGCGTTA CCCTGACACC CCTAGCGCGC ACAGCGCTGG     31620
     ACCGATATCT GCAGGAGCGG GGGCTTCCTG TCAGCCGTGC TCACTGGAAT CCGACCACGT     31680
     CCCTGATTGG CAGCCTTGAC GACGCCGATG CCGGCATCAA GCCCTTGCGG CTGTGGGAAG     31740
     TCATGCGCCG GTTTTTTCGG CTCGTCGCGC AGATTATCAA GAACGACCAT CCGGTGCTGG     31800
     CTGAAAAGCT GCATCGGGCC TCTCCGCACT GGATGCGGCA CACCCATGCG ACCCACGCGA     31860
     TCGCCAGAGG GGTTGAGCTG AGCGCCGTAC GAGATAACCT GCGTCACGCG TCGATTTCGA     31920
     CCACGTCGAT TTACTTGCAT ACCGACGATG TAAAGCGGGC ACGGCAGTTC GGGCAGGCAT     31980
     TTACCGACTG AGTTACTCGC TCGGCACGTC AGGCAACAAA CCGATTGACG TTCACAATGT     32040
     GGAATGACGG AATTTTCTGG GGTTCCGGCG TAGAACCCCC TACTGGAGCA TGTGGCCATC     32100
     TGGCTCGTAC ATCGCCGACG CGGTTCGTAC ATCGCCGACA ATGTGGATAA GCCTCTGGAT     32160
     AGGCTGTTGA GGCCCTCGTA TATCGCCGAT GGATAGCCTC GTAGATCAGC GACAAAACGG     32220
     TCGTATATCG GCGACGGTCA TTTCGTACAT CGGCGACATA CGCAACTCGC AAAGCCTTGC     32280
     TGCGCAAGGC GTTTCAGAGT TTGCTCGGGA CGCTAACACG CGCGCGGCTG TTAACCCCCC     32340
     TTTTTTAACA AAAATTAGTA GTAACGCAAC CTCAAGCCCC CGCCTCTTGG GGGGCGCAAG     32400
     CGCCCCCCGC CGGCTCGCTC CGCGCTACGC GCTCCGCCCC GGCCGCGCAA GCGCGGCCTC     32460
     CCACCCGGCA TCCCCCAAAA AGTGGCGCGG CTCTGCCGCG CAAGCGTACC AAGGCCGCGG     32520
     CGAACCGGCT CACCGCGCGG CAGGCAAGCC TGCCGTGATG CCCTTCCGCG CCGCGGCCAA     32580
     ACGCATTCAA TGAAAAGAGA GGGCGACCTT GCCTTAACGG TCACACTTCG TCGAACCGTT     32640
     CCCGCATAAC AACGGCCGCA CTTCGTACAG CAAAAAATCA TCATCCAGGC GCTTCGCGCC     32700
     CCGACCACCC ACGAACTCCA CAGGCCAACT ACGGGGATAT TGCGGTATCC CCTTCGTGAC     32760
     CTGATGGATT TGTGGATGGC GAACGAGTGC GGGACGCTTG ACGACCAGGC CGCCGTCGGC     32820
     GGCCGCCCAC CCATCCCCCC GCCCTTCCCG CCCTGCGGGA AGGGAGCGAG TCGCCCTCTG     32880
     TCGTCAAGGG TGCGGGGGAG ATGAAACCAC CCCCACACCC TCGACTGGAG CGTCTACACC     32940
     GGCACGTCAG CCCCTCAAGG GCCGCTGCGC TGCCGTCCTC ACCCGTTCGG TGCTCGACCT     33000
     GGCCTGCGGC CAGCTCTGCG CTCCGCGTGC GGCTTCCGGG CGGCCCCTTG ACCGTCTGCC     33060
     ATGCCGAACA CCTTCCCCCA TCTTTTTACG CAATTACGTA TTTACGTATG TACGTAAGTA     33120
     GGCTATAATA GCCCCATGCA GTGAGGTTCC ACCCTCGCCG CATCCCCGGC CGGATTCCCA     33180
     CTGGCGGCTA CCAGTCTCCC GGCCCTACCT TCCAAACCGT CTAGGAGCTA AGCGATGAGT     33240
     GAGCAATTCG GCTTCGACTT TGGCGACGCT GCAAAAGCGT TCGCGCTGCA CGAGCCCGGA     33300
     ACGTGGCTTG ATCCCAAGTA CACGGTCGAG CAGTATCGCG CGATGTTTGC AAGCGGCGCT     33360
     GCGGCAGTAA CGCGCATCGC TGGTCCAGCG CGCCCGCTGT TCGTGCGTGG GCTCGCTCTC     33420
     GCCGGCGACG AGCTCGAGAA GATGGTGGAA CGCTGCGGCG ACGACAACGA GCCGCGCCAT     33480
     CTCTGGCGCG TGACGTGCAA TCCGACGGAC GACGAGTTCG ACGGTTTCGT CGCGCACTGC     33540
     CGCGCGATGG TCGGCGCTGC CTTCGATGGG ATCGAGTACA AGGTTCGGGA CGAAGATGGC     33600
     TGCGTGACGA CGGCTGCGAT GTACGTGCGC AATGTCGGGA CGCTGATCGC ATGGCGATGG     33660
     TCCGAGACGA ATCGTGCCAT CGATTTTCAG CCGTGGCGCG ACACGTTTTT CTTGGAGAGC     33720
     TACCGCGACG GGATTCAGGC GATCGAGGCT CCCTATGCAA CGTGGGGGCG CGCCTACTGC     33780
     GCCGACAAAC TCGCGAACTC CAACGACGGC ATCGCCAGCG TACCTACCTT CGTGGTGAAC     33840
     GGACGCGAAT ACATCAACGA CGGCGGTTTC AGCCGTGGCC CTTATCGCGA ATGCGAAGGC     33900
     TGGTCATTCA CCGCATTCGC TGATTGGAAA GGTCCGACGT TCAGCTATCG CAGCCAGTGC     33960
     CGGGCGTGGG ATGACGGCAG TCTGGAGCGA GGCGACCGGC GCGGGCTCGT CGTGCGCGTG     34020
     CGCGGCCAGC TATGTGTGCT CGACGGTGCA GTGAAAGTCT ACGATACGCA GGCTTCCGAC     34080
     GCCGCTTGGC AGGCTGATGA ATTCGACGAT GTGGGCGCCG AAGAAGACGT CGACCACGAC     34140
     GACGAAAACG AGCTGGAAGA AGAGGAAGTT GCCGTCTGAG CGCGGTAATT AGGATAATCC     34200
     GCGAAAATAT GGCAAATTAA TTAAAGCGAA GTGAGCGAAG CCCGGCTGGC GGCTACCAAA     34260
     CCGGGCTTCT ACCAGAGCCA AGGCCCGTCT AGGAGCGAAG TCTGGATAGT CACATGATAG     34320
     CTGTTCCGCC CATTGACCTC AAGCAAGGCC ACGTGGCCCG CTGGGAGTCG ACGACGCGGT     34380
     TCTATGAACT GCGGCTGTTC CGCGATTTCT TTGGCTCTCC TGTCGCTCTT CGCTCGTGGG     34440
     GCCAGAAAGA CGGCACGCGC ATTCGAACGC TTCAGACCAT TCTGGAGGCC GATCACGAGT     34500
     GCGCACCGCT CTTTCGCCTA GTGATTAAGC GCATGCGTGG ACGACCGTAC ACGCTTTGTA     34560
     AGATTTGTTG AGACAGAAGG ACCGGAGGCC GGATCAATGG CAGCAACACC CGTACCCAAG     34620
     GGGCAATACA AACCGTACAC GCAGACGGAG CTGTTCGCGG CGAACATGCT TGAATGGCCG     34680
     GTCAAGGACG ACTTGGCCAG CATGGAGTTC CCGCTGTTTT CTCTCTCGAA GCGACCTGAC     34740
     ACGAAGGTTC GGGAATACGT CAGCCCGTCG ACTCACAAGC GGGTGAAGGT CATTCCATCC     34800
     GTGTTAGGCG CAGCCACTGT CTTCGACAAG GATCTTCTGC TCTACGTCGG ATCGCAGATC     34860
     ATCGAAGCGC GGCAGGCGGG ATTGCCTATT TCCCGAACCG TGAAGATCGA TACCTACGCG     34920
     TTTCTGACCG GCACCGAGCG AGATCCGGGC GGCAAGGCTT ACGACAACAT GCTCGACATG     34980
     CTACGCCGGC TGAAAGGCAC GACGATCGAG ACGAACATTG CCACGGGTGG AGAGGAAGAA     35040
     ACGAGGGGTT TCGGGTGGAT TGAAGACTAC ACCGTCACGC GGCGAACCAA GAACGGAAAA     35100
     GGCGTCCTCG AGGTCGTCGT CATCGTCGCG GAATGGCTGT ACAAGGCTTT CCTGCACTAC     35160
     GAGGTGTTGA CGATCGATCG GCGCTATTTC TTGCTGACGC AATCGCTCGA GCGCCGCTTG     35220
     TACGAGCTCG CCCGTAAGCA CGCCGGCGAC AAAGCGATCT GGAAATGTGA CATCGAGATC     35280
     ATGCGCCAGA AGAGCGGCTC GATCCAAACG CTGCGGCACT TTCGATCGGA CGTGCGGGAC     35340
     ATTATCAGAC GGGACGCATT GCCAGACTAC CGCGTGGCGC TGGATAGCAG CAAAAAGCCC     35400
     CATAAGATCG TGTTTTATAC CCGCGACAGC AAGGCGTTGA CCAAGGAATT GCAGCGCATC     35460
     GACGGCTTCA CCTGGTTCGA GCAGCTCGAA CGACAGGGTA CGCTGCAGCT CGACGACTAG     35520
     CGCACTCGTA CTTCGCCGAC GCATGCCGCT GATGCGCGCC GGGATTGTTG CACCGACGCG     35580
     CTGTAATCCT CCCTGAGCGG CCCGTTCGTG GCCGTTGATT GGTCGCCTCT CTCAACAATT     35640
     CGGCGGCTTT TCCGGGCTTT ATCGCAGCTC CCTGCCCCTT TTCGTGTGTC GTATATCGCC     35700
     GACGTTTTGG CAGAGCTACT TACATACGTA AGTACATACG CACGTAACCA TTGGCCCATC     35760
     CCCCCGCCCT TCCCGCCCTG CGGGAAGGGA GCGAGTCGCC CTCTGTCGTC AAGGGTGCGG     35820
     GGGAGATGAA ACCACCCCCA CACCCTCGAC TGGAGCGTCT ACACCGGCAC GTCAGCCCCT     35880
     CAAGGGCCGC TGCGCTGCCG TCCTCACCCG TTCGGTGCTC GACCTGGCCT GCGGCCAGCT     35940
     CTGCGCTCCG CGTGCGGCTT CCGGGCGGCC CCTTGACCGT CTGCCATGCC GAACACCTTC     36000
     CCCTATCTTT TTACGCAATT ACGTATTTAC GTATGTACGT AAGTATGTCA ATATAGCTAT     36060
     ACCCTCTTCC TGCACGGAGG CGCAGATGGC GAACATGAAA TATTTCCACG GCGATCGCCA     36120
     GCTCACGGCC ATTGCTAGCA TGCCGAACGC CGAATTCGCG AAGCGGTTTC CGGGGGCTAC     36180
     CGGTCGTCGC TACGACGGCT ACCAGATGCT GGTTGGGTCG CCGGTCGACG CCCGTGACCA     36240
     GGTGCTGCCC GTCGAACGGG TGATCGAGTA CAAGGCGAAT CCGAGCCGTC ACGAATGCGA     36300
     CGCGCGCTGT CTGAACGCTA CCGGCAAGAT CATGCGCTGC GAGTGCTCCT GTGGAGGGAA     36360
     AAACCACGGG CGAGGCTCGC TGTAATTCAT TACGTATTTG CGTATGTACG TATGTATGTA     36420
     TGTACGCTAT AATTGCGCGG TGCCATCGAA GGGCGGCACC GGCGAATGCT CGGCGGCTAC     36480
     CGAGCTTCGC TGTCCACCAT TCCGTCTAGG AGCATGACAT GAAGCAACCG ATTCAATCGT     36540
     CCGACCCGGA CGCAATCGAG AAGCTGGAGG CCGAGATCGA GCGGCTCAAG GCGTCTCTCA     36600
     AGAAACGAAA CTGAAGGCGG CCGTGTTCAT GCGACCACCT CTACGGGATG GATCTGGAAG     36660
     CCGAGCGCCG CCGCGCGGCG TCTAAGGGAA GCGACGCTGC GTTGGTGCTG TTGCTCCTCG     36720
     TAACGCTGCT GGCCCTGGTC GACGAAGGCC TCGCCGCGGG TCAGCATGAA GTAGACCATC     36780
     CGCGCGAGCT TGTGCGCGGT GGCGGTATTG GCGCGCGGCT TATCCATGCG GGCGCACAGA     36840
     CGACGGTAGA ACGCGCCGAG CGCGGAGTCA CTGTGCGACA ACGACATGGC CGCCATCTTC     36900
     AACGCCTGGC GCGCCCGGTT GGCTGATCGT TTGGTGCCCG AGGACAGTAC CTTGCCACCG     36960
     CTGATCTTGG TGCCGGGACA TAGTCCCAGC CAGGAACAGA AGTGCTTGAC GTTGGCGAAG     37020
     CGACCCAGAT CGGGACCGAT CTCCGACAGG AGCTTCATCA CTACCGTCAC CCCCAGCCCG     37080
     TTGATACGCG TGAGGTCCAC GCCGGCCCAG TTGGCTAGCG CCTGGCGCAC GTCGAACTCC     37140
     ATGCGCGCTT TGGCGCCGGC CTTGGGGGCC TTGCCCAGGT CGACACGACG CTCGCTGCGC     37200
     TCGGCCAGCA GTTCGCGCAG CTTTGCCTCG CACTCGACCA GATGCCTGCC GATGTCGTCG     37260
     TACATGGCCA GCGCCTGGCC CAGCACGAAC AGGTGTTCCT CGCGCCAGTT GCCCGTCAGC     37320
     GCCTTGATGA TCTCCTCGGC GCTGGCCTTG ATGCGGCTGT GGCGGTGCCG GGCCAGTATT     37380
     TTCGGGTCGC GTTCGCCAGC CACGATGGCT CGGATGATCG CCTGGCCGGT CTGCCCCATT     37440
     ACGTCGCTGA GCACCTCGGT GAGCTGGATG TTCATCTGCA CCAGCGCTTT CTGCATGCGC     37500
     TGCACCCAAC TGGCCTGTTC GGTGAGCAGC ACCTCGCGCT GACGGGCCAC GGCCCGCACC     37560
     ACGCAGACTT CGCTGCCAGG ACGCCAGGCC GCGCGCAGTA GCCCGAGACT CATGAGCTTC     37620
     TGCAGCCACT GGCAGTCTTG CACGTCGCTC TTGCGCCCGG GCACGTACTT GAGCTGCCGA     37680
     GCATCGACCA GCCAGACCTT CAATCCTCGC TGTTCCAGCA CCTCATACAC GGGGATCCAG     37740
     TACACCCCGG TGGACTCTAG CGCCACCGTG TCGATCCCGC AGGCTAGCAG CCAGTCAGCC     37800
     AGCGCGTTGA GGTCGTCGGT CATTGCGCCG AACTCGCGTA CTGGCTCGCA GCCGGCTTGT     37860
     TCGGCGAAAT GCCGCGGCAC GGCCGCCCAG TGGCTCGACG CGCCCACGTC GATCCCCGCC     37920
     GCGTTGGGGA ATACCACCTC GTCGTCTCGC TTGCGCATTG CCATGGCTTG CTCCACCATC     37980
     GTTGATGAAC GGCAGCGCCA TGGGAAGCGT CGAATTCGAC TCGATCTCTC AAACGGGATG     38040
     CGGCTCACGC CGCTCACCAC TGTCGCCGAC GATTCCAGGA CCAGGCTCAG AAGCGGGCTC     38100
     ACACCGTGGC GTCTGATCGC GTCACGGGCT CGCACCAATG GCATTTCGGT CATCTCGGCG     38160
     CTGCCGTTCC CTTTATAGGG CAGAACCGTT TCTTCGCGAA CGCCGGGCAC AGGCATGGGT     38220
     TTGGGAAGCT CAGAAGATGA TGCGGGCCGC GAACACCGCC CTGCGCAAGA ACGACGACAA     38280
     CGCCCTGAGA GCTTTGGGCT TCTCCGAGGA GCACATCGCA GAGCTGAAGA CCCAAGACTT     38340
     CGCTGGGCGC GTCGGCTTTC CTCAATCCGC GCTGCGCAAC AACAACGCCG ACATCCGTCG     38400
     GCTCAAGAAG CGGATCGCCG AGCTGCAAGC ACGGGGAGAA AGCGATGCTG ACCGTTGACC     38460
     TGAAAATGTC GTGGGCCAGC CTGTTGCCCG TTCTCCTCGC CGGCTACGCC GACGGGATGT     38520
     TCGCGAGATC TCACCAGCAG ATTAACCTGT AATGCCGTAC TTACGTATGT ACGGCATTAC     38580
     GTAGTGCGCA AGAGGGAATC ATGGAACGCC AATACCGGGT CTTCTATCGC ACCCCCCAAT     38640
     CGTTCGACGA AAGGGCGCAT ACCGTCAAAC TCGCAGTTGG AGACAGCACC GACGAGAACA     38700
     CCATCGAGTT ACTGCTGCTC GCGCAGGCCA AGCACGAGAT TGCCGCGGAA GTCGGGCGGC     38760
     CGCCGGACCA GGTGCATATC AATGGCTTCA GCTTGCTTTC GGACTGTCAC TAAGGCATAA     38820
     TTACGTAATT ACATACGCAA GTATGTACAG AAAGGAGAAA TCCATGACGA AATACGCGGT     38880
     TGTTAATACC AAGGGTGGCG TGGGCAAAAC GACGACAGGC GTTCATTTAG CGACGCATCT     38940
     TGCCTACTCC GAGCCTACCC TTCTGATCGA CGGCGACCCC CAGGAGACGG CAGCTACATG     39000
     GGCTGCCTGG CGCCGCGATA GCGACGCAGT GAAGGGCAAG CCGTCGCCGA CAACGACGTG     39060
     CTTGCGCGGT AAGGCGATCT TCGACGAGGG TAAGCAACTG TCTAAGGGGT TCGTACACAC     39120
     GGTCGTGGAT GCAGGCGGTC GCGACGCGCC GGGCTTGCGT AACGCGCTGC TGCTGGCCGA     39180
     TCTGGCGATC GTTCCGGTAG GTGCATCGGG CTTCGACGCT GCTGCGATGA CGGATCTGCT     39240
     GGAAGTCGTC GACTTGGCCA AGGATTACAA CCCCGAGCTG CGCGTGAAGA TCCTGCTGAC     39300
     GCGCATCGAC CCCCGCACCA AGGATGGGAA GGAGATGCTC GAGTTCCTGC AGGAAAGCAA     39360
     GCTCGACGTA CTGAATGCGC GTGTGTGCGA GCGCGTGGCG TTCCGGCGGG CTACGAGCGA     39420
     GGGCAGCACG GTTGAGGAAA TTGGCAAGGA CAGCCAAGCC GTGGCCGAAA TGGCCGCGTT     39480
     CTACGAGGAG GTGAAAGCAT GAAGAAAAAG CCGTCTCTGG ACGAATTCCG CAGCGGCGGT     39540
     AGCGAAGGCG CGGTTGAAGC ATCGGCGCCG GCTGCTGCGG CGCCTACGGT TCCGGTCGTG     39600
     GCCGAGCGCA CCAATAAGAC TATCCGCATC CGCAAGACCT TCGAGGCCAA GCTGAAGGAA     39660
     GATGCGTTTC ATCGCTCGCA AGCGGAAGGC CGTCGGGTCA CGGAATCCGA CATCATCGAC     39720
     GAGGCGCTCG AGTTCTATTG GGCACAAAAT AAGTAATTAC GTATGTACGT ACTCATGTGC     39780
     ATACGTAATT CGAGGACGAA CGGGATGCGC TGGGGGAAGG CTGATAAGGC GATGTGTACG     39840
     TAATTACGTA TGTACATGAA TTTTCAAGAA GGCCGCCTGC GGGCGGCTTT TTCGCATCTG     39900
     CGCGCAGCGG AGCAGGGGCA GGCCGCCGAG GGCGGCCGCA CCCGTTCGGT GCTCGACCTG     39960
     GCCTGCGGCC AGCTCTGCGC TCCGCGTGCG GCTTCCGGGC GGCCCCTTGA CCGTCTGCCA     40020
     TGCCGAACAC CTTCCCCCAT CTTTTTACGC AATTACGTAT TTACGTATGT ACGTAAGTAG     40080
     GCTATAATAG GCCATGCAGT GAGGTTTCAC CCTCGCCGCA TCCCCGGCCG GATTCCCACT     40140
     GGCGGCTACC AGTCTCCCGG CCCTACCTTC CAAACCGTCT AGGAGCAAGA CATGCAAACC     40200
     GAGAGCAGGA AGTTCACGCG TCACATTACC GGCGACGAGC TCATTGCCGC TTGCGATCGT     40260
     GAAGGAGGGG TGAACAAGGT AAGCGCAAAT TCCTATCATA GGCTTTATGG TTATAAAGAT     40320
     TGCGGCGATC ATTACGAATT GACGCAGTAA GCCCGATTTT TCTTGCGCTA ATCTGAGCGG     40380
     CCCTCTGCGA TCCGGAAGAT CCGCAATGGC AACCCTCGAA CGCACCGCGT ACCCGCGCTT     40440
     CCCCGAGGTT CTGGCGCGCC GGGAACTGCA AGCCTGCTAC ACGCCGCTGT CCGATGAACT     40500
     CGAATGGGCA CGCCGGTCAA CGAGGGGCGA GCGACCTCGA TTGGGCCTGC TGGTGCTGCT     40560
     GAAGGTCTTT CAGCAACTGC ACTATTTCCC CCCACTCGAT ACCATCCCAA CCGCCATCAT     40620
     CGATCACGTC CGGGCGGCCG CCGATATCGG CGGCACCGTG CATTTCGGTT ACGACACTGA     40680
     GACCTCCCCA ACGCTGTTCC GGCATTACGC GGCAGTTCGG GCCTACCTGG ACGTGAAGCC     40740
     GGTCTACGGC ACCGATGCGA ATGCGATCGC GACACGGGCG GCGCACACGG CGTCGGTAAC     40800
     GATGGACCAG CCTGTCGACA TCATCAACGC GACGATCGAT GAGCTGATCG CGCGCGATAT     40860
     CGAACTGCCG GCGTTCTCGA CGCTCGATCG GCTCACCGAG CAGATCCATG CCCGGGCCCA     40920
     ATCGAGACTC TTCAAGCGCG TCACACGACG CCTGACCGAT GAACAGAAAC TCGCGCTCGA     40980
     CCGGTTGCTC GCGCGGGATC TGTCGAGCCG GCAGACTGCC TACAACCGGA TCAAGCGTCA     41040
     TGCGAAACGT CGCGACGTGA GATTGTCCAG CTCGTTCTCG AGATAAGCGG AGGGCTAACG     41100
     GGCGCCATAT CTACGATCCT CAACGAAGCA GCAGAGTTGG CGATCAGGAA CGATGACGAG     41160
     TGCATCGATA TCGCTCACCT TGAACGAGTT GCCCGCGCGC ATGTCTGACA CCCACAGGCC     41220
     GTGGCCTGGC CTATCGCACC TCGCCCCTTT CTGGAAGAGG CGTTTGGTGG CTGGTTGGGT     41280
     CGAATCGCGG CGCGGTATCA GACGAGCGTA GACTTGATCT GGGAATCGGG CACAGGCGTA     41340
     GCGATGCCTA GCCTGACCAA GGCCGGCTGG ATCCTCTTTC CCCCAGTTCC ATCCCCAACC     41400
     CTGAGCCGTC TATCTCGCGC AGCGCGGCTC AACGACGGCA TTCTGAGCAT GATCCAGACG     41460
     CCGCATGAGT GGGTCTTCGA CCAGAAGTAC CTGGTGTATT GCTTCAGATG TCTTGTTCTG     41520
     AACGACGCCG ATGTCACTGC ATCACGGTGG AAGAGGGAGT GGCTCGATCC GTCAGCCGAC     41580
     TACTGCCGGG TGCACCACAG CCTGCTCGAG ACTGTTCCGC AATCGATTTT TGCAAGAGCT     41640
     CCGAATTTCG ACGCCGCGCT GCGGGCGATA TCACGTTATC GATGCCCACC GCTTAGGCTG     41700
     AGCAAAACAC TACGCTAGCA GTATTAGTGA ACATTGCTAG CACTCCTTTG GGCACGGCTA     41760
     GCATTGATTG TGAACTCCTA CACACGGCCT GCGCAAAGTC GTCGATCTCA TCGGCGCTGT     41820
     ACGGAAACGG ACGTCTTGCA TGGACCGTCG CGAGATCGCT CGAAATGCCT TTCGGCAACT     41880
     CCTGCGCTTC GCGCACGGCG CGCCGCGCGT GCGGACTCAC CGACGTCGTG AGCACCGCGC     41940
     TCACGCGCAA TTCGGTCACG ATGCCGATCT GCCCCATATC AGCAATTGCT GGGGTGTGCA     42000
     TTTCAGAAAT TTCTGATCTG AGCGACCTGC GCCCCTTTCC TGGTTCGCGA ATTTTATGAC     42060
     AGCGCCCCCG CGATTTTTCG ATGTGCGATT GCACAATGAG CTCGACCTCG TTTGCTAACA     42120
     CCTCCATAGA TACCCTGTGT TGTATCGATT CTGTGTGACG GTTGTGCGTC CTTCGGTTTG     42180
     TGCCTGGCAG AAGGCGGCAC CCAAACGCAG GAGGCATCTG GCCGTTTAAC GCAGGATGCT     42240
     CGGAACGAAT TTCGACAGAT GACGATCCCG CAGCAGCTCA ACTGTAAATT CGTTGCTGCA     42300
     AAGCAGCAAT AATGGCACGT TGCTACCGAT GGCACGGGGC TTGCTTCGGA ATATGAAAAC     42360
     ACAGAATCGT GAAAACACGG AATCGGAGAC ACAGGCGATG CACAAGCAAG CAGCCCTTGA     42420
     GGCGGAACCC AGGTTCGATC CGAACCTCAG GTTTGTCAGC GTTACCGCCA TCAACACACA     42480
     GGGATTCGTC CAGTTCGAAT TTTCAGTTGG CACCCCCGAG CTCTGTGTCG AGCTCATGCT     42540
     GCCCGTTGCT GCGTTCGAAG AATTTTGCCT CGCGCAGAAG GTGACGCGAT TGGATGCCTT     42600
     CGGCGAGATT GTGCGGCATT GATTTTCTTG TGAGCAGCGC CGAGCAGCCT GATGAAGCGC     42660
     GCCTAGTCTG ATCGCATCCC ATCCCGGTTC ACAACCACAG GAGCAGTTAA TGACCATCGA     42720
     TTTGAAGACG CGGGAAATCA AACCACTGCG TCACACCTAC ACGCACGTGG CTCAATACAT     42780
     CGGAGCCGAT AAAGCCGCTT CGCGCTATCA GGAAGGCACT GTAGGTGCTC AACCCGCAGC     42840
     GAATTTTCAT TACCGGCCCA CGTGGGATCC CGAGCATGAA CTGTTCGACA CGTCGCGTAC     42900
     CGCGATTCAA ATGAAGGACT GGTATGCGCT GAAAGACCCG CGTCAGTTCT ACTACGCGTC     42960
     GTGGACGATG ACCCGAGCGC GGCAGCAAGA CGCGATGGAA TCCAACTTCG AGTTTGTCGA     43020
     GTCGCGCGGC ATGATCGATC TCGTTTCCGA TGAGGTTCGA CAACGGGCGC TTTCCGTTCT     43080
     CGTGCCTTTG CGTCACGCGG CCTGGGGCGC GAACATGAAC AACTCCCAGA TCTGTGCCCT     43140
     AGGTTATGGC ACGACCTTCA CTGCGCCGGC TATGTTCCAC GCAATGGACA ATCTGGGTGT     43200
     AGCGCAGTAT CTCACACGAC TGGCGCTGGT AATGTCTGGA CCCGATCTTC TTGACGAAGC     43260
     CAAGCAAGCC TGGATGACGA GTCCCGATTG GCAACCGTTG CGTCGTTATG TGGAAAACAC     43320
     TCTGGTGCTG CAAGATCCGG TGGAACTGTT CATCGCCCAA AATCTGGCGC TCGACGGTCT     43380
     TCTTTATCCC ATGATCTACG GCGCTTTCGT CGACGATTAC ATCGCACTCA ACGGTGGTAG     43440
     CGCAGTGGCA ATGCTAACCA CTTTCATGCC CGAGTGGCAT GACGAATCCA GTCGCTGGGT     43500
     CGATGCGGTA GTAAAGACCA TGGCGACGGA ATCGGAGGAT AACAAAGCGC TGCTCATTCA     43560
     CTGGTTGCGT ACCTGGGAAG ATCAGGCGGC GTCAGCGTTG TTGCCTGTCG CTGAAATGGC     43620
     TTTGGCGGAA AACGGCCACG ACGCCTTGGA AGAAGTAAGG CAGCAACTTC GTGCCCGCGT     43680
     TGCGAAGGCC GGGATTGTTC TGTAACCCCT AATTTATATT CCTGACCGTC ATAGAGGAAT     43740
     GTTCATGTCT AACGTATTTA TCGCGTTTCA GGCTAACGAG GAGTCTCGAC CGGTGGTGGA     43800
     GGCGATTCTC GCTGATAACC CTAAGGCGGT CGCCACAGAA TCGCCTGGCA TGGTGAAGAT     43860
     CGATGCGCCC GGGCATCTCA CAATAAACCG TCAAAGCATC GAAGACCGGA TCGGCATGAA     43920
     GTTCGATCTC CAGCAAATCC ACATCAACCT GATCACCTTG TCCGGATATA TCGACGAGGA     43980
     TGACGAACAG TTCACGCTGA GCTGGAAACA CTGAACACGG CAAAGAGGAA ATTGAAATGG     44040
     ACACTTCTGT GCAGAAGAAG AAACTCGGTT TAAAGGATCG CTACGCAGCG ATGACCCGCG     44100
     GTCTTGGCTG GCAGACCAGC TACCAGCCGA TGGAGAAAGT GTTTCCGTAC GACAAGTACG     44160
     AAGGCATCAA GATCCACGAT TGGGATAAAT GGGAAGACCC CTTCCGCCTG ACCATGGACG     44220
     CCTACTGGAA ATATCAGGGC GAGAAGGAAA AAAAGCTTTA CGCCGTCATC GACGCTTTCG     44280
     CGCAGAACAA CGGGCAGTTG AGCATTTCCG ACGCGCGATA TGTCAACGCA CTCAAGGTGT     44340
     TTATCCAGGG TGTGACACCG TTGGAGTATA TGGCACACCG AGGTTTTGCC CACATTGGTC     44400
     GGCATTTTAC GGGTGAAGGG GCACGTGTTG CTTGCCAGAT GCAGTCCATC GACGAGCTGC     44460
     GTCACTTCCA GACCGAAATG CATGCTCTCT CGCACTACAA CAAGTATTTT AACGGTCTGC     44520
     ACAACTCCAT CCATTGGTAC GACCGGGTTT GGTATTTGTC GGTGCCCAAG TCATTTTTTG     44580
     AAGACGCGGC CACCGGTGGA CCGTTCGAGT TTCTTACCGC GGTGAGCTTT TCGTTCGAAT     44640
     ATGTGTTGAC CAACCTGCTG TTTGTCCCCT TCATGTCGGG TGCTGCTTAC AACGGGGACA     44700
     TGTCTACGGT CACTTTCGGT TTTTCGGCGC AAAGTGACGA ATCGCGCCAC ATGACACTCG     44760
     GCATCGAATG CATCAAGTTC ATGCTGGAAC AGGATCCGGA CAACGTGCCC ATCGTGCAGC     44820
     GCTGGATCGA CAAGTGGTTC TGGCGCGGCT ATCGGCTGTT GAGCATCGTG GCCATGATGC     44880
     AGGACTACAT GCTGCCCAAC CGGGTGATGA GCTGGCGCGA GAGCTGGGAG ATGTACGTCG     44940
     AGCAGAACGG CGGCGCGCTG TTCAAGGATC TTGCGCGTTA TGGCATCCGC AAGCCCAAGG     45000
     GCTGGGACCA GGCTTGCGAA GGCAAGGACC ACATCAGCCA TCAGACCTTC GCCGTATTCT     45060
     ATAACTATAA CGCCGCGGCC CCCATCCACA CCTGGGTTCC CACAAAAGAA GAAATGGGAT     45120
     GGCTGTCGGA GAAGTACCCC GAGACGTTCG ACAAGTATTA CCGTCCGCGT TGGGACTACT     45180
     GGCGCGAGCA GGCCGCCAAG GGCAACCGTT TCTACAACAA GACGCTGCCG ATGCTCTGCA     45240
     CTACCTGCCA GATTCCGATG ATATTCACCG AGCCTGGCGA CGCAACCAAG ATCTGCTATC     45300
     GCGAGTCGGC CTACCTCGGC GACAAGTATC ACTTCTGCAG CGACCACTGC AAGGAGATTT     45360
     TTGACAACGA ACCCGAAAAG TTCGTGCAGT CATGGCTTCC GCCGCAGCAA GTGTATCAAG     45420
     GAAACTGTTT CAAGCCGGAT GCCGATCCGA CCAAGGAGGG TTTTGATCCC TTGATGGCCT     45480
     TGCTCGACTA CTACAACCTG AATGTAGGCC GGGACAACTT CGATTTCGAG GGATCGGAAG     45540
     ACCAAAAGAA CTTTGCTGCC TGGCGTGGAG AGGTCTTGCA AGGAGAAGCC AAATGAGCGT     45600
     TGTTGCCCTC AAACCCTACA AGTTCCCGGC ACGAGACGCG CGCGAAAACT TTCCGGCGCC     45660
     GTTGCTGTTT ATCGGCTGGG AAGACCATCT GTTGTTTGCG GCACCTGTTG CCTTGCCCCT     45720
     GCCGTCGGAC ACGTTGTTCG GTGCGCTGTG CACCCAGGTG TTGCCCGGCA CTTATGGCTA     45780
     TCACCCCGAT TTCTCAAAGA TCGACTGGAG CCAGGTGCAG TGGTTTAAGT CCGGCCAGCC     45840
     GTGGCATCCC GACCCGGCGA AGTCGCTGGC TGAAAACGGT CTGACGCACA AAGACGTGAT     45900
     CCGCTTTCGC ACGCCTGGCT TGAACGGTCT GAGCGGTTCC TGCAATTGAG ATTGCGTCAT     45960
     GGCAGCGCAA TCACACCGCA GCCGAAGTTA CAGGCCGCGG TGTGATTGGC CTCCGGCGAT     46020
     TTGAACAATG ACCTATCAAC TCAACATTCA GCCCCTGGGC GCCACCATTG AGGTGGAGGA     46080
     AGGGCAAACT ATACTCGACG CGGCCTTGCG CCAAGGCATT TACATTCCGC ACGCGTGTGG     46140
     TCACGGGCTA TGTGGAACCT GCAAGGTGCA GGTGTGTGAC GGAGAAGTCG ATCTCGGCGA     46200
     TGCGAATCCC TTCGCGCTGA TGGACTTCGA GCGCGAGGAG CGCAAGGCGT TGGCCTGCTG     46260
     CGCCACCTTG CTCGATGACA CGACCATCGA GGCCGACATC GAGGAAGACC CGGACGCCGA     46320
     AGTCATCCCG GTCGAGGATT TCAATGCCGA GGTGACACGC ATCGAGCAAC TCACACCGAC     46380
     GATCAAAGCC GTCTTCCTGA GACTCGATCA ACCGATTCAT TTTCAGGCGG GTCAGTACGT     46440
     GCAACTTGAA ATTCCCGAGT TGCGCCAGAC ACGGGCGTTT TCCATCGCCA ATTCACCTGC     46500
     GGACGTCGCA GCAACGGGAG AGATCGAGCT CAATATTCGC CGGGTTCCGG GAGGACAGGG     46560
     CACGGGTTAC ATCCATGAAC AACTGGCGGT GGGGAACATT CTGCACGTGA CGGGTCCCTA     46620
     TGGCCGGTTT TTCGTGCGCA GGTCAGCCGA CCAGCCCATG GTTTTCATGG CAGGTGGTTC     46680
     AGGCCTGTCG AGCCCTCGGT CGATGATTCT CGACTTGTTG CAAAGCGGAT GGAGCAAGCC     46740
     TATCACCCTG ATCTATGGCC AGCGCAATGA GGCAGAACTG TATTACGACG AGGAGTTCCG     46800
     CGAGCTCGGC CAGCGGTATT CGAACTTCAG CTACGTACCG GCACTATCGG AAAAAGCAGA     46860
     AGGTGCGACG CATCCCTTGG CGCAGGGTTT CGTTCACGAG GTCGCCAAAG CTCATTTCGA     46920
     GAACAACTTT TCCGGCCACA AAGCCTATTT GTGCGGGCCG CCGGCAATGA TCGACGCCTG     46980
     CGTCACGACC CTGATCCAGG GCCGGTTGTT CGAACGCGAC ATCTATTTTG AGAAGTTCAT     47040
     TTCCGCAGCC GATGCCCAAC AAGTACGCAG TCCGCTTTTC AAGAGGGTGT GATCGTGACT     47100
     ACTCAGGACG GGAAGGTCTA CGTGACCGTC AAGCAGACCG GCGAGCGTTT CAGCTGCGCT     47160
     CTGGGTGAGT CTCTGCTTTC CGGCATGGCA CGCCTTGGGC GTCGCGGCAT ACCAGTTGGT     47220
     TGCCTTAGCG GCGGGTGCGG AGTGTGTAAG GTCGCGGTGT GCAGAGGCAG CGTGCGCAAA     47280
     ACTGGAGCAA TGAGCCGTGC GCACATTTCC GAGGCGGAAG AAGCGCAAGG TGTGGTGCTG     47340
     GCGTGCCGGG TGGCTCCCAC TGATGATGTG GAACTGGAGG TGGTCGGCAA GATGCAAAAG     47400
     CCCTTTTTCA AAGGGTTCAG CTTTCAGGTA GCCCAAGATT CAACGAAATA AGCCGAAGGA     47460
     GATTAGACCA TGAGTGTGAT GCGAATCGGC CATGCGAGTC TGAAAGTGAT GGACATGGCG     47520
     TTGGCAATCA AGCACTACGA AAACGTCCTG GGAATGAAAA GGACGATGGA GGACGAACAT     47580
     GGAAATGTGT ACCTCAAATG CTGGGACGAA TGGGACAAGT ACTCGGTGAT TCTGACGCCG     47640
     TCCGATCAAG CGGGGCTCAA CCATGTCGCC TACAAGGTTG AGCACGATGC CGACCTGAAT     47700
     GCGCTGCAAA AGCGTATCGA AGCCTATGGC ATCAAGACAC AAATGCTCCC CGAAGGTACC     47760
     CTTCCTTCGA CCGGTCGTAT GCTGCAGTTC AACCTGCCGA GCGGACATGA GATGCGTCTG     47820
     TTTGCGACGA AGGAATATGT GGGCACCGGA GTCGGAACGA CCAATCCTGA CCCGTGGCCC     47880
     GATGACGTCA AGGGGGCAGG CGCCCATTGG CTGGATCACT GCCTATTGAT GTGTGAACTC     47940
     AATCCGGAGA CGGGCGTGAA TCGGGTGGCG GAAAATACCC GATTCATGAA GGAATGCCTG     48000
     GACTTTTATC TGGCTGAGCA AGTTATGGTA GGTCCGGATA GTAGCATTCA GGCTGCAACG     48060
     TGGATGTTCC GCACGTCCAC GCCGCACGAC ATCGCTTTCG TAGGTGGGCC TCGCAATGGC     48120
     TTGCACCACA TTGCCTTCTT CCTCGACTCG TGGCATGACG TACTGAAATC GGCCGACGTC     48180
     ATGGCCAAGA ACAAGGTCAA GATCGACGTG GCGCCGACTC GCCATGGGAT TACCCGCGGG     48240
     GAGACAATCT ATTTCTTCGA TCCAAGTGGG AATCGCAACG AGACCTTTGC CGGCCTGGGC     48300
     TACCTCGCTC AACCTGATCG GCCTGTGACG ACCTGGACGG AAGAGCATCT CGGCAGCGGC     48360
     ATCTTCTATC ACACCGGGGA GTTGGTCCAG TCGTTCACCG AGGTTTACAC CTGACTGCCA     48420
     CGCAGGAGAT AGCACATGAC TCAGGCTGAC TCACTTCATA GCGTCGAGGC GCGGCTGATC     48480
     AACTGGCCTG CGGCTAACCG CGTCGTCGAG GCAGCTGCGA TGCACGCGCA GCGCCTCGGC     48540
     GTATGCGTGA ACATCGCGGT GGTCGACGTG GCGGGGAATC TTGCCGCGTT TCTGCGCATG     48600
     CCTGGAGCGC CGTTGCACTC CATCGAGATC GCCATCGACA AGGCATACAC GGCAGCCAGT     48660
     TTCGGCTTAC CGACCAGTCG GTGGAGTGAG GCCTTGCTGA GTCATTCCGA AGCGGTCCGC     48720
     CAAGGCATCG TGCGAAGGCC CCGCTTCATC GCCTTCGGCG GTGGTTTGCC GATTGTTGAA     48780
     AGTGGCCATC GCATCGGGGG TATTGGCGTG TCTGGCGGTA CCGAAGAGCA GGACGAGCAC     48840
     TGTGCGCAAG CCGGATTGAG CCTGCTAGGT CTAACTCAAA CCTGAATCTT TCCGGAAAGT     48900
     CGACTGCCGC CGCGACCACA TTTGCCTAAT AGGAAGCTTA CTAAAACATC ATGCTGATTA     48960
     CCGATCCCCA AGCGACCGCG AGCACTGGAA ACCAGTCCGA CGCTCATGCT AAAGAAATCC     49020
     ACAACTTCAT CAACGGCGAA TATGTGCCGG GTCAGCGTTG GTTCGAGAAG CGCTCGCCGT     49080
     TGAATAACGC GGTCATTGCC AAGGTGGCCG AAGCCGGCCG TGCCGAAGTC GACGCGGCGG     49140
     TGGCTGCGGC GCAGGCCGCG CTTAAGGGAG CGTGGGGGCG CATGAGCTTG GCCCAGCGCG     49200
     TGGAAGTGCT GTACGCGGTG GCCGACGGCA TCAACCGTCG TTTTGACGAC TTCCTTGCCG     49260
     CTGAGGTAGA GGACACGGGC AAGCCTATGA GCCTAGCGCG GCATGTGGAC ATTCCGCGTG     49320
     GGGCGGCCAA TTTCAAGATC TTTGCCGACG TGGTGAAGAA CGTACCCACT GAGTTTTTTG     49380
     AAATGCCTAC ACCGGATGGT GTCGGGGCGA TCAACTACGC CATGCGTCGA CCGGTGGGGG     49440
     TGGTCGGGGT GATCTGTCCA TGGAACCTGC CGCTGCTGCT GATGACCTGG AAAGTCGGCC     49500
     CAGCGCTGGC CTGTGGCAAC ACCGTTGTGG TCAAGCCCTC CGAAGAGACG CCGCAGACCG     49560
     CTGCATTGCT GGGCGAAGTG ATGAACACGG CGGGCGTGCC GCCAGGGGTC TACAACGTCG     49620
     TGCACGGCTT CGGCCCCAAC TCCACCGGCG AATTCCTCAC CACCCACCGC GGCATCAACG     49680
     CCATCACCTT CACCGGTGAA ACCCGCACGG GTGCGGCCAT CATGAAGGCC GCGGCTGACG     49740
     GTGCTCGCCC CGTGAGTCTG GAGATGGGCG GCAAGAACGC TGCCATCGTG TTTGCCGACT     49800
     GCGACCTCGA CGCCGCCATT GAAGGCACGC TGCGCTCGTG CTTCGCCAAC TGTGGCCAGG     49860
     TCTGCCTGGG TACCGAGCGG GTATATGTCG AGCGCCCCAT CTTTGATCGT TTTGTCTCCG     49920
     CGCTCAAAAA AGGCGCTGAA GGCATGCAGC TCGGCCGCCC GGAAGATTTG GCCACCGGTA     49980
     TGGGCCCGCT GATTTCGCAA GAGCATCGTG ACAAGGTGCT GTCGTATTAC AAGAAGGCAG     50040
     TTGAAGCGGG CGCGACGGTG GTGACGGGCG GCGGTGTACC CGATATGCCG GAGGCGCTCA     50100
     AAGGCGGCGC GTGGGTGCAG CCCACCATCT GGACGGGCTT GGGCGACGAC TCGGTGATTG     50160
     CCCGCGAGGA GATCTTCGGC CCTTGCGCGC TGGTCATGCC ATTCGACAGC GAAGAAGAGG     50220
     TGATCCGCCG TGCCAACGAT AACGACTACG GCCTGGCCAC GGCGATCTGG ACCACCAATC     50280
     TGTCGCGTGC GCACCGCGTG GCGGGGGCCA TCGAGGTCGG CATTGCGTGG GTGAACTCTT     50340
     GGTTCCTGCG CGATTTGCGC ACGCCGTTCG GCGGGGCCAA GCAGTCGGGT ATCGGGCGCG     50400
     AGGGCGGAGC CCACTCGCTG GAGTTCTACA CGGAACTCAA AAACGTTTGC ATCAAACTGT     50460
     GATCATGGAC AAAACTCAAA TCACCCAGCT TGGCGACGCC CTGTATCAGG CACTGACCAC     50520
     GCGAACCGTG CTTGATCCGC TGACCGAGCG CCACCCCGAT ATGATGATCG AGGACGCCTA     50580
     TCACATTCAG CAGCGCATGA TCGAGCGTCG TGTGCAGGCC GGTGAAACCA TCATCGGCAA     50640
     GAAGATCGGC GTGACGTCGG CAGCCGTGAT GAACATGCTT GGCGTGTATC AGCCGGATTT     50700
     CGGCTACATG CTCGACGGCA TGATCTACAA CGAAGGGCAG TCGATCGAGA TCGGCACGCT     50760
     GATTCAGCCT AAGGCCGAAG GCGAGATCGC GTTCATCCTC AAGAAAGACC TGATGGGGCC     50820
     GGGGGTGACC AACGCGGACG TGCTGGCGGC GACCGAATGC GTGATGCCGT GCTTTGAAAT     50880
     TGTCGATTCG CGCATCCGCG ACTGGAAGAT CAAGATTCAG GACACCGTGG CGGACAACGC     50940
     CTCCTGTGGC GTATTCGTGC TGGGTGATCA CGCGGTCGAC CCACGCAAGC TCGAGCTGAC     51000
     GCTGTGCGGC ATGGTGATGG AGCGTAATGG CGAGATTATC GCCACGGGAT GCGGCGCGGC     51060
     GGCACTGGGC TCACCGGTCA ACGCCGTGGC CTGGCTGGCC AACACCCTGG GGCGTCTGGG     51120
     CATTGCACTC AAGGCTGGCG AGGTGATTTT GTCCGGCGCG CTGGCGGCGA TGTTCCCGGC     51180
     CAAGGCGGGC GACAGTTTCC GCGTCAGCAT TGGTGGTCTG GGCGGTTGTT CAGTCCGGTT     51240
     TCACTGAACG CGCCTGGCCA GGCACCACGC CTGGCCGTTG TCGGCTGCCG TGCGTAAAAG     51300
     TCATTTATAT AGGAAGGACA ACGTCATGAA AAAGATCAAA TGTGCGCTGA TCGGACCAGG     51360
     CAATATCGGC ACCGATCTGC TGGCCAAGCT CAAGCGCAGC TCGGTGCTGG AGCCGGTGTG     51420
     GATGGTGGGC ATCGACCCGG AATCGGAGGG GCTGAAACGA GCCCGTGAGC TCGGCGTCAA     51480
     AACCACGGCG GAAGGTGTCG ACGGGCTGCT GCCGCATGTG CTGGCCGATG GTGTGCAGAT     51540
     CGCGTTTGAT GCCACCAGTG CATATGTTCA CGCGGAAAAC GCGCGCAAGC TCAACGCGCT     51600
     GGGCGTGATG ATGATCGATC TGACGCCGGC GGCAATTGGC CCGTACTGCG TTCCGCCGGT     51660
     CAATTTGAAA GAGCACCTGG GCAAACGCGA GATGAACGTA AACATGGTCA CCTGTGGCGG     51720
     GCAGGCCACC ATTCCGATGG TCGCTGCGGT CTCGCGCGTG CAGCCGGTGG CATACGCGGA     51780
     AATCGTCGCG ACCGTATCGA GCCGATCGGT GGGGCCCGGC ACGCGCAAAA ACATTGACGA     51840
     ATTCACGCGG ACCACGGCCG GCGCGGTGGA AAAGGTGGGG GGCGCGAGAA AGGGCAAAGC     51900
     CATCATCATC ATCAACCCGG CGGAGCCTCC GCTGATGATG CGCGACACGA TTCATTGCCT     51960
     GACCGAAACC GAGCCGGATC AGCAAAGGAT TACCGAGTCC ATCCACGCCA TGATCGAAGA     52020
     GGTCCAGAAG TACGTGCCCG GTTACCGGCT GGTCAACGGC CCGGTGTTTG ACGGCAAGCG     52080
     TGTGACGGTC TTCATGGAGG TGGCGGGCCT GGGGGACTAT CTGCCCACGT ACGCCGGCAA     52140
     CCTGGACATC ATGACCGCTG CCGCGGCCCG GACCGCCGAG ATGTTTGCCG AAGAGATGAT     52200
     TGCCGGCAAT CTCACGCTCG AACCGGTTGT CGCTTGAGCC GTCAAGGAGA ACAGAGATGA     52260
     ACCTGCAAGG GAAAAAAATC ACCGTCCACG ACATGACGTT GCGTGACGGC ATGCATCCGA     52320
     AGCGCCATTT GATGACGCTG GAGCAGATGA AAAGCATCGC CTGCGGCCTG GACGCAGCCG     52380
     GGGTCCCCCT GATTGAAGTC ACGCACGGCG ATGGCCTGGG CGGCTCGTCG GTCAACTATG     52440
     GCTTTCCGGC CCACAGCGAT GAAGAATATC TGGGGACCGT GATCCCGCTC ATGAAGCAGG     52500
     CCAAGGTCTC GGCTTTACTG TTGCCGGGCA TCGGCACCGT CGATCATCTG AAGATGGCCA     52560
     AGGAGCTTGG CGTGCACACC ATCCGGGTGG CCACGCACTG CACCGAGGCT GACGTGTCAG     52620
     AGCAGCACAT TGCCCTGGCG CGCAAGCTTG AGATGGACAC GGTGGGCTTC CTGATGATGG     52680
     CGCATATGAA CAGTCCTGAA GGGCTGGTCA GACAGGCAAA GCTGATGGAG TCATACGGCG     52740
     CCAACTGTGT CTACATTACC GATTCGGCTG GCTACATGCT GCCCGATGAT GTCAGGGCCC     52800
     GCCTTGGCGC GGTGCGCGAC GCGCTCAAGC CGGAGACGGA ACTGGGCTTT CACGGCCACC     52860
     ACAATCTGGC GATGGGGATC GCCAACTCCA TTGCGGCCGT TGAGTGTGGC GCCACCCGCA     52920
     TCGACGCCGC CTCGGCTGGT CTCGGTGCGG GTGCGGGTAA CACACCGATG GAGGTGCTGG     52980
     TCGCCGTATG CGACCGAATG GGGATTCAGA CCGGAGTGGA TGTGTGGGCC ATTCAGGACG     53040
     TGGCCGAAGA CTTGGTCGTA CCGATCATGG ACTTCCCCAT CCGGATCGAC CGCGACTCGC     53100
     TCACCCTGGG TTACGCCGGG GTCTACGGGT CGTTCCTGCT GTTTGCCAAG CGCGCCGAGC     53160
     AAAAGTATGG CGTACCGGCG CGCGAGATCC TGGTCGAGCT TGGGCGCCGG GGCATGGTCG     53220
     GTGGCCAGGA AGACATGATT GAAGACACGG CCATCACGCT GGCCAAAGCG CGTGCGTCAA     53280
     AGGCGCAGAA GGTGGCGGCA TGAAACTGGA TCGCGCCACC ATTGCGCGCC TTGCAGAGCA     53340
     CCTCGAGAAC TGCGAGCTTC ATGCGCAAGA CACGCTCAAG ATCACCGATG AGCATCCCGA     53400
     GATGGATTGG GATGACGCTT ACGCGATCCA GGACGAGATT CGCCGCCGCA AGCTGGCCCG     53460
     CGGCGGGAAG ATCGTTGGGC TCAAAGCGGG GCTGACCTCG CACGCCAAAA TGAAGCAGAT     53520
     GGGGGTTGAG AGTCCTGTCT TCGGCTTCAT GGCCGACTAT TACGCGATCC CAGATGGCGG     53580
     CACGTGCAAG ACCGAGGCGC TGATCCATCC TAAGGTCGAG CCGGAAATCG CCTTTGTTAC     53640
     CAAAGCGCCG TTGAAAGGCC CGGGCTGTCA TATCGGAGCG GTGCTGGCGG CGACTGACTT     53700
     CGTGATGCCG GGCATCGAAG TCATTGACTC GCGCTACCGC GATTTCAAGT TCGATCTCAA     53760
     AAGTGTGGTA GCGGACAACA CGTCGGCCGC ACGCTTTGTT GTGGGTGGGC GCGCACTGCC     53820
     AGTGTCTGAG GTGGATCTGC GCACCGTCGG CATCGTGCTG GAGAAAAACG GTGAGCCGGT     53880
     TGCGTTCGGG GCGGGCGCCG CGGTGCTGGG CCACCCGGCC GCGGCGATTG CGATGCTGGC     53940
     CAATCATCTG GGCGCGCGTG GCGAGGAGAT TCCGGCGGGC AGTTTGATTC TGTCAGGGGG     54000
     GATCACGGAG GCCATTGCCG TGCGAGCGGG GGATGCCATC GCCCTGCGGG TGCAGGGGAT     54060
     GGGCAGCACC GGTTTGCGCT TCGTTTAAAG GAGATAGCCA TGCCGATTGC GCAGCTGTAC     54120
     ATCATCGAAG GCCGCGATGC GGAAAAGAAG GAGCGGCTGA TCGCCGAGGT CACCGAGGCG     54180
     ATCCATCGCG CGATTGATGC GCCGGTGGAG TCCATCCGCG TGCTCATTAC CGAAATGCCG     54240
     AAAGAACACT TCGGAATCGC GGGTCAAAGC GCCAGGAAGC GAGGGCGTTA GGACGTTGTG     54300
     TGTGTGGTGT GTTGAGGGCC AGTTGGCCTT AGAAATTATG GAGACTGAAA ATGGCTTTGT     54360
     TAAATCGGAT GGACTGGTAC GACCTTGCCA GGACGACTAA CTGGTCGCCG AAGTACGTCA     54420
     CGGAGAGCGA GCTTTTTCCG CCCGAGCTCA GTGGAGATCA CGGCATTCCC ATGGAAAAGT     54480
     GGGAGACCTA CGACGAACCA TACAAGCAGA CTTACCCGGA GTATGTCAAA GTCCAACGCG     54540
     AGAAGGACGC TGGCGCGTAC TCCGTGAAGG CCGCGCTCGA GCGCAGCCAG ATCTATGAAA     54600
     GATCTGATCC GGGTTGGCTT ACGGTGATGA AGCAGCATTA TGGTGCCATT GCCCTCGCCG     54660
     AATATTCCGC CTCGAGCGCC GAAGCACGGA TGATGCGCTT CTCCAAGGCA CCGGGCATGC     54720
     GCAATATGGC GACCCTGGGA AGTATGGACG AAATTCGTCA CGGTCAGATC CAGCTCTACT     54780
     TTCCTCATGA GCACGTCTCG AAAGACCGTC AGTTTTTCCA CTTCCGCAAA ACTGATCTGT     54840
     CGCTTCATCA CAGGACCTGA ATCATGGACA CGCTTATGAC AACGCGCTCA CCCGATGCCT     54900
     CGATGACTCG CGCACTGATT TAATCAGCGA TTCCTTAGTG TCCTGAATTT GACGCTCGTA     54960
     GAAGGGAAAC GGAAGCGGAC GCTCGTGCAA TGCGATCTAC GCGAAAATCC GCTAGGGAAC     55020
     CACTGATTTA TTCCGCCGGA CGGTCATCGT TGAACAGGAC TAAGACGTTG TAGAGAAGAC     55080
     CCCCGGAACA GGCATAGTGA ATGAAGCGGC AGATCAGTTT TGCGGAAGCG GAATGCACCG     55140
     GCAAGAAGCG CGTGACTCGT CGACAGCGCT TTTTGACGGA GATGAACAGC GTCGTGCCTT     55200
     GGGCGCGTCT GCTGGCGGCG CTCGAACCGT ACTACCCGAA GGGCACGCGA GGGCGTCCGC     55260
     CGATCGGGTT GGAGCGGATG CTGCGCATCT ACTTCCTGCA GCAGTGGTAT GGGCTGTCGG     55320
     ACGAAGGCTT GGAAGATGCG CTGTATGACA GCATCGCGAT GCGCGCCTTT GCCGGGATTG     55380
     ATCTGGCAGT CGAGAACGTG CCGGATGCGA CGACTTTGCT GAAGTTCCGT CGCTTGCTGC     55440
     TCGAGCATGA TCTGACGCGC CGGCTGTTCG ACGAGATCGG CATCTCGCTG TGCGAACGCG     55500
     GGTTGATGAT GAAGGAAGGC ACGCTGGTGG ATGCGACGAT CATCGAGGCA CCGCCGTCGA     55560
     CCAAGAACGC CGAGAAGCAG CGCGACCCAG AGATGCATCA GACCAGGAAA GGTAACGAGT     55620
     GGCACTTTGG TATGAAGGCA CATGTCGGCG TGGATGCCGA CTCGGGGCTG GTGCATAGTG     55680
     TAGTGGGGAC AGCCGCCAAT GAATCGGATG TCTCGCAGGC GCATGCCCTG CTGCATGGTC     55740
     ATGAAGCGCA CGCATTCGGC GATGCGGGCT ATACAGGCGT GGAGAAGCGG GAGGAGATGC     55800
     AAGGCGCCAC CGTAAAGTGG CATGTTGCCA TCAAGCGCGG CAAGATCAAG ACGATGCGCG     55860
     AAGGCGCATT GAAGGATCTG CTGATCGCTG CGGAGCGAAC GAAGGCGCAG ATCCGGGCGC     55920
     GGGTCGAGCA TCCCTTCCAC GTGATCAAGA ATCTGTTTGG TCATCGCAAG GTACGCTACA     55980
     AAGGTCTGGC GAAGAACACA GCGCAGTTGT TCAGCCTGTT TGGTCTGGCC AATCTGGTCC     56040
     TGGCCAAGAA ATCGTTGTTG GCCAGTCATG GGAGCAGTCC GTCCTGAGTG CGCCAAGAGC     56100
     GCTAGGGGAA GGCGCAAACC GGCGCTTTTC GGGGAAAAAC CCGCTCGGCA TGTACTTATA     56160
     TTGTGCATTG CGAAATTACG TGATCAGTTC GACAACCCGA TCGACACAAA GACGTTATTG     56220
     ATCAGCGCTT CCCTAGCTGT TCATGAAGTG GTACTCCACC CAAAGGGCGC GGTCTGGCGT     56280
     AAGTCGCATT GCGCAGATGA TTGCTCCGAG TCATCAGAGG TCGACAAACT ATGTTTGACG     56340
     AGTCAAATAT ACTGACGCTC GGGGATGCAA AGCACCTGCA GGCGTGGACG AACGCCTGGT     56400
     TTGAGGCGGC CGTCGAACTA GGTTTTATCC GGTGGCCCTA TGTACCCGAC AAAGAAGTCG     56460
     TCAAGCGTTT GCATGGCTAC TTCAATGCAG GGTTGATGCC AATGGAAGCC GCCCAAGCAT     56520
     GCTTTGCGGC GAAGCATTGA GAAAGATCGA TGATGATTCA ACCAAGAAAA ATCATACGAA     56580
     GTTGTTAAGA GAAATCAAGT TATTGCTCGT TGCTGGATAT ATGGAGTTGC AAATGTCGGA     56640
     TTCTTTAGAA ATTGCGAATA CAGTCACCGC AAATGGTATA AAAACCAATT ATCACGATCG     56700
     TGGTCAGGGA GTGCCTGTTC TTTTGATTCA TGGATCGGGC CCTGGAGTAA CCGCATGGGC     56760
     GAACTGGCGC CTCACAATCC CTGAACTCGC GAAGCAGTTT CGCGTCATCG CACCGGACAT     56820
     GGTGGGCTTT GGATATACCG AGCGGCCGGT GGGTATCCGG TATGACATGG ATACCTGGGT     56880
     CGGGCATGCG CTCGGGTTGC TGGATGCGCT TGGCATTGAC AAGGCTCACG TGGTGGGCAA     56940
     CTCTTTCGGA GGGGCTCTGG CCTTGGCGCT GGCCATCCGG GCGCCCGAAA GAGTGCGCCG     57000
     ATTGGTCCTC ATGGGCAGCG TGGGTATCTC CTTCCCGATA ACGGAGGGGT TGGACAAGGT     57060
     TTGGGGCTAC GTTCCGTCAA TCGACAACAT GCGAGAGTTG CTCGATGTTT TTGCGTTCGA     57120
     CCGCAATCTC GTAAATGACG ACCTCGCTCG CCTGCGTTAT GAGGCAAGCA TCCGGCCGAA     57180
     CTTTCAGGAA GCGTTTTCAA GTATGTTTCC GGCACCGCGC CAGCGTTGGG TGGACGCTAT     57240
     GGCGAGCCGG GAGGAGGACG TCGGCTCGCT TCCGCACGAG ACACTCATCA TCCATGGGCG     57300
     CGAAGACCAG GTCATCCCGC TGTCCAATTC CTATACACTG CTCAGACTGA TTCCACGGGC     57360
     GCAGCTGCAC GTGTTCGGCC GCTGTGGCCA TTGGACGCAG ATTGAACATG GAGAGCGATT     57420
     TAACCGGTTG GTCGGTGACT TCTTCTCGGA AGAGGCGCTT TAAGCCTCCG CGCGGAGGCC     57480
     TTTGGGGGGG CGTTCAAGTG ACGCCAACGG CATGGGGCAA CGAACGGTCC CCCAATTAGG     57540
     TTTTCGTTCC AGGCAGGTTT ACGCACCCGG TGAGAGCGTG CGAGACGATG AACTTTTAAG     57600
     AAAGAGCCCT GACTGGCGAT CTCTTGAGGA GGGGACATGA AGGAGGAGAA AGGGAAAGCG     57660
     GGAGAAATAG ACAGAGGAAT ACCGCTTTTC GTGCCGGATG TAGTGGCTGA TCTGCATTTT     57720
     CCGGACATTC GAGATCTGGC GGAACGCCTT CGTTTCAATC CTGCGGACGG TCGCATCTGG     57780
     CTCGACGATC GTCGAATGGT CTTGATCCAT ACGGACGCGT TTGCTTCACT GCGACAGGAA     57840
     CTCATCGAAG CTTTAGGTAT CGATGCTGCG CGCGGATTGC TGACACGCAT GGGATATCTA     57900
     TCGGGTTCTC GGGATGCCGC GCTCGCACGA AAGGTTCGCG GGCAAGACAG CGCATTTGAT     57960
     GCCTTCGCGG TAGGTCCTCA ACTTCACGCC CTGGAAGGCA TCGTCCTGGT AGAACCTGTC     58020
     AGAGTGGATA TCGACAGCAC CACCGGTCAG TATTACGGGG AATTTCTGTG GAAAGACTCG     58080
     TCCGAGGATG AGGCTCACAT ATCCGTGTAC GGCATCGGCT CCGAACCAGC CTGCTGGATG     58140
     CAGATTGGCT ACGCGTGCGG CTACACGAGC GCTTTCATGG GCCGGCGTAT TCTATACCGG     58200
     GAAGTCGAAT GCCGCGCGAT GGGCAATACA TTATGCCGAA TCATTGGAAA GCCCGTGGAG     58260
     GAGTGGGACG CCCCCGATGC GGACCTTCGG TATATGCTGC CACAATCTCT GGAGAAACGT     58320
     CGCTTTGTCG AGTTGAAAAG TTCAGGTCCA GCCCCGACTG ACTCTACAGA TCATGAGTGT     58380
     GTGCCTTGCA AGCTGGACGA AGTGCCTGTC AAAGAAGGAC CAATAGGCGC GTCTGCTGGA     58440
     TTCAACGCAG TGATGCACAA AATATTCAGA GTGGCTCCCA CTAGTGCAAC CGTTTTACTG     58500
     ATGGGTGAGA GCGGCGTGGG CAAAAGCCTG TTTGCTCGGG AACTGCACAA CAGAAGTTCG     58560
     CGTGTAGGGA AACCATTCGT TGAATTAAAT TGTGCAGCTA TTCCCGATTC GCTGATTGAA     58620
     TCGGAGCTTT TTGGTGCGGA GCGTGGGGCA TTCACCGGCG CATCCGATGC CCGCGTTGGG     58680
     CGTTTCGAAA GCGCAAACGA AGGGACCATT TTTTTGGATG AGATTGGTAC TCTCAGTCTA     58740
     ACCGCTCAAG CGAAGCTATT GAGAGTTTTG CAAACGGGGG AGATGGAGCG ACTCGGGAGT     58800
     TCAAAGACGG TTAAGGTAAA TGTTCGGGTA ATTACTGCGA CTAATGACAA CCTCAAACAG     58860
     GCGATAAAAA GCGGGCGTTT TCGTGAGGAT CTTTTCTACC GGCTGAATGT ATTTCCAATT     58920
     TTTATTCCAC CTTTGCGTGA AAGAAAGGAT GATATCCCGG TTTTGCTGGA ATTTTTCATA     58980
     AAGAAATTTT CAAGAAGGCA TGGTAGGCCC CTCAAGGGCT TATCCAATCG TGCGCTTCAT     59040
     CTATTGCTGG ATTACTCGTG GCCCGGGAAT ATCCGCGAGA TGGAGAATGT GCTCGAACGT     59100
     GGCGTTATCC TCGCCGAAGC AGGCGGTACG CTCGATGTAT GCCACTTGTT TAGTAGCGAT     59160
     GACACCGTGG AATGTAAGGG TGCTTTTGGT TTAAGCGACC TTGGGTCGCT TGTCCTCGAT     59220
     TCCATATCGA CGAGCGCTCC CCCCGAGACT ATCGGCAAGA GCGGAGAAGG CCCGGAGGGG     59280
     CTCGAGGATT GGGCAGCGCT CGCTGTACAG ATGAACAAAG CGACACTTCG CGAGGTCGAA     59340
     GATGCGCTCG TACGCGCGGC ACTCAAAGCC GCGAACGGGA ACATATCAGA AGCCGCACGT     59400
     CTTCTCGGAT TGACACGTGC GCAACTCGAC TACCGTGTCA AGAAGTCGAA CAGTTGGCTC     59460
     TGGTGCAAAT AGGTTGCGTA GCCGAGATGT TTATTTTAGA TATGGATACC TTATCGATTG     59520
     AACAGAACAA GATTCCAGAC GGAAGGCGCA GCGATGTCCT TGAGCGCAAG AGCGGAGAGG     59580
     TCGAACTGCC CCTTTCGAAC GCGATGCATC TGACCTGCCC CTGACCCTAG CCCACAAAAC     59640
     TGTCCCATTT GGAAGTGGAA AATTCCGGCA TGACGTTGTC ATCGAGACCA GGAGGTCATG     59700
     CCGTGAAGAA GAGCAAGTTC ACCGAAGAAC AGATCACTTA TGCGTTGAAG CAGGCCGAGC     59760
     TGGGCACGCC GGTCGCGGAG GTCTGCCGCA AGATGGGGAT CAGCGACGCG ACGTTTTACA     59820
     ACTGGCGGAC GAAGTACGGT GGGCTATCGC CCTCAGAGCT GCGCCGGTTG AAGGTAAGCG     59880
     CGCAATTCAG CACACCGCAG TGATCGTCGA ATCTGCATGA ATGCAATAGT TATGGATCAG     59940
     ACTGGGTGAC GTGCTGCAGG CGGGAGCTTC GCGAAGTTGA ATGGCAGCAG ATCGGTGACA     60000
     TCGGCATCCG GGAGCGCTGC GGCAGTTCGG TGAGTACATG CAGGAGATAG GCATAAGGCT     60060
     CGACGTTGCA GGCGCGGCAC GTGAGCATCA GACTGTAGAC CATTGCACTG GCTTCAGAGC     60120
     TAAAGTCGAA AGTGGTGTAC GGGGGAATTG AGGGGGGAGA TTGAAGGCGG TGGAGGTTTC     60180
     AGCTGAGAAT CTGATTGTCG AAGTCGGAAA CCAGCAAACA ACAAACCATC CACCATGAGC     60240
     AAGTTTACGG AAAAAGAAGT CGTCGGTCTA TCGGAAGTCG GTCTGGGCCT GGATGATCTG     60300
     GTGCGCCAGG GCGCGCGGCA GGTGATCCAG CAGGCAATTG AAGCGGAGCT GTCGGCGCTG     60360
     CTGGAGCGGT TCGAGAACGT CAAGACGTTG CACGGCCAAC GTGCTGTGGT GCGCAACGGC     60420
     TATCTGCCGG AGCGCGAAGT GTTGACGGCG GCCGGACCGA TTCCGGTGAA GGTCCCGAAG     60480
     GTTCGTGATC GGTCAGGCTC CGGCGTGAAG TTCAATTCAT TGATCGTACC GCCGTATGTG     60540
     CGTAAGTCGC CGCGCGTGAG TGCGGCGCTG CCGTGGCTGT ATCTGAAAGG CATTTCGACC     60600
     GGGGACATGA GCGAGGCGCT GAGTGTGCTG CTGGGCGAGG ACGCCAAAGG CTTGTCCGCG     60660
     AACGTGGTAA GTCGGCTGAA GGCGCAATGG GCCGATGAGC ATGTCAACTG GAGCCGGCGC     60720
     GATCTGTCGA AGTCGCGCTA CGTGTATTGG TGGGTCGACG GCATTCATAC CGGCCTGCGC     60780
     AGTGAGAACT CAGACGGCCA GTGCCTGCTG GTGATCATCG GTGTGAGGCC GGATGGGCGC     60840
     AAGGAGCATG TGGCAATCGG CGATGGGTAT CGCGAGTCGA AGGCGTCCTG GCAGGAGCTG     60900
     CTGCTCGATC TGAAATCGCG TGGCTTGCAG GCGGGGCCGC TGCTGGCAGT CGGCGATGGC     60960
     GCGATGGGCT TCTGGGCTGC GCTGGAAGAA GTGTTCCCTG CGACACGCGG TCAGCGCTGC     61020
     TGGTTTCACA AGATGGGCAA CGTGCTCAAC GCGCTGCCGA AGTCGCAACA GGGGCGCGCG     61080
     AAGGCAGACC TGCAGGCGAT CTGGATGGCC GCGACGCGCG CCGATGCGTA CACCGCGTTC     61140
     GATCGTTTCG TGACGGTCTA CGAGGCGAAA TATCCAAAGG CGACCGAAAC GTTGAAGAAA     61200
     GACCGGGAGA GCCTACTGGC GTTTTACGAC TTCCCGGCCG AGCACTGGCA ACATTTGCGC     61260
     ACAGCCGCCG GCGCAATAGA TCTGACCTCG GTCACAGCGG CGGCAAATGA ACACCTGCGT     61320
     GCGGCAGCGG GCGCACAGGA AGAAACGGCC CGTGGGCAGC ATCCCACCGG CAGCATTGCC     61380
     TTCGGTCATC GGCGATCCCC GTAGAACGCC GAAGACAATG CGATAGACAG GGGCGCACGA     61440
     GCCGTGGAAT ACTGCGGCTG CACGCGATCC TGTGTTAAGC CCCGTGGCTT TGCACTGCGA     61500
     CTTGGGTGGC GCGACTCCGG GGTGAACTTG GCGGTTTACC GGTGTCGCGC CAGTGGTTTC     61560
     TTCGGCGCAG CGCCTTTCTA CCGCAACCGC TTGCCGCCGT CATCTCCCAA CGCGCTTTGC     61620
     GCGTCTGCAC TCGCCCTGCG GGCTCCTTAC GACGCACAAA GCGCCATCAG TGCCCGGCTG     61680
     CAAGTTCCCT GCACATCCCT CAACGAGAAA CCGCTCGTTT AACAGATCAA TTCCACGACG     61740
     CCGTCGCTTA GTGTCGGATT TAGACCGACG TTCACACCGT GCGAGCGCCG CACGAGCTTG     61800
     CGCCACCGCG GCGCGGCAAA GCTCATGTCG ACATCCGCAT CGATCCACTC CCGATGCAAT     61860
     GATTCGTTCT CCAGCACCGC ATCGAGTGCA TCCAGCAGCG AGCGAACCGG GCTGGTCGAA     61920
     TCCCATTCGA GCGTACGTAC GACACGCATC ATGACCGAGC GGTGCGCCTT GAAGTGCTTC     61980
     CAGAGCAGCG GCAGATAGTT GCGGCCGCTG AACGCGCGGA TCGCCGCGCA GCTCTCGCGC     62040
     AACGGCTCGA GATCGCCTTT CGATGCAAGC AGCTTCCTGA CTGCGTATTC CGGCGAACGT     62100
     GATCACGCAT TTCGGCGGAT CGTGATCATG GATTCCGAAT GATCGTGATC ACCCGTTTCG     62160
     GTTGATCGTG ATCGCTGATC ACAGGTTTCC GAAACGCGTG ATCACGATGC CGGAATGAGC     62220
     GATCACGGGA CCGAAACGGG TGATCACGTA ACCGGAACGT AATCCGGGTT TGAGTCTGGC     62280
     GGTGGCGTTG CGCATGTATT CACCGACGGC GTTAGCCTGC TCCCTTTTTT GCGGGAGAAG     62340
     TGCCGATGCC GACACCTCGG ATGAGCATGC GCAAATTGAA GGAAGTCCTG CGACTAAAGT     62400
     GGGCGTGTGG CCTGACGCAT CGGCAGATCA GCCGGGCTAT CGGCATCAGC GTCGGTGCCG     62460
     TCTCGAAGTT CGCGGCCCAA GCCAGCCAGG CGGGACTCGA TTGGGCGGCA GCCGAAGCAA     62520
     TGTCCGACGA CGAACTGGAC GCGCGCCTGA GGCCTGCGGC AACCAATGCC GCGGCGACGA     62580
     CGACGCGACG CATCGAGCCC GACTACACGG CATTGCATCG CGAGCTGCGC CGCAAGGGCG     62640
     TGACGCTGCA ACTGCTGTGG GAAGAATACG CTGAAGCGAA CCCCGGCCAG CGGACGTACC     62700
     GCTACACGCA GTTCTGCCAG AAGTACAAGG ACTGGGCGAA GTCGATCAAG CGCTCGATGC     62760
     GTCAGCAGCA CCGCGCCGGC GAGAAGCTGT TCGCGGACTT CGCGGGTCCC ACCGTGCCGG     62820
     TCCTGGCGAG CGATGGCGGC GTCGAGTTCG AGGCGCACGT GTTCGTTGCC GTGCTCGGCG     62880
     CATCCAACTA CACGTTCGCG TGCGCGACGC GCACCGAGAC GATGGCGGAC TGGATCGGCA     62940
     GCCTGTGCGA TGCGCTAGAG TTCATTGGCG GCGTGCCCGA ACTGCTCGTG CCCGACAACC     63000
     CGAAGGCGCT GATCGCGCGA CCCGACCGTT ACGAACCCGG ACTCGGCACG ACCACGCAGG     63060
     ACTTCGTGAA CCACTACGGC ACCGCGATGC TGCCGGCGCG TCCGCGCAAA CCGCAGGACA     63120
     AGGCCAAGGT CGAAGTCGGC GTGCAGATCG TCGAGCGCTG GGTGCTGGCC CGACTGCGCC     63180
     ACTATCGCTT CTACAGTCTG GCTGAACTCA ACAAGGCGAT TGCAGAACTG ATCGCCGACC     63240
     TAAACCAGCG CCCGTTCAAG CGGCTCGAAG GCAACCGGCG TGAATGGTTC GAACGGCTGG     63300
     ACCAACCCGT CCTGCGCCCG TTGCCCGTGC GTCGCTACGA GATCGCCACC TTCCAGAAGT     63360
     GCCGTGTGAA CATCGATTAC CACGTCGATG TCGGCGGCCA CTATTACAGC GTCCCGCATA     63420
     GCCTCGCACG GCAGGAGGTC TGGGCGCGTA TCACACGCCA CGGCGTAGAG ATCCTGCATG     63480
     GCGGCAAGCG TGTCGCTGCG CACGCTCGCT CGCGCCTCAA AGGCAAACAC ACGACCATCG     63540
     CCGAACACAT GCCGGCTGCG CATCGCGCGC ACATGGAATG GACGCCTGGG CGCCTGCTCA     63600
     ACTGGGGCGC ATCCGTCGGC CCCGGCGCCG AGGCTGTCGT GCGGCATCTG CTGACCAACA     63660
     AACCTCACCC CGAGATGGGC TATCGCGCCT GTCTCGGTCT TCTCTCGCTC GCGCGCAAGT     63720
     ACGGCAAACA CCGCCTCGAG GCCGCATGCC AGCGTGCATT GAAGATCGGC TCGCCCACGC     63780
     GTCGCTCCGT GCTGTCAATC CTGGAAGCGG GACTTGACCT GCAGCCCTCG CTCCCGACCA     63840
     CGCCCGCCGA ATGGCGCTCG CCCGAGCACG AGAACGTGCG CGGCCCCGAC TACTACCACT     63900
     GACCCGAAGG AGGTCACGAT GTTGATGCAG CACACCCTTA CCCAGCTAAA GGCGCTCAAA     63960
     CTGGACGGCA TGGCTCGCGC GTTCGAGGAG CAGTCAACGC TCACGGCAAG CACCAGCCTG     64020
     TCATTCGAGG AACGCGTGGG CATGCTCGTA GATCGCGAGC TGGCCTGGCG TGATACGCGA     64080
     CGACTCGAAC GTTTGCTGCG CGCCGCGAAG CTCAAGAACC CACAGGCCTG CGTCGAAGAC     64140
     ATTGAATACC GGCAAACCCG TGGGCTGGAC CAGCGCATCG TCGCCACGCT CGCCGGCTGC     64200
     GACTGGGTGC GCAATGCTCA GAACCTGATC CTGACCGGCC CCACCGGCGC GGGCAAGACG     64260
     TGGCTCGCTT GCGCGTTCGG CCAGCAGGCG TGCCGGCAGG GCTTCTCCGT GTTCTATGTG     64320
     CGCGTCGCGC GGCTGTTCGA AGAGCTGAAA ATCGCGCACG GCGACGGCAG CTTCACACGT     64380
     CGGCTTGCGC AACTCGCGAA GATTGATGTG CTGATCCTCG ACGATTGGGG CTTGCAGGAT     64440
     CTCGACCAGG CGGCGCGCAA TGATCTGCTT GAGGTACTTG ATGATCGTGT CGGTACGCGC     64500
     TCGACTGTGA TCACCAGCCA GTTGCCGCTC GAACACTGGC ACGCGTGGCT GCAGGACCCC     64560
     ACGCTCGCCG ATGCGATTCT CGATCGGCTC GTGCATCAGG CCCACAAGCT TCCGGTCAAG     64620
     GGCGATTCGA TGAGAAAGAA AACGAAATCC GAGTCCGCTG ACGCCTGATC GTGATCACCG     64680
     TCGCTATAAT CCATTGACCG CGCAACACCA CCTTCCAGAC TGATCACGTT CGCCGAAACG     64740
     ATTGATCACC ATCGCCGAAA TCCGCATCCT GACCGCTCGG GCGATGGCTG TCTCGTCAGA     64800
     TTCATCGGCG AGAATGTCGA CCACGCCGTC CAGCAAGCCG ACGAGATCCT CGACCTGATC     64860
     ACGCTGTTTT CGCTGAATGG CGTCCAGTTC GTCGCTCGCG CGCTTGTGGA TGGCGCCCAT     64920
     GCGCCGTACG AACATGTCGG CGAGATCGTC GCGGGCGCGC ACGCGCATGC GGTTGAGCAG     64980
     CGCAACGATC AACGTATAGC GCTTTTCGGG CAGTGTGTCG TTCCTGAGCG CCGACGCGTC     65040
     AAGCGCCATC GCCTGATTGG CGAGCGAGCG CAGCTTTGAG GCTGGAATCC CGGCGATGGC     65100
     CAGTGAGAAA TCGCCGAGCT CGTCGAGCCA GGCGACCTGG TCAATCAGCA GGTCCAGATG     65160
     CTGTCGCGAT GGGCGTTTCG CATGACGCTT GATCCGGTTG TAGGCAGTCT GCCGGCTCGA     65220
     CAGATCCCGC GCGAGCAACC GGTCGAGCGC GAGTTTCTGT TCATCGGTCA GGCGTCGTGT     65280
     GACGCGCTTG AAGAGTCTCG ATTGGGCCCG GGCATGGATC TGCTCGGTGA GCCGATCGAG     65340
     CGTCGAGAAC GCCGGCAGTT CGATATCGCG CGCGATCAGC TCATCGATCG TCGCGTTGAT     65400
     GATGTCGACA GGCTGGTCCA TCGTTACCGA CGCCGTGTGC GCCGCCCGTG TCGCGATCGC     65460
     ATTCGCATCG GTGCCGTAGA CCGGCTTCAC GTCCAGGTAG GCCCGAACTG CCGCGTAATG     65520
     CCGGAACAGC GTTGGGGAGG TCTCAGTGTC GTAACCGAAA TGCACGGTGC CGCCGATATC     65580
     GGCGGCCGCC CGGACGTGAT CGATGATGGC GGTTGGGATG GTATCGAGTG GGGGGAAATA     65640
     GTGCAGTTGC TGAAAGACCT TCAGCAGCAC CAGCAGGCCC AATCGAGGTC GCTCGCCCCT     65700
     CGTTGACCGG CGTGCCCATT CGAGTTCATC GGACAGCGGC GTGTAGCAGG CTTGCAGTTC     65760
     CCGGCGCGCC AGAACCTCGG GGAAGCGCGG GTACGCGGTG CGTTCGAGGG TTGCCATTGC     65820
     GGATCTTCCG GATCGCAGAG GGCCGCTCAG ATTAGCGCAA GAAAAATCGG GCTTACTGCG     65880
     TCAATTCGTA ATGATCGCCG CAATCTTTAT AACCATAAAG CCTATGATAG GAATTTGCGC     65940
     TTACCTTGTT CACCCCCCTG AAGGCTTTCC GTGTCAGCCT CGCAAGTACC TTGAGGAGGG     66000
     GAGCGACCAC ATCCGCTTTG GTTTTGAGCA CGGCGGCGTC TACGTGACCG CGCTCTACAA     66060
     CACGGTGAGC GGCCGCGCAT TCGGCGAATA CGAGCTGCCG AGGCGCAAAC GCAAGCTCGA     66120
     TGAGAAGGGC ATCGAGTTCA GTACCGACGA CAAACTCGAT GGGACGCCTT GGTTCGACGC     66180
     GTTGCTGTCG TTCCTCTATG TCGCCTGAAC AACCCCGCCC CTACAGGAAA CGACGATGGA     66240
     AACGACAAAG ACACACACCA TCAATTGCAT GGATTCGTGG GCAAAAGAGA AGGGCCTTCC     66300
     GACATACACC GAATTGATAA ACGCACTGCG CGCGATGTGC GAGACCGGCA AGCCGGTGCT     66360
     GGCCGACCTT CCGAATCTGA GCCCGGAGCT GAAGGCTCCT GAGAAACAGA TGAGGGCCGG     66420
     CGCTATGCAG GTGCCACTGT CGCAGGCGTG ATGGCGAAGC CGAGGTCGGC GGCGCGGCGG     66480
     CGCAAAGCGG CAATGGAGCG CTGGCGCTGC TGCTCCTCGT ACTTCTGCTG ACCCTGGTCG     66540
     ACGTAGTCCT CACCGCGCGT CAGCATGAAG TAGATCATGC GAGCAAGCTT GTGCGCGACG     66600
     GCCGTATTGG CGCGGGGCTT GTCCATGCGC GCGCACAGGC GCCGGTAGAA GGCGCCCAGC     66660
     GCCGAACGAT TGCGCGACAG ACTCATGGCC GCGAGCTTGA GCGCCTGACG AACGCGGTTG     66720
     GTCGAGCGTC GCGTGCGCGC TGACAGGACC TTGCCACCGC TGATCTTGGT GCCGGGGCAC     66780
     AGTCCGAGCC ACGAGCAGAA GTGCTTGACG TTGGCGAAGC GGCTCAGGTC CGGCCCGATC     66840
     TCCGACAGCA CCGTCAGCAC CGAGGTGACC GCCACGCCGT TGATGCGGGT GAGGTCCACG     66900
     CCCGCCCAGC GCGCCAGAGC GGTACGCAGG TCAAAGGCCG GAGTGTTCTT GCCGCGCCGC     66960
     TTGCCCGGTC CCCCGAGTTC GACCTCGTGA CAGCCCAGTG GCGCGAGCAA CGCCTCGATC     67020
     TTGGCGTCGC ACTCCAGGAT GCGCTGGGCC AGACTGTCAA ACATCGCCAG GGCCTGTGCC     67080
     AGTACGAACA GGTGCTCCTC ACGCCAGTTG CCCGTCAGTG CGCGTTGGAT GTCGGCCACG     67140
     TTGGCCTTGA CGCGACCATG GCGGTGCTGC GCCAGCACTT TGGGGTCGCG CTCGCCGGCC     67200
     ACGATGTCGC GGATGATGGC CTGGCCGGTC ATACCCATCA CGTCGGTGAG CACCTCCGTG     67260
     AGTTGGAGAT TCATCTGCAC CAGCGCCTTT TGCATGCGCT GCACCCAGCA AGCTTGCTCC     67320
     CCGAGCAGCA CTTCGCGCTG ACGCACGACG GCGCGGACGA CGCAGACCTC GTGGTCGGGG     67380
     CGGAAGGCGC CGCGCAGCAG CCCCAGGCTC ATCAACTTCT GCAGCCACTG GCAGTCGAGC     67440
     ACGTCGCTCT TGCGGCCGGG CACGTACTTC ATCTGCCGCG CATCAACCAG CCAGACCGTC     67500
     AAGCCGTGCT GCTCCAGCAC TTCATACACG GGGATCCAGT AGACGCCGGT CGACTCCAGC     67560
     GCGACCGTGT CCACGCCGCA CGCCAGGAGC CAATCGGCCA CCGCGTGTAG GTCGTCGGTC     67620
     ATCGCGCCAA ATTCGCGCAC CGGGTCGTCA GTCGCATGGC GGGGCACGGC GACCCAGTGG     67680
     CTCGACGCGC CGACATCGAT CCCCGCCGCA TTGGGAAACA CCACGTCGTC GTCTCGCTTG     67740
     CGCATGGCCA TGGCTTGCTC CAAGATCGTC AGTGAACGGC AGCGCCATGG GAAGCGTCGA     67800
     GAATCGACTC GATCTCCTGA ACGGGATGCG CATCGCTGCG CTCACCACTG TCGGCGACGA     67860
     TTCCCGGACC ATGCTCTCAA GCGGGCTCGC TATAGCTCGC ACCATTGGCG TGTCGGTCAT     67920
     CGCAGCGCTG CCGTTCACCG GTATAGCCAA TCCTCGTTTC TTCGCCCACG GCGGGGCCGC     67980
     TAAGTGCCTT GAAATGCTCT CAAGAAACGA AACTGAAGGC GGCCGTGTTC ATGCGACCAC     68040
     CTCTACGGGA TGGATCTGGA AGCCGAGCGC CGCCGCGCGG CGTCTAAGGG AAGCGACGCT     68100
     GCGTTGGTGC TGTTGCTCCT CGTAACGCTG CTGGCCCTGG TCGACGAAGG CCTCGCCGCG     68160
     GGTCAGCATG AAGTAGACCA TCCGCGCGAG CTTGTGCGCG GTGGCGGTAT TGGCGCGCGG     68220
     CTTATCCATG CGGGCGCACA GACGACGGTA GAACGCGCCG AGCGCGGAGT CACTGTGCGA     68280
     CAACGACATG GCCGCCATCT TCAACGCCTG GCGCGCCCGG TTGGCTGATC GTTTGGTGCC     68340
     CGAGGACAGT ACCTTGCCAC CGCTGATCTT GGTGCCGGGA CATAGTCCCA GCCAGGAACA     68400
     GAAGTGCTTG ACGTTGGCGA AGCGACCCAG ATCGGGACCG ATCTCCGACA GGAGCTTCAT     68460
     CACTACCGTC ACCCCCAGCC CGTTGATACG CGTGAGGTCC ACGCCGGCCC AGTTGGCTAG     68520
     CGCCTGGCGC ACGTCGAACT CCATGCGCGC TTTGGCGCCG GCCTTGGGGG CCTTGCCCAG     68580
     GTCGACACGA CGCTCGCTGC GCTCGGCCAG CAGTTCGCGC AGCTTTGCCT CGCACTCGAC     68640
     CAGATGCCTG CCGATGTCGT CGTACATGGC CAGCGCCTGG CCCAGCACGA ACAGGTGTTC     68700
     CTCGCGCCAG TTGCCCGTCA GCGCCTTGAT GATCTCCTCG GCGCTGGCCT TGATGCGGCT     68760
     GTGGCGGTGC CGGGCCAGTA TTTTCGGGTC GCGTTCGCCA GCCACGATGG CTCGGATGAT     68820
     CGCCTGGCCG GTCTGCCCCA TTACGTCGCT GAGCACCTCG GTGAGCTGGA TGTTCATCTG     68880
     CACCAGCGCT TTCTGCATGC GCTGCACCCA ACTGGCCTGT TCGGTGAGCA GCACCTCGCG     68940
     CTGACGGGCC ACGGCCCGCA CCACGCAGAC TTCGCTGCCA GGACGCCAGG CCGCGCGCAG     69000
     TAGCCCGAGA CTCATGAGCT TCTGCAGCCA CTGGCAGTCT TGCACGTCGC TCTTGCGCCC     69060
     GGGCACGTAC TTGAGCTGCC GAGCATCGAC CAGCCAGACC TTCAATCCTC GCTGTTCCAG     69120
     CACCTCATAC ACGGGGATCC AGTACACCCC GGTGGACTCT AGCGCCACCG TGTCGATCCC     69180
     GCAGGCTAGC AGCCAGTCAG CCAGCGCGTT GAGGTCGTCG GTCATTGCGC CGAACTCGCG     69240
     TACTGGCTCG CAGCCGGCTT GTTCGGCGAA ATGCCGCGGC ACGGCCGCCC AGTGGCTCGA     69300
     CGCGCCCACG TCGATCCCCG CCGCGTTGGG GAATACCACC TCGTCGTCTC GCTTGCGCAT     69360
     TGCCATGGCT TGCTCCACCA TCGTTGATGA ACGGCAGCGC CATGGGAAGC GTCGAATTCG     69420
     ACTCGATCTC TCAAACGGGA TGCGGCTCAC GCCGCTCACC ACTGTCGCCG ACGATTCCAG     69480
     GACCAGGCTC AGAAGCGGGC TCACACCGTG GCGTCTGATC GCGTCACGGG CTCGCACCAA     69540
     TGGCATTTCG GTCATCTCGG CGCTGCCGTT CCCTTTATAG GGCAGAACCG TTTCTTCGCG     69600
     AACGCCGGGC ACAGGCATGG GTTTGGGAAG CTCAGAAGGC GTACGCGGCC TACCTCGGTG     69660
     CGCGCGACAT CATAGGCAAG TTGGACGCCG TCTGAACAGT CCCAGCCTGC TACAGGAGAC     69720
     GATGATGACA ACGGCTTATG ACCTGCTTCT CGATGCGCCC GACACGCAAG TGAAGCGTTG     69780
     TCAGCTCGCG TGGAAGGCTA TTGCGGTCGG CAATTGGCGA GATGCAGCGC ATTTCCTTCT     69840
     CAATGCGGCC GCGGAGGAGG GTGCAACGGC GTGGGCGACT GAAGCGCGAG CCCTTGCCGA     69900
     AGCATGTCAA GTTAAGGCGA ACCAAGACGC CTGACGACCA GGCCGCCGGC GGCGGCCGCA     69960
     CCCACCCATC CCCCCGCCCT TCCCGCCCTG CGGGAAGGGA GCGAGTCGCC CTCTGTCGTC     70020
     AAGGGTGCGG GGGAGATGAA ACCACCCCCA CACCCTCGAC TGGAGCGTCT ACACCGGCAC     70080
     GTCAGCCCCT CAAGGGCCGC TGCGCTGCCG TCCTCACCCG TTCGGTGCTC GACCTGGCCT     70140
     GCGGCCAGCT CTGCGCTCCG CGTGCGGCTT CCGGGCGGCC CCTTGACCGT CTGCCATGCC     70200
     GAACACCTTC CCCCATCTTT TTACGCAATT ACGTATTTAC GTATGTACGT AAGTACGCTA     70260
     TACTGGTCCC ATGCTGTTGA GCCAACCGGG AAGGAGAAAC CACGATGCAA GTACGAACCC     70320
     TCGCCCAAGC CATCGCTTTC GGAGAAGTGG CCGCGCAATA CCAGCAACTG CGGCGCGAGC     70380
     ATCCGACGAC GGCTACGCAA TCGCGCCGTA CATCATCGAT GCGGCGGATC ATGGCGTCCC     70440
     GCAGCATCGC AAGCGACTGT TCCTCGTTTG CACCCGGTCG GCCGCGCCGA TCACTCTTGA     70500
     CCTTCCCAAG CGCGACCACA GTCCCATTGG AACGTCATCG ATTGGGACGC GCCAGGCTGG     70560
     AGCAAGATCG ATAGAACCGG ACGCAGCCCG AACACGTTGG CCAGGATCGC GGCGGGGCGT     70620
     CGCGCGTTCG GCGATCGCTT CGTGGCGCCG TACTACGGCA ACGGCTCCGG CTTAACCGGT     70680
     CGCTCCATCG ACCGGCCGAT CGGCACGATC ACGACGGTAG ATCGCTGGGC AATCATCGAC     70740
     GGCGACCGTA TGCGAATGCT TCACCCGAAG GAGGCGAAGC GCGCGTGCGG CTTCCGTTCG     70800
     ACGTTCGCAC TCCCAGCGAA CCGGCGCAGC GCCATGCATT TGCTCGGTAA TGCCGTCATG     70860
     CCGCCGGCGG CCGCCGACCT GCTGCGCGCG TTACGGCGCG CTGCCTGATC CCTTTTTTGC     70920
     CCTCTTGAGT AGTAATAATA ATTGCACTAC TATTATTATT ACTACCAAAT CGCCGCCGAC     70980
     CACCGAGGTA CGTATGAACC AGGAACTGAA AGAGCGCATT TTCGCCGCCG CTGACGAGCT     71040
     CTACGCCGAA AACGGCGAGT TTCCCAACGT AGAGGCCGTG CGGCAGCGTG CCCGCGCGGG     71100
     CATGAACTAC GTGGTCGAGG CATTGAAGGA ATGGCGGCAG AAACAGCGCA TGCTCGTTCA     71160
     GAGCGTGCGC GAACCGCTCC CGGCCGAGCT GCACGACGCG ATGACGGGGT TCGGCAACCA     71220
     CATTTGGGAG GTCGCGCAGC GGCTGGCCAA CGATGCCTTA GAATCGGCGC GGGCCGCGTT     71280
     CGAGGCGGAA AAAAACGACC TGGCGCGCCT GTCGACCGAG CAGTCGGAGG CATACGAGGT     71340
     TCTTGCCGCC GAGCATGACC GCACGGTGGA GGATTTCACC CGCCTGCAGG GCAGGGCGGC     71400
     GCAGCTCGAG GAGGAACGAT CTGCACTGGC CGACCAGCTG CGCGCGGCCC AGCAAGAGGC     71460
     ACACGTCGCG GCCACCGAGA CTCGCGAGAA AGCGGCGCTC GTCGACCGCC TTGAGAAAGA     71520
     CCTCGAACGC GCGCGCGCGG AAGTCGACGG TCTTCGCGAG GAGCTGAACG CTGCACGGCG     71580
     CGAGCTCGCG GACGAGCGCG GCAAAGCTGC GACGGCCGAG ACGAGGCATG TCGCAGAGCG     71640
     AGAGGCCATG CAGCGGGAAA TCGACGTCCT GCGCGGCCAC GAGAAGGAGC AGTCGAAGGA     71700
     ACTCGCAGAG TCGCAACGAG CAGTGACCCG AGCAGAAGCC GAGCGAGACA AGCTCACTGA     71760
     GCAGTTGAGC GACGTCCGCA AGAGGACCGC CGACGAGATC CACCGTGCGC TGGAGAAGGT     71820
     GCAGCAGCGC GAGGCGGAAG CCGTGCAGGC GCGTAAAGAG GCAAGAGCCG CCGGCGAGCA     71880
     GCTCGCGCGC ACGTCGGGCG AGCTCGATGC CGCTAAGGCC CAACTGGCCG ACCTGCGCAC     71940
     GATCATCAAG GATCTGTCGT CGACGAAGCG GACACCGAAG GCATGACCTC AAACAACGGA     72000
     GTGAAAAAGA TGGAAAACAC GCTGAAACGG CCGATGTTTC AGTTGAGCAT CGGCGGCTTG     72060
     CTGGGTCTCG GCACCATATC CGCCATCGAG GCCCGATCGT GGGGCTCCTT CCTGTCCACG     72120
     GCTCTCATGG CTTTGTATCT TTTCGCTTTC GCCGCCAGTC GGCAGGCAGC GCGGGCCAGC     72180
     AAGCCACCGA TCCGTCTCGC GGGCAACATC GTCACCGCGT TGTGCGCCGT GCTTCTGCTC     72240
     GGTACGTTTC TACTCGTCGC GGAACGCATC TACCTGGTCA ACGGCAGCGG CTATCCGCAA     72300
     TGGCTCGCGC GTGACATAGG CGCGGCCAAC TACGCCGAGC TGGATCGACT TCACAGCACC     72360
     GAATGCAAGG GCGAGAGCAT GGAAATTTAT GGCAAGCGCA GCGGCCAATG GGTCATCCGC     72420
     TGCGGGTTCA CGTGGATCGG CGGCCGCACG TATATCTCGA GCACGAACCC CTACGGGCAC     72480
     ATGCTTGATG ACATCAAGCC GGAGGGCAAG CAATGAGCAC GCTTCGCCGC TTCTTCATCG     72540
     ACTACTTGAT GGTCCCGCTC GGCATTCCGC TCGTCTGCGC AGCCGCCTCG GTTTATCACG     72600
     TGTCGAAGGA AACCACTGCG ACCGGATACG CGACATTGGC AATGGCGTGG CCTCACCTCC     72660
     ATCAATCGAC CCGCGATGCA ATCGTGAGCG CGATGCGCGG CGACGGCGGC CGCATCAGCC     72720
     AGTGGGAGTT TGTCAGGCTG TCCGACCTCG CGTTGCGTGA CGCCGGCGCT CTTGAGCTGC     72780
     CGATCGCCGG CGACGACGTG TCTTTGCAGC GCGAGCGCCT GGTGCGGACC ATGACAGATA     72840
     CCGCACCGGC CGGCGCCATC CTGCGAGCTA CGTCTTTCAA GTGCATGCCG CTCCAGACAG     72900
     TAAGCGCTCT GCTCGACATG CGGGACAACA CCGCCGTGCA ATGCTCCACA ATGAGCGACG     72960
     TCGCCGACAG CACTGGCCGA GTCCTCATCG CCCGGAAGGC CCAGCTTTTC GGGTGGAAGA     73020
     AGGGCACAAG CGTCGAATGG ACATCGTGGA CCACGAACGA CGGCATCGTC GTCGGAGAAA     73080
     AGGTGCTGCA CGGTGTTGCG TTCACCAGCG CGTTGCAACC CACTCCCGAC GAATCTCTGA     73140
     CCGTGATGGC GCTGCACGAT ATTTCGGTTC CTTCCCTCGC GGCCCCAGCC AACTGAAACG     73200
     ATGCCGAGCT CGCGTCCAAC GACCTATCAG CGGCTTCTAA CCGAGCTTGC CGAGCTTGAC     73260
     GTTCGAATCG AGCAGGCGCG GGCACGCGAG CGCGTCCGCG CCATAGAAAC CATCCACGAG     73320
     CTGATGGACA CCTATGGAAT CAAGCACAGG GATCTCGTCG GCCGCAACGG TAGGCGAGGT     73380
     TCCTACCAGG TGAGCGCACT GCCGGCAAAA TACCGCGATC CGGCCACAGG CAGAGAGTGG     73440
     TGCGGACGCG GAAACGTGCC TCTTTGGATT CGCGGCAAAG ACCGCACACG ATTCCTCATC     73500
     GATTGACCGT TACCGTCATG TCCGAAGAAG TTCAGCGTCT CAACTACAGC ACGCACGCGC     73560
     TCGAGCAATT CGAGCAGCTC ATTCCCACGA TCCGCCGAGA CATGCCGGGC ATGCGCGCAG     73620
     GCTTTGAGGC CGTCACGCAT CTGCTTCGCC TCAGCGTGAA GTATCTCCTG CCGAACTGCG     73680
     CCGAACTCAT CGACGTCAGC GAGCTCCGGC AAGTCCACAT CGACAGCATG CGGCTTCCGC     73740
     ATCCCGTCGC TGCGCTCGAG GCGCCGTGGG TGTTGCCTGA TGGTGAAGGC GGCGACAAGG     73800
     GCAATCTGCG CTGTCCGAAG CGCATCGCCT TGTGCGTTGA GCTCGACGAA GACGTTGCCC     73860
     GGCTCTTGCC CGGTACCGAG CATTTACTCG ACGAGCCGGA CGGCGGGGTA TGCGTCATTC     73920
     CGATCTACTG GACCGAGGCC GGCCAGTGGC AACTCGCGCC AGGCGGTGCC TTCGTGCCGC     73980
     ATTCCAACGA ACTGAGCGCC TACGTGCCGG AGCAGGCGGA CGAACGTACA CGCCTGTTGA     74040
     ACGAACCGCT TCGGGAGGCG GGGCTATCGG CCCGCAAGAT GCGCCAGTTT CAGGTCTCGG     74100
     CCTTCGTCAT CCTGCCTGAG CAATACGAAT TCCTTGTGAC CCAGCTCGGT TCGCTGAGGG     74160
     TCGCTCATTC GGAGACGCTG GCCAACGCTC GCGATGACAT CCTGGCGCTG ATCCAGACCG     74220
     GATGCGTCGT CAACTGCTCG AACATCGAGA CGCCGACGCT CGAGGCTCCG GCAAAGCTCA     74280
     ACAAGAAGCG CCAACAGAAC GGCAAGGTGC CGTTTTTCGA CTATCGGGTG CTGGCCCTCC     74340
     GGCCGACGAA GGCTGGCGAC GGGCAAGGGA GGGGAGGGCA GCACGCGAGC CCGCGAGCGC     74400
     ACATCAGGCG CGGGCACATC CGCAGGCTGG AACACAAGAC CGTATGGGTG TCCGACACAC     74460
     TGGTGAACGC AGGCTCGGCT CGCGGTGTCG TGGTCAAGGA TTACGCCGTC CGACCGCTCA     74520
     AGCCCTGACC CGCCCTTAAA ATAGTTTCAC GGCCGCTACG AGAGGCCACA GGAAGGCCGC     74580
     TGATGCGGCG AGCAGGCCGA TGCAGCCAGC AAGAAGCCCC AACCGCCTGC CGGCCCTCAA     74640
     ATCGTCCCGC GCGCGCCACG CCGCGCCAAC GGCTGCCGCG GCGCCGCCGG CAGCAGCCAG     74700
     CCACCCGGCC GGCGTGCGTG CCAACGCACC AAGGATCATC GTTAGCGGGC CGTCTCCTGC     74760
     GGTCGGCACC GCCCAATACG GCAGACGGCC GCTGCCCAAC ACAAAGCCGA CAAAAACACA     74820
     CAGCGTTCCG AACGCCGCGA ACGCGAACCA CGCCCATCCC CACGAAAGCC ATCGCGACGC     74880
     ATCGACAAGC CGCACTGCGA CCTGCTCGCT AGTCTTGCTC ACAGCGTCGG CGAGCGTCCC     74940
     GAGAGCCTTC TTCGTCTCTG CGTCGGCGAT CGCCGCCATT GCAACCCGTT GCTCGTCGAG     75000
     AATCTTGCCG ACGTGATCGG AGATCATCGC CGGATACTTC CGGTACAACG CGTCGTAAGA     75060
     CTCCAGTGCC ATGAGCACGA GCCAAAGCGC ATCGTTGTCG CGGATATTGA GCGCATTCTT     75120
     GACGCGATAA AGGCTCTGGA CTTCCCGCTC CGTGGGCTGC CTGCCGAGCA GCTTCTCGAA     75180
     GCTCGCTTCA ACGTCAAGCA TCGAGCACTT CCCCTAGCGC CTTACGCACT TCGTTGCGCC     75240
     ACCTGGTCAG TTCCGCACGA TTGCCGATCG GAAGCTCTTT CATCGCTGCC GAGATCGACA     75300
     GACGCTTGCT ATACAAATCG TCGCTAACGC GGTCCGCGAG ATCCGGCAGA TTGACTGACT     75360
     TTCCGCCGTT ATCTTCGACT GCCTTGCGCG TCTTCGACGT GTTGTACAGC TCGAACTTCT     75420
     GCTCGTCGCC GAAGTAGGTA TTGCGCACGA CATGAATCGC CGAGCCAGGC AGCGATTCCA     75480
     TGTACTCCTT AAGCAACTCC AAACTGTCTC GCTGGCGATT GATGACCCAC AGTGTCACCA     75540
     GCTTACGACC CAGCTCGCCA AGCGTGCTGT TGAGCGTCTC GCCATAGGCC GCTACGCCCT     75600
     TATTGTTCCT CGCTGCCGTG TTCACCACCA CGACCGCATC CGAATTCTCA TGGCAAACGT     75660
     TCACCAGATC GATCCAGCCA TTCGCCTCAT CGAGGTTAAT CAGCTCCGCT TTCACCTCGC     75720
     CCTTGTACAT CTTCCAGACG TCGGGATTCG ATGTATCGGA CTCGATCAGC AGGATCTTCT     75780
     CAGAACGTGC CTGCAAGGTG TCGATAACAC CGATCGACAC AGCCGACTTT CCCACGCCTC     75840
     CCTTGCTGCC ACCCACCATA TAAATCGGTT TCATTCCGTC TTACCTCTCA GATGTCGTCA     75900
     GAATCCGCGC GCGGCGTAAA GCCACCGCTT CGCTGAGAAG GCTCCGATGC CTCCTCTTTC     75960
     GCCTGCGCCT TCGGCGTTTG GGCCTTCGCC GCCTTGACTG CCGATTCGCT GCCTTGATCG     76020
     ATGCTGGTTT TCGCCCTCGC TTCTCCCTTC TCAGAAGGCT TCGGCGTTAC AGCTTTTCGC     76080
     CGTCGCTTCG GCTGCGTAGC AGCCTGCCTA AGCGCCTTCT CTGAAATCCG TATAAAGCCC     76140
     TTCATACGGA GTTTCTCAGC GATCTGCGCA TAGCTGTAGC CACGAGTAAG CCATTCGTTC     76200
     ACAACCCCCG CCATCAGCTT GATCGTCTGG GCTCTGTCTG CCGCCCTTTC GTTCTCGTCG     76260
     ATCTCGGGGA ACTCTTTGTC CAACTCATCA AGCATCAGCT TGATTTGGCC AACAGTGTAT     76320
     TTCATATCGT GCCTACATTA CAAAAAAAGA GGTCCGCAGG ACCAGATTCT AGCCTTTCGG     76380
     CTTGATGAGT CAAATTCTTG CCGGTAGACT TCGTGAATCG ATGACGGTAG TTCGGGGACA     76440
     AGGTAGGGTT TGCTATACCG CCATAAATGG CGTCCTAGCA ACCGGCAGCG CACCAGTCGT     76500
     TTCACTCCCT CTGCGCAGCC TACCGTCCCT GCTCAGGGCG AAGCCCCGAG ACCCCAACGG     76560
     CGTGAGAGTT CAGTGTGAGT AGCAGTGAGG AACGACAGAA AACGAAGCAC GTAATGGTGA     76620
     GGGTGACGCC CGAGCAGTTG GCCACGCTTC GCGAGAAGGC CAATGATTCG GGCGTTACCG     76680
     TGCCGGAATA CCTGCGCGCG TGTGGCCTCG GGCGGCCTAC ACGCAGCAAG ATGGAAGCGC     76740
     ATATCGTCAA TGAACTGCGT CGCCTCGGTG GCCTACAGAA GCATCTGTTC ACCGAGGGCG     76800
     GCGGCGTGCT GTCCAAAGAG TTTGCGGCGG TCCTCGTTGA AATCCGCGCA GCCATCGCTC     76860
     GGGTTGGTGA ATGACCGATG CTGGCGAAAA TCCCCGAGCG GCGCGAAGAC GGTAGGTCCG     76920
     ACTTCGGCGA CCTGGTGGAG TACATCACCA ACCGCGACGA CGACCAGGAG AAACTAAGTG     76980
     ACGAGCTCGA TCCAAGCGAC CGAAGAAGAC ACCACCAAAT TCTTGAGCGT GCTCGAGAAC     77040
     ATCTCGCAGG AGCAGAAGAC CATCTGCGCG CTGCTCGACG AACTGATTCT ATTGATGCAG     77100
     ATGCCATCCG AGTCCGTCTT GGAAGTGCTC GAAGGGCTGT TGCTGCCTAT GGGGCAGAAC     77160
     ATGGTCGAGC TGACGAGCGA GCTGAAGACT CAGCTGACGG ACGAGGAGGC GTAGATGGCG     77220
     ATCAACATCA ACGAAGCCTT GCCCGTGCTC GAAACCATCT ACGAGCAGCA GCGAGCTATC     77280
     TCCGACAGGC TCCGCAAGCT GATCGAGACT TTCAAGAGCG AGCCCGAGCC CGTCGAGCCT     77340
     ACCTTGCGTT TAATGCTCAA GCCGCTCAAC GAAGGTATGG ACGAGATGCA TCAGATGCTC     77400
     TCGCCGACCT CGGCCGACTC CTCGGAGAAC CCGAGCGAGT CATAACGCCC AACGGCGTTG     77460
     CCTGCGAGCA CAACTGTTTG TCGCTGGCGA CCGCAGCGGC TGAAATGAAA GCCGTCGCGG     77520
     CGCAGAATCC CAGGGTCAAA GACCCGGTGT ATCACATTGT CTTGGCGTGG CAACCTTCAG     77580
     AGTCGCCCAC CGATCAAGAA ATGTTCGAGG CGGGACAACA CGCGTTAGCT GCCGTCGGCA     77640
     TGGTCGATCA CCAATACGTG TTTGCCGTCC ATCGTGACAC TCAGCATGTG CATTTGCACA     77700
     TGGCCGTGAA TCGCGTTAAT CCTGACACCT TCGCGGCCAT TTATCCGGAA CGCGACTACT     77760
     TCAAGCTCGA TCGTGCGATG CGCGAACTCG AACTCAAGTA CGGGTGGAAC CACTCCAACG     77820
     GCCCTTTTGC TGTGTTCGAG CGTAACGGAC AGACCGTCAT AGATTGGGCG AGCAAGGACC     77880
     CTAATACGAA GGGCAAACGG CCGACGCGGG CGGCCGACAT GGAGCGGCAC GCCGATCAGG     77940
     AAAGCCTGTT CAGCTACGCA CGTGGCGAGC CACGCAAGGC GCTCCTGGCC GCGCTCAAGA     78000
     ACGACAAGCT GACTTGGCGG CAGCTCCACA ACCTACTCGC GAAATTCGGG CTCGAGCTGC     78060
     GGGAAAAAGG GCAGGGGTTC GCCATCTACG ACCTCAATTC GAGCGACACG ACGCCGATCA     78120
     AGGCAAGCGA CATGCACGAA GCGCTGGGCA AGTCGCGGCT GGAGAAACGA CTTGGCCCAT     78180
     TCGAGGCTTC GACGTCAACG ACCGATGCAA TTCTTACCTA CGACAAGCAG CGCCCCTTGA     78240
     AGCGCGATCC GAGAGTCCGC GAGGAGCGCC GACAGGCCCG TGCAGATGCC CGACGGGATC     78300
     TGCGCGCCCG GTACGAGGAA TACAAAAAGG GCTTCGTCTA TCGACGCCTC GATCCAGCCG     78360
     ACGTGCGAGC CCGCTTCGCT GCGATCCGCG CCGACGCGCG TCAGCGACGC CTCGAGGTAC     78420
     GGCAAACCGT CAGCGATCTA GCGGCTCGCC AGGCGCTTTA CAGCGTCATT GCATTCGAGA     78480
     CGCTACGCGC GCGAGACAGG TTGCAGCGGG AGATTCGCAA AGAGCGTCAG GCATTGCGGG     78540
     ACGACCAGTC GAACCGGCGA CAGTCCTATC GCGAATGGGT CGAACGCCAG GCGGCTGCCG     78600
     GCGACACGGC GGCCATCAGC CAGCTCCGCG GCTTCGCCTA TAGCGAGAAG CGGCTCGCGA     78660
     AGGAGCTGGA GAGGGCACTC GCGAACGACG GAGCCGACGG CATCATTCAC CCTGACGATG     78720
     CAGATCCGGC TGCCCGCGAC ATCGCCGAAG GCGTTTATTA CCGCGTGCGG CGCGACGGAA     78780
     CCGTCGTGTA CCGGCTCGAC GATGGACGCG ACGCTTTCGT CGACCTCGGC CGGCGCATCG     78840
     ACGTGCTGGC GAAGGGGGAG GCCGACACCG CGGCGATCGC CGCTGCCCTG CAACTGGCCG     78900
     GCGAAAAGTA TGGCGGCACG TTCGAGCTGA CCGGCAGCGA GGAATTCAAG CGTCGGGCGA     78960
     TCGACGTCAT GCTCGAATAC AAAATCGACG TGCGGCTCAA AGACGCCGCT CAGGAAGCGC     79020
     TGCGCCGCGC CAGAGCGGCC GAGATTGCGC GGGCCAGCCG GGATGCGAAG GCCCGGCAAC     79080
     AACGCCGGAA ATAGCCCCTT TCGTTGCTCT CTTTCTTTTT GTATAGTAAC CTTAATACGA     79140
     AATTTTCAAA GGAGGGCCAC CTATGGCTAT GCCGCGTTAC ACCGTTGCCG GTTTGCTGAT     79200
     CGGCCTCGCG CTCACTGGCT GCGCGACGCA ACCGAAGACC GACAACGCTC AGATCGAAAT     79260
     CGACCGCCAG ATTCTCGACG CCTCGCAGAA GATCCAGTCC GCACAGGCGG ATCTGTATCA     79320
     GGCCGGCGCG CTCAACCAAC CCACCACGAA GGTGCCGGTG TCGATCGTGG ACGACCAGCA     79380
     CCGCGTCACG CTCTCGTGGC AGGGTGACGC CCTGCAGCTC CTGAACAAGC TCGCGCATGA     79440
     CCGCGGGCTT GCCTTTTCGT TCATGGGCGT TCGCATGCCC TTGCCGGTCA ACATCGACGT     79500
     CAAGGACGCG TCTTACGATG CGGTCATGCA GATGGTTCGA GCGCAGATCG GCTATCGGGC     79560
     CGACGTCACG CAGTACCCGG ACAAGCTGGT CCTGCAATAC AACCGGCCGC AGTCCTGATA     79620
     CGGGAGACAA TCATGAAGCG CTTTGTCGTC GCGGCGATTC CGCTCCTCGT GGCCGGCATG     79680
     GCACATGCCG CAGAGACCCC TGCGCCGGCC GCCGCATCGG CTCCGCAGGC ACAGTCGCCG     79740
     GCTGCTGCAT CGTCGGCATC GGTTCCGACC GCTCAAGCCC CTGCGGTACC TTCGCCTGAA     79800
     GTCCAAGCGG CTACGCCGGC GCCCGAAGAG CAGCCAATCA CGCTCGACTC GCTGCTCAAC     79860
     CCGCCTTCGC AGGCGAGCAC GGGCCTTTCC GATCTGCGCG TGCAGATGCT GACCGACGCC     79920
     GGCAAGACCG TCGGTTTCCG GGGCGGCATG GCCGCACGAG CCCGTGTGCT GCGCGATGCG     79980
     CTCAACGCGC GCGCGGAGCG TCTTGACACC ATTTTCCAAT TCTCGCCGCT CATCAACCGC     80040
     AACGGCACTA TCCCGCCGGT TATTGTCGAA GCGCGCGATC TCTCGTCGTT CTCCCCCGAC     80100
     CAGATTCGCA CCGCGAATCG CGTCTACAAG ATCGAGAGGG AAGAACGGTT CGTGAGCGTC     80160
     CCGCCGACGT GGCGCGACTA TCTGTTTGTC GGCCTCCCGA TCAAGGGCGG CGTCGACCTG     80220
     CCGACTTTCG AAACTCGACC GAAAGACGGC AAGGAAGAGG CCGTCTGGCG CGATGCGGTC     80280
     AAGAAGGGAT GGGATGCCGG CGAGCAGCAG GCCGATGCGA TCCTTGCCGC CAATTTCAAC     80340
     CGACTCACGC GCGACTACAC CGGCATGCTG CGATATTCGA CGCTCGTGCA GGAAGGCATG     80400
     ATCTCGACCA CGCGCGTTGC AGAATCGCGG CAAACGGTGA CGGGCGACGG CCGGCAGCTC     80460
     ATGCTCGGCG ACACCTTGCG CCGCGTGACG AGCAGGGCGA CGTTCGAAAC GAACCCGAAC     80520
     AACTGGCGTC CGACGGTCAA CCGGGGCGAG CAGCCTGCAC CGAAGGTCGC TCCCGTTCCG     80580
     CAATCTGCAG TCGTACCGGC TACCGAGCCG CCCGCGACGC AGATCGAAGG CCGACCGCAG     80640
     GGTGACGACG GTAAATGAGC GACCTCGTTC AGTTCGAACC CTACGATTTT CGGGGCGACG     80700
     TAACCGCGCA CACGTTCAAG CAGTTCTTGA AATACTGCGC GGACTACGGC GCTTCGGACA     80760
     TCCTCGTGCA GGGCGGCGAT TACGCGTGGG TCGAGATCCA CGGCCGTCAG CGTCAGGCCA     80820
     GCACGCACAC GATCAAGCAG GGCCACCTGT CTAACCTGAT CAGTACCGTA TGGCAGGCCG     80880
     AAGTCGAGAA CAACGTTCGC GCCGGCCACG GCGCCGACCG CTCGCTCGAG CTCGCTGGCG     80940
     AAGAGCTCGG CATCGACCGG GGCAAATTCC TTCGTTTCCG CTGCAACTTC ATCCAGGGAC     81000
     GTGTAGCGCG GTACGACATG GCCTACGCGG TCACGATGCG TCTGATCCCG TTCGATCTGC     81060
     CCGACATCAC CAAGATGGGC ATCGAACAGG AGCTGTTCGA GGCGTTCTAT CCGGGCATGG     81120
     GCCTCGTTCT CGTCTGCGGT CCGACCGGCT CGGGCAAGAC CACGCTTCAA TCTGCCGTCT     81180
     ACGGTTATGC CGGCATCCAT ATGCCGGACC GCAAGGTCAT CACCTACGAA GACCCGATCG     81240
     AGTTCGTGCT CGGCGGACCT CACTGGAAGG GGCCGCAGCC GCACCAAGCT CAAATCGGCC     81300
     GCGACATTGA AAGTTTTGCA ACCGGCCTGC GCAACGCCAT GCGCCGCAAG CCGAGCATTA     81360
     TCGGCATCGG CGAAATGCGC GACCTTGAAA CGATCGACGC AGCGATCGAG GCCGGCCTCA     81420
     CCGGCCACCT GACCTACGGC ACGATGCACA CCGAATCGTG CGCCGAGACA ATCAACCGTG     81480
     CTATCCAGGT CTATCCACCG CAACAGCAGT CGGCCGTCGC GTCGCGGTTG CTCGGTTGCC     81540
     TGCGCGTTAT CGTCGTGCAG CGCTTGCTCA AAACCACCGA TGGTAAGCGC GTCGCCGTTC     81600
     GCGAATTCGT GATCTTCGAT CGCGACTTCA AGAACGAGCT GCAATCGCAG CCCTACGATC     81660
     AGTGGGCACC GATGATCCGC GCACGTCTGG AATCCGAAAA GGCGACCCTC GACGACAAGG     81720
     CGTGGGCGCT CTACGAGGCT GGCCGCATCG ACAAAAGCGA GTTCATCGAG CTGGCCGGTC     81780
     ACAAGGCATT CCGCATCCGT TCTCAGGAGG CAGCATGAGC ATCTCCATCT GGCGTCACGC     81840
     ATCGCAGACA CCGACCTTGC TGGGCATTCC CTGCATCGCA TATATGCCTA TCTTCGTGTG     81900
     GCTGTTCCAC ATGCGCTGGT GGTCATTCTG GACTGCGATA GGCGTGATCG TCTTCTTCGC     81960
     AGTGCTTGCG AAGTTTGGCC TCTCGTTCAA GGTGCTATGG CAGAAGTTCT TGCACCTGTT     82020
     GCGAGGATCG CGCATCTACG CACGCCCTTG GTGGTACCGC AACCGCTTTC AGGACCATGA     82080
     CTGAATACCA TGAAGAAGAA AGAGCTGCGC CGACTACCGG TCGACATCGC ATTGCCTCAA     82140
     CGCGTTCTCT TGGAAAACGG CACGATGTTT GCCGCATTTG AGAATCTGGA AGACCTCGAA     82200
     GTATTCTGGT TGGCCAATCG TTTTCCTTTC GCGTGCGAAA GCGCTGAAAG CGCTGAAGGG     82260
     CAGGCGGTTT TTTTGCGCCC TGGCGAATGG GTATTTGGCC CTTCAAAAGC TGCTGTCGTC     82320
     AAAACAGCGA TGCGTTGGGA CGAGTGGGGG ATTCGGTGCG AGTATCAAAA CTACGGCAAT     82380
     GACGAATTCA TCGATGGATG GCTCGCCGAC CTCACGATTG ATCGCAGCAA ACGGATTGCC     82440
     AATGGAACGT GGACGGAAGG GGATGAGCTG AAATATACGC GTAGATCGTC TAAGCAATTC     82500
     CCCGGTTGCT GGAGGCTCAC CAATCTTCCC AATGGATTCG ATGCTGAGGA TTGGCTCACG     82560
     AATGATTTTA ATGTCGAGGG AACGCTTGAT GATCCAAGAA CACCCATTGG TCAAGTAGTT     82620
     ACTGCTCTCC AAGAAGCTAC GTTTGACGAC TGGGGAGAGC ACAACAGTCA GGTTCTCTCT     82680
     TTTTACGACC AATATGGTGT CGACAGATGC ATCGATTACC TGCGAGAAGA GGCCGCACTC     82740
     GGTTACGCCT ATCCGTAGGC AAATTGTGGA GGCCACGGTG ACACTTCAAC GTATTTACAC     82800
     GTCAAATGCC CGTGCGGCCG ACGTCCGCAA TCTCGAGCGG CAAGTCACGA CGTCGCCCCG     82860
     CGCGAGGGCG AGCAGCATTT ACGAAATCAC GCGCGATCGC GCGGTATGGC GCGTTCCCGT     82920
     GCCTGGCCAA TCTGACCGCT ACATGTCTGC GTCCGCCGGC CATGTCGGCG ACGACCACTT     82980
     CCAAGATCAC GAATAGGAAC GGCGCCATGT CAACTCCATT CACGCCAATG GATGTCATCG     83040
     CAGACCTCGA CCAGGTTCAC GAACACTTGG TCTCGAGTGG ACACACCAGC GACGCATCGA     83100
     TCGTCTTGCA GGCCGCGATT CGCACGATCG AGTTGATCGC CCGTGTCGAC ACACTGACGC     83160
     GTTTCCAGCT TCGCGGCATG GAGGGCCTGT CGCTCAAAGA GAGGGCAGAA CTACTCGCCA     83220
     AGGTCGACGC GATGTCGCGC GCGCAACGCG CGATCGTCGG CCACGGCGAT GTACTCGCCC     83280
     GCGAAGCGCG AGAAATCCTT GAGGCTGTCG CTCCCAGCCG GAGGGGGGAC TGATGCTCGA     83340
     GCGCATTCGC CTTTCGATCG CACGCGCGAG CGAGCTCCGT AACCTCGAGC GGCAAGTCGC     83400
     GACGTCGCCC CGCGCGAGGG CATGCAGCAT CCACGAAATC ACGCGCAATC GCGCAGTATG     83460
     GCGAGTTCCG GTGCCTAGCC AACCCGGCCG CTACATGTCT GCGTCCGCTG GCCACGTGGG     83520
     CGACGAGATG TTCGCGGTCC ACGTCGACGC TGATGCCTTC TACCTAGCGT GGCTGCGCAG     83580
     CGACGAGCAG TGCGTTGTGC GCGCGCAAAG GCCCCGCGAC TACAAGTATG CCTACGCGGT     83640
     CGACGGATTC GCGCAGGGCA GCGCGAACCC GGTTCCGCTC GCCGACGTCG GCGCATGGAA     83700
     CGACGAACGC GGCCGCACTC GCATCGGCTT CACGAACGGA ATTACCCGCA GCTTCTGGCT     83760
     CATCGCGAAC CGCGCTCCTT CGTTCCCTGT TCAGGTGTAC GGGCGTGAGT CGGCCGAACT     83820
     CCTGCACCGC ACGGCCGGCG CGACGCAAGG CCCGATCTGC TACGCGGATC TCTTCACGTC     83880
     GGCCGCACCA CGAAGCGCGC CAGTGCGAGC GCTGAGCCGC GCGCCGCGGC CCTGATGTCT     83940
     CTCAGGCTCT AGCACGGCCC TCGGATAACG CTAGAGCCTT TCTCGCCGGC CCTTGTGGCC     84000
     GGTTTTTTTC GTCCGCGCAC GTACAGCTCG CGCGCCGGCG CGATCAAAAG AAAAGGCCAC     84060
     CGAAGTGGCC TTTTGGCAAG ATCTCGATCG GACCGTCATT TCCAGATGTT GCTCCAGAAG     84120
     GTCGACGACT GCGACGACCC TGCACTGGTC TGCTGCAACG ACGGGCCGCT GAGCTGCGGC     84180
     ACGCTGCCGA TGACCTGGCC GGCGCCCGTA CCGTTCACGG CATTGTTGAT CTGCCCGTTG     84240
     ATGCCGTTCA TAACGCCGCT GATCTGGCCA TTGACGTCGT TCACCACGCC GTTGACCTGA     84300
     TCGCTGGCGA TCTGGCAGAC CTTGTTCTTG ATCTGGTCGA AAATGTCAGA GAGGGACGGG     84360
     AATTGCGGGG CGGTCAGCAC CGAAGTGATG CCGCCCACGC ATTTTCCGAG AATGTCCGAG     84420
     GAGGACCGTT CGCTTTGGGC AGTCTGCTGC GCAGCCTGTT TATCCCGTTC GTAACCGCTC     84480
     TGACTGCCCG CGGCGGCAGC GCTGCCGCTT CGGCAGGTCG CTGCCTGTAC GCCGGCAGCA     84540
     GAGCACAGCA ACAGCACGAA TAACGCGCGT ACAAAGATTT TCATGGCGAT TCCCTCGTTG     84600
     GATGAACAGG CGCCACGGCG TCAAGCCTTA GCGCGCGAAC TACGGCGTGC TTTTGGAGCG     84660
     CCGGCCGCGT CCTCCTTTGG CTTGGCCGCC GGCGCCGTCG GTTTTGGGCT CGTATCTTCC     84720
     TTGTTTGCCG ACGACTTGTT GTCCTCCTTC GGCGGCCGCG GCTTTCGATC TTCGATGAAG     84780
     CCGAGCTTCC GGTGCAACTC GTCATCGCAA TGGCGCGTCA CGCGACCACC TACTAACTGG     84840
     TTGCCGACGC TAAACAAAAC TTCGTCGAAG TATACCGGCT TGTTGTCGGT TCGCCGATTG     84900
     ACCGCGTTGC CATAACCGAT CTGCTTCCAT GTCGTCTCGT CGCCGGTGTT TTGAGCCTCC     84960
     GTGAGCGTAA TGAAATTCGG CTTAATCTCG CCCGTCTCCT GATCGGGCTT CCGCTCGTTC     85020
     AAGTGGGCAA TGACGTGACG CTTTTCGTCG CCGACCTTGA TGAAGCCCTG CAAGAAGTCA     85080
     CCTTTCCCTT TAAACAAAAG GACGTTTGTG TCCCATTCGC CGTTGTCGAG CTTCTTCACC     85140
     GACCGAATGA CCGCATGCGG TTCCTTTTCA GCGCTGTTAT CACTAGTAGC CATACCCAAC     85200
     TCCTTCTCGT TGATGTCAGA CACCACTTCC GCGCGAGATT CAGCACTGCT CATTGCGACG     85260
     CGCGCACGCA ATTCGGATTG GGAACCGTCC GAGAAGCCCG GCACTTCGGG GTTGACGCTC     85320
     GCCAGATAGG CGCCGGCATC AGCGGGCGCC TCGCAGGGCT TCCCGGCCTT ATCGAACCAA     85380
     TACACGAGAT CCGGTGACGG CTGCGGGCCG AGGGCATCGA AATCCGCGCG CAGCTCCAGA     85440
     TCTGTTTTCG CCCACACATG GATCGCTTCG CGCTGGACCG TCCACCAGTC CAGTGCCCGG     85500
     ATTGGAACGA GGTCGGCCGC GAGCCGACCT TGCGGGGCTT CTACTGGCGT GTCGCTGGGC     85560
     GAATTCGCCG CGGCGGTTGT GTCGGTGCTC GGCTCTTCGG CAGCGGGCTT GCCAATACGC     85620
     GGCTCAGGTG CCGCAGCTTT CGCGGCTTCC TGTTTTTCCG ACGCCTCTGG CTTGGCCTTC     85680
     GCCAGCTCTC TGCGAAGCGC GTCCTGCTGC GGGTTTTTGA GCGTCACGTC GACCTTGTGC     85740
     TTCAACATGA TCTCGATCGC GCGGCGCTGG AATGCCTCGC TGCCGGTCAG CTCGAATGCA     85800
     CCGCCATACT TCTCCTTGGC AAGCAGCACG GCCGCGAGTA TGGCTTCCTC GTCCTCGTTC     85860
     GCCTTGTCGG CCATCACGAT TTGCTGACCG TGATCGATGA ACGCCGGCCG CTCGCTCACC     85920
     ATGTAGAGAA CGCTGCCGTC CTTTTGCGCC TTGTACGTGA CGCTCTCCAG CAGCTTGCTG     85980
     ATCGCCAGCT CGGGATCGAA CGGCTTGTCG TCGGCATCGG CATCGGTGCC GCCGGCAAAG     86040
     CCGTCGGCTT CTTCCACCGT GGGTGACTTC GTCGCCTCGC TCTGCACTGG TGCCGACGGC     86100
     TCGGTCGGTG ACACGGACTT CGCCGCTTCG CTATCGCCTC CTGCTTTCGC CGGCGCTTCC     86160
     TGTTCGACGC GCTCGGTGTC CGTCGGCGTC GATGCAGGAG CGTCATCGGC GAGCTCCTTG     86220
     GCCCGAGCAT GCGCGACCGC GAGCCGTTCC TGCGTTTCGC GCAGAGCCAC GGCATCAGCC     86280
     CCGGCTGCAC GAAGCGCCTC GATGCGCAGT TCCAGACCGA ACGCATAGTG CTCGACAGCT     86340
     TGGCGACGCT CGAGTACATA GCGCGGCGCA GGGTCGCCTT CATTGCCTGC TCGGAGCGCC     86400
     AAGTCGTCAA TTACCTGCTC GTGGTTCGCC GCTCCCTTCG ATGCTTGATA AGCCCGTTCG     86460
     CCTTCGAACG CACGCTGGAC AGGGCTATCG GGAAAAGGGC AGGGCCGCGA CGTATCGACG     86520
     CGGGCCATCG CGCTCGCGAG TTCGAGCGCT GCGCCAAGGT CGGCGCGATC ACCGCCGAGA     86580
     TAGACGTGAT CCACGGCGCG GCCTAGCCGC GCCCACTCTT CATCGGGAAT ATGCCCACTG     86640
     CCATTGAACG ACTCGGCGAT GCGCAGGGCT GCCTGCTGCT CCGCAAGAAG AGCCGCACGG     86700
     CTGTCCTCGA ACTCGCGCGC CTTCCGGGCT TCCTTCTCAG CCGATCTGCG CTCGTTCTCC     86760
     GCCGCGAGGG ACTTGACACG ATCGACCATC CCTGCATCGA TCGTCTGAAG AATTTCCGCA     86820
     TACGAAACGT TTGCGGAAAG ATTTTGGAAG ATGTCTTCCG CCGCAATGTC GTGCCTGTCA     86880
     CCTGGCATTT CGCGCCAGGA CGTCAGGTCA GCAACGGCCC AATGCCGCAC GAAGTCCGGT     86940
     GCGAGCTCTA CTGACTCGTT CGCGTTTTGG GTAGCGATAC GCCAGTCTCG AAACGCAATC     87000
     GAACGCTGCT CGATGGCACC TTCGGGCGAC AGTTGCGAAC CCGTGCCTGG ATTGACCAAG     87060
     CGCTCATAGA CCGCCTGGCG GAACTGTTGC ATCAGTGCTT CTGACTCTGC GCTCATAGGG     87120
     CATTCCCTAG TGGGTGAAGG GCAGGGCCAT CCTCAAGTCT CGATGCTCAC GGGCCGATAA     87180
     ACGCCTAATT GTTGCCGTGA GCCGATCGTG GGGCTGGACC CTAGCCGAAC GAATTTTGTA     87240
     TCGTGTATAT TATTCAAAAT AGAGCACGTT GGGAAGTGCC AAGAAAACAG TGCCCAGAAA     87300
     GGGGCTTCCT TGCTATCATT GAGCGAATGA ATGTGGACAT GCGAAACGAA CAGCTTCAGC     87360
     CAATCTGCGG AACTGACCTG GAGCGTTGGA GGATCGAGAA CGGTCTGACG AAAGTTGCGG     87420
     CAGCGGATGC CTTCGGCTTG CAAAAAGCGA AGTGGGAGGA GCTGACCAGT GCTGAGAACT     87480
     CGGCAAAGCA GATCGCCGAT CCGGTAGTGG CCATGCTCCT TCATTTGTAT CGGCAATACC     87540
     CTGAATCAGC GCCCGTACAA CTGCCGCCCG ACGTCAAGGA GTTCTACGAC TACCTCGGAC     87600
     TGCAGGACAC GCCGCAGGAT CGCGACAAGT TCGCAACGCT GATCGGACGT TCGCCGCCGT     87660
     CGGTATATCG CTTGCTATTG CATGACGGTA AGCCTGGCCG GCCGGTGATG CGTTGGATCG     87720
     AAGCGGTGCG TCGGCTCAAG CTAACGCCGA AGAAAACTCT TCGGCTGATG GCAGATGTAG     87780
     TGAGCAGCGT TGGCGACCGG CAGCACGTCG AAAAAGTGCT GATTCAGGGC TGGACTAAAC     87840
     AAGGTGATAC TGGTGAGCAC GAATGAGAAG CCCGACTCAC AGCATATTAT TGAGCTATCG     87900
     ACGGTGTACT TTTACGAGGG TGCGGCGCCG CGCGTGATCG CACTGAAGGA TTGTGGTTTG     87960
     CCTATGAAAA GTCCCGTCCC TGGGGCTTTT TCCGCATTAT ATGGATACCA AAGTAAGCAG     88020
     GAAGGATTCA TGGCGGCTCG TGCCTACGCC GACAAGAATC GCCTGCAATT CACCGTCATA     88080
     GATTTGCTCG TCAAGCTGGA CCAGAAACAG AACCCGCTCA TGATGAAGCC GGAGGATCTG     88140
     CCACAGCACG ACTTCATCAC GTTCCAACGT CTTTCGCGGA GCATGACGGA CGAGCTGGGA     88200
     GGCATTCTCA AGCAGCAGCT CGAGCGCGAG GGAGGAGACA CAAGTGCCCT CGATCCGTCG     88260
     AAACCGCACC TCCTCCTGAT GCAACGGCCG GATTTGATCG CGGCTGTTAT CAACGAACCG     88320
     GGCTGGGAGC ACATGAAGGT CGTGACCTAC CCGGCAAAGA TCGCGCTCAG TGAAAAACCG     88380
     CTGAACGTCG GCACCGTGCC GTTCCGGCAC TGGGATTCGA TTCAGAAGGC CACGTGCCGC     88440
     TTGAATCCGA ACATCCAGAT CACGCTCGAC CCGCCAGGCC AGCGTGCAAA AGATGCCCCT     88500
     GCCAGTGCGC CGCCCTCCGA TCGGCCACGC GGTCCGCGCA TGAAGTAAGG AAGCCGCCCA     88560
     CGGGCGGCTT TTTCGCATCT GCGCGCAGCA GAGCAGGGCA GGGCCGCCGA CGGCGGCCGC     88620
     ACCCACCCAT CCCCCCGCCC TTCCCGCCCT GCGGGAAGGG AGCGAGTCGC CCTCTGTCGT     88680
     CAAGGGTGCG GGGGAGATGA AACCACCCCC ACACCCTCGA CTGGAGCGTC TACACCGGCA     88740
     CGTCAGCCCC TCAAGGGCCG CTGCGCTGCC GTCCTCACCC GTTCGGTGCT CGACCTGGCC     88800
     TGCGGCCAGC TCTGCGCTCC GCGTGCGGCT TCCGGGCGGC CCCTTGACCG TCTGCCATGC     88860
     CGAACACCTT CCCCCATCTT TTTACGCAAT TACGTATTTA CGTATGTACG TAAGTAGGCT     88920
     ATAATAGGCC ATGCAGTGAG GTTCCACCCT CGCCGCATCC CCGGCCGGAT TCCCACTGGC     88980
     GGCTACCAGT CTCCCGGCCT TCCTTCCAAA CCGTCTAGGA GCAAGACCAT GAACGATCGC     89040
     GCACCGATCT TCTTCTTCGA CAAACTGGCT GCGCTGGCCG ACTTCACCAC CTTCGACGTC     89100
     CGGGCCACCG AGGAGGGCGG GATGCCTGTC TCGTGGTCCG TCGTCGGCAT TCTGCCCAAC     89160
     GGCGAGATCT GGCCGGTATT GACGGACCTG CTAACCGAAC AGCACGCGCA GATGGTCGTG     89220
     TCGTTGTGCG AGCTGGCCGC GATCGCGCCG GACGTCGTTC GCGCACTCAA CACGTTGCCG     89280
     CGCCAGAAAC TCAGCGGCCA CTACGGCGAC ACCTACGAGC TCGTGGCGGC GCTGGAGCGC     89340
     ATCACGCGGT GACGCGTGCT ATCGGCCGGC CCTTGCGCCG GCCACACGCG TTCTTTCCTT     89400
     GTTGAGGAGA AAATCATGCT TCGTCGTATC ACGACGGCGG CCGTCGCGCG TCACGTCGCT     89460
     GCGGCCGCTG CGGTTCTCGC GCTCTCGTGC GCGCTGACGG CATGTGATGC CGACCAGCAG     89520
     CCGCCGAAGC TGCCCGAGTC CGTGTTCAAC CAGAAGCTAA CCGACGAGGT ACGGTCAAAG     89580
     TGGACGCTTC CGCCTGATGT CGACCGGATG CTCTGCTGGC CAGAGCATCG GATGTTAGGC     89640
     GGTGATCGGG TTGCTTGCAC CGTGACTCTG CGAGGTCGGG CGGTGAGCGA CATGTCGACC     89700
     CCGGTCATCC GCTGGGAAAT ACCATTGCGC GCTCCTTCAC CGTGGGACGA CCCGTACAGC     89760
     AACGACTACC TCGACCCGTC ATTCGACATC AAGCTGCTTG ACTGGACGAG CTTCAAGATG     89820
     GTGCTCACGA ACATTCCGCA AGGTGTTGTG TCAGTCGGGT TGATCGTGGA CGAATCTCGC     89880
     GTGCCATTCA AAGACGCTCA AATGTTCGTC CTCGACGTGA CGGACGCGGT TTCAAGGGCC     89940
     ATGTTCGCGG AACTCAACCG CGCTCGAGCT GCTGCTCCCG ACGCGATTCG CGACACCTGG     90000
     CGCTGACCCC TGCAAACGCT GCCGCTCGCA CGACATACAA AAAAGGCCGG TCTGCCCGGC     90060
     CTTTTTCAAT ACGCTGGCTT CAACTCGACG CCTTCCTGCC AAAGCCGCGC CCACTCGGCG     90120
     CCGTATCGAT CGGCGAGCGG TTTCACGTTC CACAGGACAA GCGCATTCTC CGCGTTTCGA     90180
     TTCGCCGCGG CCGACGAATA GTTGAAGGAG CCGGTCTCAA CGTGCATCCC GTCGACCACC     90240
     ATGAACTTGT CGTGCGTCGC TTCGTACCGA TCGTTCAACC GAACCGGCAC GCCTTGGTTC     90300
     GCGAGGAACC AGACGGCCGA ATAGCTCTTC GCATTCTGGC CGCGATCGGC GACGACTGCG     90360
     ACTTTCACGC CGCGTCGGTG CGCGGCCAGC AGCGCCGTCG CTATCGGCTT GCTCGTGAAG     90420
     CTGTAGGCCA CGACGACGAT CGACGAGCGC GCGCTGTCGA TCGCCCGCAG AACGACGTCC     90480
     AGCGCGCTTG CAGAGCCGGA CGCAGGCGAG AACCCAAGGT CGTAGCCCGC GCCGGCCGGC     90540
     AGCGGCTGCG CGCCAAACGA GCCGGTAGAC GCCACGGCTA GCGCGGCCGC GGCGATCAAG     90600
     GAACGGAAGA AGCGCCGTTG CATCATGTCG TCGCTCCTGC CCGTGTTAGA ACCGTACCTG     90660
     GCGGAACGAC GCCGATTGCC CCTTTTCGAG CATTCGCACG GCGCCCGTCT CCTGCGGCTT     90720
     CAGGTATTTC AGATCCTTGA CCTCGATCTT GAGCTTCCGC GCCGCTTCGT CCCAATCCGC     90780
     CGTCGCGAGG TTCAGCAACA GCAGCGTGCC GGCGTTCTTG ATGAAATCGG ACGAGAAGTG     90840
     CGCCGGCGAT TGGCCTGCGA GTAGGATCGC GAGGCCGAAC TTGCGCATCT CGTTCACGAC     90900
     CACGTTGATC GGGTTGCTCG CATCCTCGTC GTTGAACTTC TTTGATTCGT CGAGCACGAT     90960
     GAGCCGGCGC AGCTTCCCGC CCGACTCGCC GCGCTGCATC ATCTCGCGGA TGATCGCGCG     91020
     CATGCGGAAT CGCACGAACA TCTTCAACTC GTCCTCGGAC TGCGCGAGCG GCTTCAGAAC     91080
     GTAGCGCCGC ACGCGGGCGT TGCCGAAGGG CGGGGGATTC GGATTGAAGA TCCCCGTGGC     91140
     GTTCAGGTTT TCCAGCCGCG TGATGACGCT CAACAGCACG TCCTTGCTGT TGTACCTCAT     91200
     CGCTTCTTCG AACTCGCGAC CGTTCTCGAG GCTGTTCAGG AATGTTGCGT GCGTGTCGAA     91260
     CGCCTTCGCC TTCGCCGCCT CCATCCGTTT CTGCAGGCGC TCCATATCCT CGTCGTCCTT     91320
     CGCGCCGCTC TTGGCCAGCT TCGTGCGGAG CTGGTTCACC GCAGCCATCG ACCGGCAGTA     91380
     TTCATCGAAC GCCGTGAGCG CTGCTCGCCC GTTGTCCTTG TCCTCGATGC CCATCCACAG     91440
     CGCCTTGAGC TTGCGCTTCG CGAAGCCGAT CACGTCACCG AGCGTCGGGT ACACCTCGCG     91500
     CAGACCCGAC CAGTTGCGAG CCTCCATCAT TTCGCGGATC TCGGCCTCGG ACGCTTCGCG     91560
     TCGCGCCCAC GAGCGAGGAT TGTCCGCGAA GATGCCCTTC ATCATGTACG AGTCGGTTAG     91620
     AAGGTGTCGA AGCACACCCT CCTGATTGCC GCCGAGCTGA CGTGCCGTGC TGTTGATCGC     91680
     CTCGATCACG TCGTTGACAG CACGACGCAC ACCCCCGTAG TGCGGATCGG TATTGAGCAC     91740
     CAGCGGGTTG TACCCGTACC GGGTAGCTTC GCTGAACAGC ACCGTTTTTG CACCCTCGAT     91800
     TTCGATATCG CCGTGGTAAT CGAAGATGTC GATCTCCACG TCGTCGGGCA TGCCGGTCAC     91860
     AAACTGGCGA ATCCAGTGCG TCTTGCCGGC ACCTGACGTG CTGTCACGGA GCTTCCAGAA     91920
     ATCGTGGCCG ATCAAAATTT GCGTCATCGT TTCATTCCTC ATTCATCGAA GGCGGACTCG     91980
     GGTATGTCGT CGTCGTCGTC CATCGGTATC AGCTCGTCAG GATCGTCGTG ACGCGGGTCG     92040
     TGCATGTACC CGGTACGGCC GGCTGCCTCG GCCTGTTTCA TCGCCTTGCG TGCAGCTTCG     92100
     AAAAGAACGA TTCCGCGCTC CGTCGGCGTG ACCTCGAAGC GCTGAATATC GTTCATGTGA     92160
     GCGGCGGCAC CTACTACCGC CGACAGGATT GGATCGTCGA GCGAGGGGTA GTACGGCTTC     92220
     TCGCTTCGAC GGAGTTGGGC AAAGATGTAA TCCGCCGAAT GCACGTCGGC GCTGCTGATC     92280
     TTCTCCGCGC TGCGCGGCAG GCGTTTGAAC TGCGGTCGCT CGATCTGCAG GAAGCGATTG     92340
     ATGCGGGCAC GCAGCTTCGA CGTCTTTTTG TGCTCGTCCG GGATGTAATA CGACGCGGAC     92400
     GGCACCACGG CGTCCTTGAA GATCACGAAA CCCTCGCCCG AATTGAGCTT CTTCAATTCG     92460
     TTCAGCGTGA TCTTTTCGCG CCGTTCGACG CTCGACTGCG CCTGCGCCTG GTTCGACGTC     92520
     GTGAACGTGC CCACCGTCGC ATCGTGTCCA GACAGCACGC TGTAATACGC ATCGCCGCCG     92580
     GCCTTCTTGA TGAGCTCGAA GGTGTCTTCG GGATCTTCCA GCGCGAGCGT CCATTTCACC     92640
     TTCGTATTGG CGATCATCGA CGCCGATTCC TCGCTGGCTT CGCCACGCTT GAGACCCTGC     92700
     ACGTCCTGCA CGGCCGCGAT CATCATGAAG CCCAGCGATC GGGCCTGGGC GAACATGACG     92760
     GCGATGCCCT CGGCGAAGTA ATACGCGAGT TCGTCGCTGA TGATGACCGA CGGGTTCGGC     92820
     GCGTTGGTCG CCTTCGAATC CAGCACTTCC GCTTTTGTCC CCTCGAGGCG GTAGCCGAGG     92880
     TTCTGCGCCA TCATCAATCG GATCGACGAG ATGTACAGCT TGCCGAGCGA TGCCGCCTCA     92940
     GAGGCCGACT TTTCAAGCGA CGGGATCATC ACGACGAGCA GCCGGTTGTT TAGCAGCACA     93000
     TCGAGCATGT CGATCTCGGG ATACTTGTCG GCGAAGATGA ACCCATACGT GTCCATCATC     93060
     ATCGACAGCG TGCGCGCGAA TTGACCGGTC AGATAGCCGT GCTGGTTGAA TACCTCCGGG     93120
     TCCCACTGCG TAGGGTCATG CGCTTGCGCC GGATTGAAGC CCGGCAGACC GGTTTCGAAG     93180
     TACGCCTTGA TCGGCAGGAA CGCCAGCTCG GGAATCTTCC CCTCGCGGCC TTCAATGTAG     93240
     AACTGGACGA GATTCTGCAG CGCCAGATAA TGCCGGATCA CGCCGATCGA GATGTCGAGC     93300
     TCTCCCTTCG CCCGTTTGTA GCACAGGGTG CGGAGCAGGG CGTCGATCAT GTTCAGCGCT     93360
     TTCTGCTGCC ACTGCGCACC GTCGCCGCTC GCGCGCGGCA GCAGCGAGGC CATCAGCTGC     93420
     AGCAGGAAGT CGGCAGAGCC GTCGCCGAAC GGGTTCATCG AGTTCGACTG CGCGAGAACC     93480
     GCGCGATCCG CGAACCGACC CAGCTCCTCG TCGACCATGC GCTGGAACGG GTCCATGCCG     93540
     CCGGTGAGGT AATTCAGGAT CAGGAAGTCG TCTTCCCGGC CGTGACGGCG CGAGAGCGAC     93600
     CAGAGGCAAA AGGCCAGATT CGAATCGGCT TTGCCGTCCC CATAGCAAGC CCCGGAACCC     93660
     CAGCAAATCG CGTTGTGGAA CGTGCCCATC AACGTTTCAC TTTTGCCGCT ACCGGTCGTG     93720
     CCGTCCACGA ACATGTGCGT GCGCGCGTCC GAATTCGTCA GCCAGAGTTC GCGGCCCTGA     93780
     TCGTGCAGGG CGCGAGAGCG CATGAAGCCA AGATACAGAA TACCGCCGGC GACGAGATAC     93840
     TTGCGCAGGG TCTTCGAGCG ACGCACGAAG CCCCACAACA TGTTTTCCTC GACCAGCTCT     93900
     TCGTAATAGT CCGTGCGATC CAGGCCGCCG ACGTCCTTCG GCATGCGCAG CGGCATCTGG     93960
     AATTTCTGGT CCTGAAACGA CATGACCATC ATCCAGAGGA GAATGACCCA CACGGGCCAC     94020
     AGCGCCGGCA GGTAGATCTG CAGGCCGACG AACAAGACCA GCACATTGCT GAACGTCGAC     94080
     GGCCTGTATA AGGCGGCGAA GAAGCGCTGT TCCGCGCTTC GCGTGTCAAC TGTCAGCCTG     94140
     GACGAGTCGA TCTCGTGATT CGGGTCCAAC GCCATCAGAC TGCCCCCCGC TTGAAGAGAT     94200
     ATTGGTGTGA CATGAATGGT CGCTCCGTCA ATCCAACGCC ACGCCGACGA CTTCCTCGAA     94260
     TTTCGCCTTC ATCGCACGCC CGAACAACTC GGCATGCTGG ATGCGAGCGA GGATTGCCTT     94320
     TGCTTTTTCG GCGGCCTTGA CCTGGCTTTC AGGCACGTCC CTATCGAGCC CGTGCGCCAC     94380
     GTAATCGGCC AGAAACGCGC TCAGTGGCGC GGCCTGTTCC GTCGCCGCAT GCCACGCTTC     94440
     CAGCCCGTGA GCACGCACGA AGCTATCGGG ATCTTCGCCT TCCGGCAGAA ACAGGAAGCG     94500
     CGCCGTTTTT CCGTCCTTCA TCTCGTCGAG CAGGACCGCA GCGGCGCCGA GCGCCGCTTT     94560
     GCGGCCGGCC GCGTCGCCAT CGAACGCAAA GACGATCGTG TCGGCATGCA CCAGTAGGCG     94620
     CCGTACCTGG AGGTTCGTCA GCGCCGTGCC CATCGGCGCG ACGGCGCGCT CATCGCCTGC     94680
     CTGGTGCAGA CTGATGACGT CGAAATACCC TTCGACAATC ACCGCGACGC GCCCGCTGCG     94740
     AATCGCTGGC TTGGCCAGAT GCAGCGCGTA CAACTCCCGG CCCTTGTGAA AGATCTCTGT     94800
     CTCCGGGCAA TTCACGTACT TCGGTGTCTT GTCCGGCTTC TCGATCATCG AACGGCCGGC     94860
     GAAACCAACC AGGTTGCCGC TCTCGTTGTG GATCGGGAAC ATGATGCGAT GGCGGAATCG     94920
     ATCGTAGATC TCGCCATCAT CGCGTTGCGC GGCAAGCCCG GAGCCCAGCA GGGCTTCGCG     94980
     GCTCGTCGAG CCGCCGAGCA GCTCGACAAC GCCTTTCGCG ACGACGCCGA GCCCGAATCG     95040
     CTCGATCGTC TCAGCGCTCA GGCCGCGCTT TTGCTCGAGG TACGCGCGAG CGGCGGGGCT     95100
     CTTAGCCAAG CCCCGAGAGA AGACGCGCGC GGCCTCTTTC AGCGCCTGGT AAAGCCCGGC     95160
     CAGCCGCTTG CGCTGCGCTT TGTCTTCGTC GCTATCGCGC TCCTCGACGG GCAGCGGAAT     95220
     GCCGCTCACG CCCGCTAGAT GAACCACCGC GTCCTGGAAC GACAGGTGAT GCTTGTTGCG     95280
     CATCCACTCG ATCGCGTCGC CCCGCGCGCC GCATCCCCAA CACCGATACG TGTTCTTGTC     95340
     GGCCGAGACA CGGAACGAAG GCGTCTTCTC TTCGTGGAAC GGGCAGCATG CGACAAAGTC     95400
     CTGGCCGGCG CGCTTGAGTT TCACGTCGCG CTCGATCAGC GCCGGAAGAT CGGTTTCGCC     95460
     TCGGATGCGC TCCAGAAATT CGTCGCTGAA CCGGATGTAC TTGGCCATGC TGTTCCTTAC     95520
     TTGCGCGCGG TTGCCGCGGC CGACATCCAT TGATTGATCG CGTCCGCCGT ATTCGGAATC     95580
     GAATCGGGCG TTTGCTCGCC TGCCGCGTTG ATGATCGTCG GCGTGCCAAG GAAGCGCATC     95640
     ACGCGGAACA TCTGATCGTT TCGTGCAACT GCATCGCTAC CGTCGGCGCA TTCCGCGTTC     95700
     GGCAAATCGT CGCCTTGAAC GATCTTCTTC CACAGGGCAG CTCGCGCCTC GGGCTTCGCG     95760
     CACATGAGCT TCGCCGTGCG ATGCGACGAC GCTTCACCAC CGATCACCGT GACGGGGAAA     95820
     ATGTAGATGG TGTAGTCCTT CGCCAGCTTG TCGAGCTCGG GCTCCAGATC CTGACAGTGC     95880
     GGGCACGACG GATCAGAGAA GACATACAGC GTGCCCTTGT TGCCCTTCGA AAACTGGACC     95940
     GCGTATTTGC CCGACTTCGC GCCGTCGGCC ATTGCCTGCG CCAGTTGGGC AGGTGAGGCG     96000
     ACGGCCGGGC GTGCGATCGG TTGTTGCAGC GCGCCCAAGT TGTTCGGCAG CGGCACCATC     96060
     GATGCCGCGC CGGCGGCGCC GATGCCGCCG GCAGGTGATC CACCCACCGC GCGCGTTGCT     96120
     GCCATGTTCA CGGCCAGCCC CAGGACGGCA ACCATCAGCG GCGCGAAGCC CCATTTGATA     96180
     GCGGCCTTCC AGAAGCCCGC GAAGCGCCGT ACACGCGCGT AGCGCTTGAG CGCAGCCTGC     96240
     AGGTTCTGGA ACGCGGTTGT CGCGAGAGAT TCGCTCGAGA AGCGCTCGAC GACCAGCGCC     96300
     TCCCCGGCGC CATCGTGATA CCGCGCCTCG ATCGTATTGC CCGACCGAAT AAACGTAACG     96360
     CCCTGATCGA GTCGCAACGT GCTGACGTGC TGCAACTCCC CCGTGCTGCC GAATTGCACG     96420
     AATAGTGACT TCTCGAACGG CCGAATGATG TCGTTGCTCT TCACGGATTA CTCCTGGTTC     96480
     TTGCGCGGGG CCATAAGGCC GACTTTGATG AGGTAGGCTT CCACGCCGTC GATCGCGTCG     96540
     TCGACGTAGG GCTCGGTGAG CCGGTAGCCG CTGTCAAACG CCAAGTCTTC CCATAGGGTC     96600
     TGCGTGAAGA CTGCGGCGGA TTCGAGAAAA GGAACCTTGC GGCCCGTGGT GTTCAGGGCG     96660
     TACCAAAGCC CACGGTCCAT TCCCTTGAGC CATCGGAAAT GCGATGACGG GAGCTTGCCG     96720
     GACCCCTGCG CTGCCTTGTG CATTGCGTGC AGCAACGTGC GCGGGTAGGG GTGTTTTTCG     96780
     AGCCAGCGCT GCGCTTCGGG ATGCTGCGAA TATTTGGCGA ATGCCTTGCT CGCGATCGAC     96840
     AGATCCGGGT AGCCCTTCAT TCCGTTCCAC GTGTGATTGT GGCACGAACG GTTCAACGCA     96900
     TCGAGAAGTT CCTGCGCCTT GGCGCCGTCC TTGCCGTCGG ATAGCAAGCG TGTGCCGAAG     96960
     ATCGCAAACA TCGCCTTCTC CTGCGGCAGT AACTCGTCCA ACGACTTCAC GGGCTTGCCG     97020
     AGATCGGCGA TCAGCAGCTC GCGACAACGC TCCCGGTCGA GCACGCCGTT CACGAGCAGA     97080
     CCATGCTGCT CGACCCACTC TTCGGGATTG ATCGAACTGC GGTGTTCCTC GGGGTCGACG     97140
     TTGAGCAGCA GCGTGTCTTT GTCTCCGTAG TAGAGCGACG GGATGATCGC TGGCGAGTGA     97200
     TTCGACATGA TCCACGGAAG CGTTTGCACC GTGACCTTGC GCCGGGTGAG GTTTGCCTTG     97260
     TGCTTCACCG CGAGCTTGAT TCCGCGGATC GCCAACAGGA CCGGAATCCA TACGAACAGA     97320
     TACCCGGCTT TGTTCATCAT CGCCAAAAAC TGTTCGAACG AAACGGCCGC CGGATTCATC     97380
     GCCAGATAGG CGGTTTCCTG TTTCCAGCGC CGAATCGCGT TCGGCATGAA CGGCCAGTCC     97440
     AGTGCCGACA GCTGATACCA CGCGAACTTG AGGCCGTAAT ACACGATGTC CGCGTGCGAC     97500
     GAGTACCACA TGAACCAGCA AAAGCCGGCC GCGAGCCCGA GCATCCCGAG ATACACGAGG     97560
     CCCATGTCAT CGCGCTTACC TTGCGTTGCA CTCATGCGTC GTCCTCAAAA TTTCAGCGAG     97620
     TTGCGATAAA CGCGCTCGAT GTATTGATAC TTGAACTGCG GCGTGCGCGA GTGATAGTGG     97680
     CCAACACCAT CCCAAAAGCT GCCGCCCGCC TGATTGATCT CGTAGCGCAG GATGTACGCG     97740
     CCGGCGCGCA CCGACCAGCA GAAGTCGTCG GTAATCATCT GGCGCGTTAC CCCGAACTGC     97800
     GACTCCAGAC GTTGCGCCCA GACGGTGTTG ATCTGCATCG GACCGTAGTC CGCCGTTCCG     97860
     TTCTTGTTCC TGCTGACCGT GCCAATGCGT CCGCCCTCGG TCAGCCACAC GGCCAGCAGC     97920
     CCCCGCACCG GCAGGGTGTA GTCGTTCGCG GCCTGGACAA CGCACGCCGG CACGGCCACA     97980
     ACACCGGCTG CTACAGACGC ATGCGCCATA TGCGCGGCGG CCAGTAGGCC GACGGCGACG     98040
     CCGACTCGCT TCAAAAGCAT TGGATCGTCC TTTCTAGGTG GCTCATAATG CTATATACTT     98100
     TTTTCGTATA GTAGCCATTT TACGAAAGCA GAGCAAGCGG CCGATCTACA CGTGATCGTC     98160
     GTCCAAAGCC GCTTGCAGCC GAGCAACCGA ACCGAGGAAG GATCATGGGT AAAGCATTGA     98220
     TAGTCGCCGA AAAACCGTCC GTCGCCGCCG ACATTGCGAA AGCGCTCGGC GGTTTCACCA     98280
     AGGCCGACGG GTATTTCGAG CGCGACGACG CGATCGTCGC TCCGGCGCGA GGTCATTTGG     98340
     TGGAACAGAC CGTGCCAGCA GCCGACGCGA AAGGTATGTG GAAGATCGGC GTCTTGCCGA     98400
     TCATTCCCGA CAGCTTCGAG CTCGAGGTCA TCGACGGCTG CACCGCCGAG TTCAGCCGGC     98460
     TGAAAAAGCT GATGGCCCGT GACGACGTGG CCAGCGTCGT CAACGCATGC GACGCAGGGC     98520
     GAGAGGGCGA ACTGATCTTC CGCCTCATTT ACAACAAAGC GGGTTGCCGG AAGCCGACGA     98580
     AACGCATGTG GATTCAGTCG ATGGTCGCCT CAGCCATCCG CAAGGCGCAC GACGATCTGC     98640
     GCCCCGGTGC AGAGTTCGAC CATCTTTCGG ACGCTGCCTT TTGCCGCTCC GAGGCTGACT     98700
     GGATTGTGGG CGTCAATGGC ACGCGAGCGA CGACCGCGCT GCGCGAGCGG AAGACGCAGC     98760
     GCCGGGAGGT GTCGCCTGTC GGACGCGTCC AAACGCCGAC ACTCGCCATG CCGGTCATTC     98820
     GCGAGCGGGA AATTGCGGCC TTCGTCGCGC GGGACTACTG GGAGATCCAC GGAACGTTTC     98880
     GCGCAGAGGC CGGCACCTAC GTCGCGAAAT GGATCGGCGA TGCCGACGGC GACACGTCGC     98940
     CGGCTGAAAC CGAAGGCGAC GCGGAAGCCG AAGCCGAGCA AACCGGCGCA CGCTGTTTCG     99000
     ATAAAGCGAA GGCGCAGGCT ATCGTCGACA AGTGCAAAGG CGTCGATCCG TCGTCCGTTG     99060
     TGGACGAGTC GAAACCCGAA GAGCGGCCGG CCCCCGCGCT CTTCGACCTG ACCGCGCTCC     99120
     AGCGCGAAGC CAACAAGCGC TTCAAATTCT CTGCGAAGAA GACGCTCGAC ATCGCGCAGG     99180
     CACTTTACGA AAAGCACAAG GCCACAACCT ATCCGCGCAC CGACTCGCGA GCGCTGCCCG     99240
     AGGACTATCT CGAAACAGCC GCGGCCACGC TTGCCACCTT CGCCTCAACA CCGCTTGAGG     99300
     CACACGCGCA GCGTGTCATC GAAAACGGCT GGGTGAAGCC TGACAAACGC ATCTTTAACA     99360
     ATGCCGACAT CAGCGATCAC TTCGCAATCG TGCCGACCGG CCAGCAGCCG GACGGTCTGT     99420
     CGTCCGACGA GCAAAAAATC TACGACCTCG TATCGCGTCG CTTCATCGCG GTGTTCCACC     99480
     CGTCGGCGAA ATACGAAAAG ACAGTGCGCA CAACTATCGT CGCGGGTGAA ACGTTCCGCA     99540
     CGTCCGGCAA GGTGCTGGTC GAGCCCGGTT GGCTCGCAGT CTATGGCGAA AAAGCGCACG     99600
     ACGACACCGC GGCCGCGCTT TGCAAGGTCG CCGACGGCGA AGCGGTCACG GCCGACGCCA     99660
     TCGAGCTGAA GGCGTTGCAG ACCAAGCCGC CGAAGCGATA CACGGAAGCG ACACTGCTGG     99720
     CCGCCATGGA AAACGCCGGC CGCCAGGTCG AGGACAAGGA CATTCGCGCT GCGATGAAGG     99780
     CCAACGGCAT CGGTCGTCCC GCGACGCGCG CGGCCATCAT CGAAGGGTTG CTGGAGGACA     99840
     AGGACAAAAA CGACAACCCG AAGGAGCCCT ATCTGCGACG CGACGACAAC GAGCTCGTTC     99900
     CAACGCCCAA GGCGATGGAG CTGATCGCGT TCCTCGAGGA AGCCGGCATC GACTTCCTCG     99960
     TGTCGCCGCA GATGACCGGC GAGTGGGAGC AAAAGCTGTT GCGCATGGAG AAGGGCGACT    100020
     ACCGGCGCAG CACGTTCATG AGCGAGATCG CGGACCTGTC GACTGGCATG GTCGAAACCA    100080
     TCCGCGCAAA ATATAACGAG CTGCCCGAGC CTGTCGCCAA GGCGCTCGAC GCACCTTGTC    100140
     CGCGCTGCGG CGCTGCCGTA CATGTCGACG GCCGCGCGTA CCAGTGCAGC GGTTGCGATT    100200
     TCAAGGTATG GGGCGAAATC CTTGGCCGTC GGCTGACCGA AGCCGAGGCG AGCACCCTGA    100260
     TCGCCAATCG CAAGACCAGC GTGCTGTCCG GTTTCACCAG CCGCACGTCC GGCAAGAAGT    100320
     TCTCGGCCGC CCTCAAACTG GACGTCGAAA CAGGAAAGGT CGACTTCGAG TTCGAAGACC    100380
     GCGCGGCGCC GGCTTCCAAT GGCGAGGCCA AGCAGCTCAA GGCCAAGTGT CCGAAATGCT    100440
     CGTCGGGCAT TGAGATTCAG GCGTGGAACT ACGCGTGTAC CGGCTGCGAC TTCAAAGTGC    100500
     GCACTGAAAT CGCGAGCCGC AAGCTGTCTC CGGGCGAGGC CGAAACTCTT ATTGGCAAGG    100560
     GAAAGACCGG CGTACTCGCC GGGTTCGTCA GCAAGTCGAA GCGCAAATTT TCGGCCGCGC    100620
     TCAAGCTCGA TGCCACTACC GGCGGCGTTA CGTTCGAATT CGAAGATCGC AAGTGAGGAC    100680
     GGACCATGCA GCTCCCCTTT GAACTTGATC CGCAGATCAT CCACCACATC ATCTACAGCC    100740
     AAGCCGGCTC GATCGGCAAG GCGATCATCG AGCTGCTGAT GAATTCGGTC GACGCACGCG    100800
     CCACGGCCGT GCAGCTCTCG ATGACCAAGG AAGGCTTCGA GTGTTCCGAC GACGGAAACG    100860
     GGTTCGCGAG CCGCGAAGAC GTCATTCGCT ATTTCGGCCG CTTCGGCACG CCGCACGAGG    100920
     AGGGCGATGC CACCTACGGC CGCTTCCGGC TCGGCCGCGG GCAAATCATG GCGCACGCCA    100980
     GCACGATTTG GCGTTCGAAC GAATGGCAGA TGACAGTCGA CACGCGTGTG ATGGGCTACA    101040
     ACTACGACCT GGAGCAACTG GAGCGAGCCC GACCGGGCTG CTCCATCTCC GGCCGCTGGT    101100
     ACGAGCCGCT CACGGATTCT GAACTCATGT CTGCCGTGCA GGAAATCCGA GATCTGGTGC    101160
     GCTACACGCC GGTCAGTGTC GAGCTCAACG GGCGCGTCAT CACCCGCGAT CCTCGCGCCG    101220
     AGCGATGGGA TGCCGAGGAC GAATTCGCAT GGTATCGCGC GAAGGAGGAT GGTGCCGTGT    101280
     CGATCTACAA CCAGGGCGTA CTTGTACGGC ATGACCCCGG ACATATGTGG GGCGCAGGCG    101340
     GGCTTATCGT CTCGAAGAAG GCAATCGCCC TCAACGTCTC GCGCACTGAA ATCCTTCGCA    101400
     AGACGTGCCC GGTCTGGAAA GCCATCGCGA AGCAGTTCGG AGCGTTGGCA GACGACGTTA    101460
     GGTCTCGACT CGGCGAACAT CGCAAGACCG AGGCAAGCCG TGAGCGCTCG GCTCGCGCGC    101520
     TACTCGCCGG CGACCCGAAC ATCGTGCAGA TCTACGAGAA GGAGGAAGTA GTCACGCTGC    101580
     TGCCCGGCAA ACGCAACCTC ACGATGCAGG CATTCCTTCG AAAATGCCGC TACAGCCACA    101640
     ACAAGCGCCA AGGGAACCGC TTCACTGTCG TCGAGAACGG CTTCGACGTA CCGAAGGGCG    101700
     AAGCGATCGC TCGCGAGGGG ATCGCCGTGG TGGTTCACCC GAAGACGCTC GAGCGCTTCG    101760
     GCTGCTACAA CGCACACGAC CTGCTCGACT GCGTGGATCG AATCCACGCC AACATCCGCG    101820
     AAGACGTTGA AAAGAACGGC ACCCGGTTTT GGGGGCTGGA CACGCTGGAA CTGCCCGAGC    101880
     TCGTGGACTT CGCGACGTTG CGCGACGCTT TCGTCGAGCG CACAGCGCTT GTCACTGAAC    101940
     GCGATGCGTT GGACAAAGAG ACTCGCCGCG CGTGGACCGC GCTTCGCACG ATCCTTCACC    102000
     ACTATGCTGC CGTCCTCACC GGCGGCGAAC GTCGCTATCA CGGCAGTCCT ATCGCCAGGG    102060
     GAGGCAAGTC GTTCCAGATC CTGCTGGGCG AATCAAACAC CGCCGAGGCC TGGACGGATG    102120
     GAGACACCTA CATCGCGCTG ACGGTCGACG TAGTGAAGCG CCTGAAGACG GTGCCGCTCC    102180
     AGGCCGCCGC GTACATCTTC GGTTTGGTAG AGCACGAGGT CGCACACGAA GGCGACAGCC    102240
     TCGATTGCGG CCATGACGAA GCGTTCTACC AACGGTTTCA CGATTTGACC ATCAGGTACG    102300
     CGCAGGAGCG CCAGTGGTAC ATGCACGCTT GGCTCATGCG CTACACGAGC AGCATGGAAG    102360
     CAGAGGGCAA GCGCGCGCGC GGCTCGGCAT GGCGCGAGCG TTATCTTGTC GATCGCGCGG    102420
     GCACAGGCCG CACGAAGCGC GGCTTGCCGC GCGCAATCGA CGACGTGGCC ACCGAACCGC    102480
     CCGTCGTGAC GCCTGAAGAG AACATGGCTT TCATCAACTA TCAGAACGCC CGTCTTGCCC    102540
     AGGCCGGCGT TTGCCCGCCT CCGCCGGACT GGACAGAGGT GTTGGACCGT GCTCGCGATG    102600
     TCCAGCAACA GATCGAGTCG GACCTTCGCG CCGAGCGCGA ACGTCAAGCC GCTCAAGAGG    102660
     CGGCCGAGCA GGAAGACTTC GACGCTTTCT ACGAAGAGAT GCAACGCGAA GAGCAAGCGG    102720
     TACGCCAGCG CCTCGCCTTG CTGCTGGGAA TCAATGCCGA CGAAATCAGC GATTACGCAC    102780
     TCGACTACCT GACTGCCTCA GATCTGTCTG ACGACGATGT GAAGGCACTC TGGCAGCGAA    102840
     AGCCGTGGGC GGAACGCGAG CGCGAGATCT ACGGCTATCC CGTCGACCAT GACGACCAGG    102900
     GCATGCGGCG CCAGGATGAT GACGCGGACA CGGCCGCCGA CGACGAATCG CCCGACAACG    102960
     ACCCCGCGGC ACTCGAGGCC GGAGCCTTTT ATCCGCCTGA ACTGCGCGCG CTGATCCAGC    103020
     CAGGCGAAAC GACGTGGGCG CTCGAACGCA ACGCGGCGGC CGCCGGGTTC TACCGCGTCG    103080
     AGGACTATCT GAAATGGCGA GCAGAGGTGA ATTCATGAAA CGATACGTCA TTGCGCTCGC    103140
     GCTCATGGCG ACGCTCGCCG CTTGCGACCG CAAGCCGCCT GCCGAGGCCG AGGGGCAGGG    103200
     CGCTCGCCGC GAAGTGCTGC AGGGCTTCCA GACTACGTTC TATCGCGTCA GCGACGGCAA    103260
     GCAGCGATGG GTCGAGATCG CGATCGCCGT TGACGGCAGC AAAACGTTCC GTATGCCGGT    103320
     CTTCTTCTCG GACAATGGGC GACTCGTCCA GGTCAGCGAC GACGAAGCTC GCGCGCTGAT    103380
     CGACAAGTGG CTCAAGCAGC GGGCGGCGAA CGTCGCCGCC TTCGGTTCGG TCGACCCCCA    103440
     GGTCGGCGGC AACACTCCAT TTCTGGCCAT CGACCGCAAC ACCCCGTAAC GGAGCGACCA    103500
     TGCAAGAACG CGCCTACCTT GAGGCAGTAC CGGCCTACCA CGCGACATCG CCCGACGGCC    103560
     GCACCGTGCC TTTCATCGTC TCGTTGCTGC TGCACGACGC CGAGAACAAG CCTCGCATCA    103620
     CACCTGCCGT CGAGCGGTCG ATCGACCGCA CCATCGACAT CACCGGCCGC GAAGGCCTCG    103680
     CCCTGGCGAT CATCGCGGAC GACGACGAAA TGCCGGCCAC GGCACGCCGT TACGTCGAGC    103740
     GAGCTATGGG CATCCCTGGC GCGATCATCC TGTTCCGATG CCAGAGCCCC GAGACGGCGG    103800
     AACGGCTGAT GCAGCATCTG CATGCCGAGT ACCAGCTCAC GCTTGTTCGT GAGTCGGCCG    103860
     AGCCCGCACC CGGTCCCTGA ATTTGCATGT TAATTGTTAT TCGTGTACTC TAATAACAAT    103920
     TAAATTGCAC CGGAGAGACC GAGATGCACA CCTTGACCCT TGAACAGTTG CGAGCCACTA    103980
     CGGACGCCGG CGGCGTCGCG GGCGTCACGC TCAAAGCGCA GGGCGGCGCT TTCTACGTAA    104040
     AAGTCGACAC GCGCAACGGC GACGAGGCCG TGCTCGCGAA GGCCCGCAGC AGCGAACCTC    104100
     GCAGCTTCGG CAACCCCGCG CAGGCATTGA CGCTGCTGCG CGGCCTCGGG CTGGCTGTCG    104160
     GCTCATTCGA CGTGCAGGAC TGGAACCCGG AGGACAGGGC CACGGTGCGC ACTCGTCCCG    104220
     ACCGCGCCGA GGCCCTGAAG CGGACGCACG AAGCGGCCGA ACACGACAAA TGGTTCCGCG    104280
     CGCAGGTCGA GCAGGGTCTC GCCGAGGCCG ACGATCCGAA TACGAAGTGG GTGCCGCACG    104340
     ACGTCGTGAA GGACGACATG CAGCGTCAAC GCGAAGCACT GAAGGCCCGT ATCGCAGGCG    104400
     GCAATAAGTG ATGGAATTGG TATGGACGCC ACGCGCACGT CGCGCTCGCG AAGAGGCAAT    104460
     CGACTACATC GCGCAGGACA ACCCGGTTGC CGCACTCGGC CAGCTCGACG AGATCGAGCG    104520
     GCAGACCGAC ATGCTGATTC AGCATCCCGA AATGGGGCGC CCCGGCCGAG TGGAGGGCAC    104580
     GCGCGAGCTC GTCATCAGCC GCACGCCGTT CATCGTCGTC TATCGGCTTA GGCCGCGCGC    104640
     CCGACGCATC GAACTGATCC GCTTTCTTCA CGGCGCGCAG CAGTGGCCGA AGACGTGACG    104700
     AAGGACCGAA CCACCGAGAG GACTGAACAT GAAACTGAAA GTCAGAAACG CAGCCGGTGA    104760
     ACAGCACACG ATCGACATTG ATGCGTGCGA CACAGCCATC ATCAACGGCG CGCAAGGCCC    104820
     GACCACCTCG TCGCTCGATT GGCTTACCGC TGACGAGCGT CGAGAACTGG ACGAGTGGTG    104880
     CAACAACCAG ACGCCGAGCC CGAATGGCTC GATCGCAATG AATGCGTGGC CCGGTTGGCA    104940
     TGATGTCGCG CTTCGACGCT TCGCTGACAC CGCCCGCAGC TACAGGCCGA ATATCCAAAC    105000
     CGTAACGCAG TCGTTCGCTC AACTCGTCGT CGGGGCACCG GCCAGCGGCA AGTCGCAGAT    105060
     GATGAACTCC TTCCCCATCA CAGACCCGGA CGCGCCGAAC ACGACGGAGG GCAACTGACG    105120
     TGAAGACGAC CGTACAGACT GGCGTTGCGA TCCTCGCCCT TCTCATAGGA TTGCTTTTCT    105180
     GTTTTGCCGC CGCGCGCGGC TACATGCAGC ACGACACCAT CGCTCTCCGG CCATTGCTGT    105240
     TCGGGGTGGT CGACGTGGCT GTCGCATGCG TGTTGCTACG CAAAGCCTAT ACGGCCCGCA    105300
     AGGCCCGGAG CATGCCGCTA TGACAACCTG GACTGACGAA CAGCTTGCCG ATTATGAGTG    105360
     CGCGCTCGAA ACGATCGGCA ACGTGATTGC CCTGAAGGCG CGCGACATCG AAACCGAGAA    105420
     AACGAAGCCG TCGCCGAACT CAGATCGCAT TGACGAACTG CGACGGCAAC AAGCCGAACT    105480
     TGCCGACGAG CGTAGTCGCT TGCGCATCGG CGATCACGAC GCCGTTGCGC GCGCCATCGA    105540
     GCAATACGGC AGGCTTGTGC GCGCAAGCGC GTGAACTGAG GGCGCGATGA CGGTTATCCA    105600
     CGACAATCGC CCGCGCGGAC TCTCGGTCGA AGAGGCGCAG AAAGCCGTCG ACGAGTTCCT    105660
     CGCCGAGTAC AACGGGAATA TTCCCGTAAC CGCCGTCGTG CGCGCAACAC AGGAGGAAAT    105720
     CTATGGACCC CAAGTATCCC GCGAAAAGCT CGGCTACCGT ATCGACGGCG CATACCACCC    105780
     GGCCCGACGC ATCTTTACCC TTGCAGCTTC CAATATGGGT GACGAAGGGG CCGTCCGACG    105840
     AGCCCTTCGC CACGAGCTGC TCGGCCACTA CGGGCTCAAC ACTTTCAGCC CGACTGAGAA    105900
     GCGCGCTCTG CTCGATCGCG TTCTGGAAAC GCGGCACGAG TCGTCGTTGA GCCACATCTG    105960
     GAAGCGGGTG GAGCGTGACT ACGCCTCGCT TCCAGATCTG CACAAGGCCG AGGAAGTGTT    106020
     CGCCTTCGTC GCCGAAGAAG AGCGCAGCTT TCTTGGTCGC GCATGGGATG GCGTGCGAGC    106080
     AGCGCTTCAA CGCGCCCTTC GTGCGACGGG ACTTTCCAGC GGACCATTGA CCCTCACGGA    106140
     GCTGCGCGAC GTAGCCCGCG ACATCGCGCG CGGCATCCGC GCAGGCGATC GCGAGCAGCA    106200
     GACGTTTCCC CAAAGCGACA CCGCGCAATT CCGGCTCGAT CCTGGAAGGC ATGCCGAGAT    106260
     CCTGCGCGAC ATCCAGACCC ACGCACTCGG GGCTACGCGA CCGGCCCAGC GGCCCGTAGC    106320
     GATCATTCTC GGCGGGCAGC CTGGCGCCGG CAAAGCCGGG CTGGCCAGTG CTGCGCTGGA    106380
     GGAGCTCGCC GGCAACGCCG TAAAGGTTGA CGCGGACGAG CTCCGCAAGA ACCATCCGGC    106440
     CTACATCGCG CTGATGCGTG AGGACGATCG CGCGGCCGCG GACCGCACAC ACGGCGACGC    106500
     GGGCCCGTGG GCCGTCAAAC TGACGAGTGC GGCGATGGCC GCGCGGCGCA ATCTCATCGT    106560
     GGACGGAACG ATGCGCGACC CGGACAACCT GGCCAAGCTT TGCAGGAAGC TGCGTGAGGC    106620
     CGGATACCGG ATCGAGGCCC GCGTGATGGC CGTCAACCCG CTCGTCAGCC GTCTCAGCAT    106680
     TCACGAGCGA TATGAGCGTC AGGTACGGGC CAACGGCTTC GGCCGCTGGT CGAACCGCGA    106740
     CAAGCACGAC GCAGCGTTCA GCGGCGTGCC GCTGACCGTC GAGAAGCTCG AGGCGCAGCA    106800
     GCTCGTCGAC CGAATGACCG TGTTCGCACG GAACAGTGAC GAGCCGATCT ACGACAACCG    106860
     GCTCGTCGCA GGACATTGGG AGCAGCCGCC GGCGGGCCGC GAGCGGGTCG ACGCAGAGCG    106920
     TGCGCGCGAT TGGTCGCCGG CCGAACGTCA CCAGTTCGCC GACAAGCTCG ACGCGATCGC    106980
     ACGCCGAATG GAACAGCGAG GAGCCGACGA AAGCGACCTC GCGTCGCTGG CCGAGCTTCG    107040
     TGCCGATTTT GAACGGCAGC ATCCGACTGA CCGGCACGCG CCGCGCGTGA CCCGCCGCGA    107100
     TGCCCCAAAA CCCGGAGGGC GACGCTGATA TACGACACTG GCTGACATAT GCCGCATACG    107160
     CCACGAAAGC AGCGCACACG GCGCTGATTC AACATCCCTA GCCGTTTCGG ACGCATTTTG    107220
     TATAATGCAT A                                                         107231
//

If you have problems or comments...

PBIL Back to PBIL home page