(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_4

ID   BURVG_4; SV 1; empty ; DNA; empty ; PRO; 226679 BP.
XX
AC   NC_009229;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 plasmid pBVIE03, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-226679
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of plasmid pBVIE03 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-226679
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-226679
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000619.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..226679
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /plasmid="pBVIE03"
FT                   /db_xref="taxon:269482"
FT   gene            complement(86..721)
FT                   /db_xref="GeneID:4947945"
FT                   /locus_tag="Bcep1808_7302"
FT   CDS_pept        complement(86..721)
FT                   /locus_tag="Bcep1808_7302"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component LuxR family transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: bxe:Bxe_A4347
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="GI:134287903"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:4947945"
FT                   /translation="MADELRQAGIETILQSVGFTIECVGVSTTKELRERLRRASRCALL
FT                   IVDLDFDESVVFEVISKARLRTPDLRVLAFDLRRGADRTVRALRSGVLGVIGEGATRAD
FT                   IAEAIESVMRGRRFVHGDAVNALVQQVMEDGARLPHYELSNREYETLCLFGAGKRLTDI
FT                   AGDLSVSIKTVSTYRARLLEKLQMRTTAELIRYAVTHNLAADASVKMV"
FT                   /protein_id="YP_001110067.1"
FT   misc_feature    complement(107..715)
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(383..715)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(order(425..430,437..439,494..496,554..556,
FT                   578..580))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(578..580)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(order(554..562,566..571))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(422..430)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(128..295)
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(order(152..154,185..199,203..208,212..217,
FT                   239..247,284..292))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7302"
FT   misc_feature    complement(order(128..130,137..139,146..154,245..247,
FT                   251..253,257..259))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_7302"
FT   gene            complement(751..1293)
FT                   /db_xref="GeneID:4947695"
FT                   /locus_tag="Bcep1808_7303"
FT   CDS_pept        complement(751..1293)
FT                   /locus_tag="Bcep1808_7303"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pat:Patl_3283 hypothetical protein"
FT                   /db_xref="GI:134287904"
FT                   /db_xref="GeneID:4947695"
FT                   /translation="MITQSELHELLAEQARINAHTNAYWMDAGYPLERHIGLLTSAAVA
FT                   PRGWVWVQYRERDVMVKMLGGMWRCILSRYLALERGDVHRASEHLQADLEAPRAVFFDL
FT                   RAYDFASMPLVEKIELAGALSLAGRVYPALFGAILDDCDVTWHELIRRLAHVNVLTWES
FT                   QVFRELTRVGERCILAA"
FT                   /protein_id="YP_001110068.1"
FT   gene            complement(1393..1803)
FT                   /db_xref="GeneID:4947696"
FT                   /locus_tag="Bcep1808_7304"
FT   CDS_pept        complement(1393..1803)
FT                   /locus_tag="Bcep1808_7304"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: ade:Adeh_3808 single-strand binding
FT                   protein"
FT                   /db_xref="GI:134287905"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:4947696"
FT                   /translation="MATYGELEFRQIGYLAADPSFRKNGDQKVVNFRVLTNEVWKDKAT
FT                   QEERSRVEGFNYELWGEGAEHFAERMKKGRRVYVVGQPRNDSYEKEPGVTQYGVRIRVS
FT                   RWQDLGAPSQDADGKSRQDAGGAGIQEGEAAF"
FT                   /protein_id="YP_001110069.1"
FT   misc_feature    complement(1489..1770)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7304"
FT   misc_feature    complement(order(1507..1509,1516..1518,1549..1551,
FT                   1576..1578,1639..1641,1645..1647,1690..1698,1768..1770))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7304"
FT   misc_feature    complement(order(1498..1500,1504..1506,1543..1548,
FT                   1552..1554,1558..1560,1582..1587,1624..1626,1630..1632,
FT                   1636..1638,1642..1644,1648..1653,1687..1692,1711..1713,
FT                   1738..1740,1756..1764))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7304"
FT   misc_feature    complement(order(1564..1566,1570..1572,1576..1578))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_7304"
FT   gene            complement(1892..3940)
FT                   /db_xref="GeneID:4947697"
FT                   /locus_tag="Bcep1808_7305"
FT   CDS_pept        complement(1892..3940)
FT                   /locus_tag="Bcep1808_7305"
FT                   /gene_family="HOG000225293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: pfl:PFL_4674
FT                   helicase, SNF2 family"
FT                   /db_xref="GI:134287906"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:4947697"
FT                   /translation="MSLKLSALRWDSDVARRAKVGASVAPRPLVEKVVFDGHQFGVLLS
FT                   HFKGANVIIKQEPYAGRFVNASDHQYYRYWRFSRQSLYDHGEALVGALVAAGNGAVIET
FT                   VESFFEKLTDARTNPQYDAFTRDLKATVYQLESGGAVIVSTYHPAVVAIAQQMGGRYLG
FT                   PMKAWKIAHASQIVVRDNLISELRLRDDQVDLAQGVFSIVDDAFVPRGNQGATIKVLAS
FT                   DMPDFPAAAETDHDNEVYLAVTSPLAPTSLSDDEIRSRIALYQLYDFQKEGVFHLVRNT
FT                   SALLADDMGLGKSRQAVCAADILSSLVPRAQVLIACPASLLINWSREIALAVPGEASIA
FT                   VGKYDPSKRWIVINYDRLDEVVPFADRFAVMVLDEAHLLKEPTAQRTRLAFDVAAKVPY
FT                   RAILTGTPILNRECEIHTLLRLSGHPIGNIDLKAFEEQFAGDPAFRVALSERISEWKLR
FT                   RTKDLVLKHLKGKQRQARYIEITAEERARYDRINGDMGILTLPKITMLRRELESYKVRP
FT                   IVEMIKDLNGDDKVLLFCEFKENVALFKQALDEVGIGYSVLTGDMSSPTRRQRAIDEFQ
FT                   SDPLKRVFITTTAAGGVGHNLTAANYVFLVSLPWTPGLAAQAEDRAFRNGQLRLVIVLI
FT                   PLVENTIDMDLVEMHRNKQSIAAEILDPEEAERLAMAEFAAGWRKAA"
FT                   /protein_id="YP_001110070.1"
FT   misc_feature    complement(2417..3136)
FT                   /note="SNF2 family N-terminal domain; Region: SNF2_N;
FT                   pfam00176"
FT                   /db_xref="CDD:143942"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(2720..3097)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(3059..3073)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(2810..2821)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(2039..2437)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(order(2171..2179,2261..2266,2324..2335))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7305"
FT   misc_feature    complement(order(2069..2071,2078..2080,2090..2092,
FT                   2153..2155))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7305"
FT   gene            complement(3944..4240)
FT                   /db_xref="GeneID:4947698"
FT                   /locus_tag="Bcep1808_7306"
FT   CDS_pept        complement(3944..4240)
FT                   /locus_tag="Bcep1808_7306"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287907"
FT                   /db_xref="GeneID:4947698"
FT                   /translation="MVMQVQPPPFGDVLASVVYLVVIVVITRFALRWFLGVRALQRKCD
FT                   QQSLMLELMAKRLRVELPVERPRDSIVDRGRSVAVRIGSRVAALRARMFSKVR"
FT                   /protein_id="YP_001110071.1"
FT   gene            complement(4251..6275)
FT                   /db_xref="GeneID:4947699"
FT                   /locus_tag="Bcep1808_7307"
FT   CDS_pept        complement(4251..6275)
FT                   /locus_tag="Bcep1808_7307"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lpp:lpp0511 hypothetical protein"
FT                   /db_xref="GI:134287908"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="GeneID:4947699"
FT                   /translation="MSAKGQKSPADESIDPQWYVVLALLVGVLIYAFWYTAHEYIAGAY
FT                   AAIRVGQFSIFVLSRSVWGAVTGACLLSLAVVCRFKKEWRPYVKWAVIAGAYFVGEYVV
FT                   TRFTASVWGSLVGVAVMLIAYIFGWSRAFKPYMGPMVMVGVLLATSGLVGGIFTSWFHF
FT                   FLHSDAPFIEWGHLSKSSLIANAFTLLAINSPLAYWVMRRSFTTNPTNHKHFGKTQDYT
FT                   LHTFTDEQAKHYPHLKLFRKLDLTARPINSGKYRMADTEKYFAIKHRLLDRVDKGNEFK
FT                   VNRDRSAEIFRRQLGRLWRTPKDLTKWEAAIIAALIPRIAALDPKMSELDYKEALATTD
FT                   RLVAQYWADAGDSYDPETDRIKLNMDEPLAVLRKYWNHTTVRPYFKRHAYVYTLIYAML
FT                   GDARRLGVMPANEFRWLRVADRRLWLTVDNVGRITAFTEVAGIYAHYLHEVKAKRAIDR
FT                   PAIEAAIKGLVEGVDSYKFTEDEIEQINEQLRDAEEKPTVDPKAVAIAKQTLLLGALVV
FT                   KSPERNDLIDVAILSEKGEVVYQQICKPQVAVEYLRDQHGIGDEQLAKIVGAPTSDAVV
FT                   QKVLEVVNGHDLVAFYGDELPLFPGIERSASSVRVLQDPEEPESVQAAVMMEGIAQQTP
FT                   EIKSAEDCAKLVRELWLKAREAEMRAEAQRQSPSAKNPN"
FT                   /protein_id="YP_001110072.1"
FT   misc_feature    complement(5793..>6218)
FT                   /note="Cytidylyltransferase family; Region: CTP_transf_1;
FT                   cl00347"
FT                   /db_xref="CDD:174132"
FT                   /locus_tag="Bcep1808_7307"
FT   misc_feature    complement(<4491..4721)
FT                   /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
FT                   superfamily; Region: DnaQ_like_exo; cl10012"
FT                   /db_xref="CDD:176833"
FT                   /locus_tag="Bcep1808_7307"
FT   gene            complement(6281..7990)
FT                   /db_xref="GeneID:4947700"
FT                   /locus_tag="Bcep1808_7308"
FT   CDS_pept        complement(6281..7990)
FT                   /locus_tag="Bcep1808_7308"
FT                   /gene_family="HOG000014483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA primase"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1407 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="GI:134287909"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR006647"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="GeneID:4947700"
FT                   /translation="MSATHRFADAFLDEVRERTDLVEVVGQHVKLKKGGKDFVGLCPFH
FT                   TEKSPSFTVSPVKQFYHCFGCGAHGNVFSFLTEYSGYDFVSAVQELALRAGLSMPERSA
FT                   PTAHALAAEARTARIGDALQRAQRTYFRNLRNCPGAIGYMKGRGLTKATVVQFGLGYAD
FT                   DGHIHDWDGVAIDVLECAGLVAVDDETGVYHERFRRRLMFPIWNERSELIGFGGRVLDD
FT                   RQPKYLNSPETEVFRKGEELYGLNFAKQSIRQGRLAVVVEGYMDVVMLHQHGDARAVAS
FT                   LGTSLTEEQLRRLYRMADHVVFCFDGDKAGRAAADRAARVAIGITPDGKTASFLTLPGD
FT                   HDPDSFVREHGIDSWRAFVECEATPLSRKLIEMLLRGRDLEIAEHRAAFARDGIETLAV
FT                   IGHAPIFRAALQSELERIAQMALSVPEVADARPNRRADAATHIRVQTQSDVGLLPASNR
FT                   VAFYRRYALLLALDRDAGAEIPYQLLDDFSELVSGWFACAAIDHRARVEAAERIVDPAL
FT                   RAVVVEAIQSSRKRANMLVGDALAREVGALVQTISGELAQRARAEEAAALFR"
FT                   /protein_id="YP_001110073.1"
FT   misc_feature    complement(6731..7975)
FT                   /note="DNA primase, catalytic core; Region: dnaG;
FT                   TIGR01391"
FT                   /db_xref="CDD:162334"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(7691..7960)
FT                   /note="CHC2 zinc finger; Region: zf-CHC2; cl02597"
FT                   /db_xref="CDD:141551"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(7244..7603)
FT                   /note="DNA primase catalytic core, N-terminal domain;
FT                   Region: Toprim_N; pfam08275"
FT                   /db_xref="CDD:149368"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(<7076..7225)
FT                   /note="TOPRIM_DnaG_primases: The topoisomerase-primase
FT                   (TORPIM) nucleotidyl transferase/hydrolase domain found in
FT                   the active site regions of proteins similar to Escherichia
FT                   coli DnaG. Primases synthesize RNA primers for the
FT                   initiation of DNA replication. DnaG...; Region:
FT                   TOPRIM_DnaG_primases; cd03364"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(order(7193..7195,7202..7207))
FT                   /note="active site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(7205..7207)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7308"
FT   misc_feature    complement(order(7145..7147,7175..7180,7196..7201))
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173784"
FT                   /locus_tag="Bcep1808_7308"
FT   gene            complement(8029..8745)
FT                   /db_xref="GeneID:4947701"
FT                   /locus_tag="Bcep1808_7309"
FT   CDS_pept        complement(8029..8745)
FT                   /locus_tag="Bcep1808_7309"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287910"
FT                   /db_xref="GeneID:4947701"
FT                   /translation="MQKNVGNWYHARYRYLICLQDVQKTMRKILLRMVRCLAVPTSLAL
FT                   AGSGAFAAPPDTVPLNTTMAPDSAQASDAALTLASGFVQCDPSIALQRSELVSRGVRFL
FT                   SPGQRIAPPELSTSVRMILVPQLPPIGQSERAADGKGFLTASAMYPLKRPMRLLNSEIK
FT                   LTGIGQAAYFSIKPTIVAITLKFNRPVGDAVRALDARFGGAVSRRLGEEYASEHIWFTP
FT                   DPANNSLTCYRHPDAQ"
FT                   /protein_id="YP_001110074.1"
FT   sig_peptide     complement(8587..8745)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.993 at
FT                   residue 53"
FT                   /locus_tag="Bcep1808_7309"
FT                   /product="hypothetical protein"
FT   gene            complement(8825..9376)
FT                   /db_xref="GeneID:4947702"
FT                   /locus_tag="Bcep1808_7310"
FT   CDS_pept        complement(8825..9376)
FT                   /locus_tag="Bcep1808_7310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287911"
FT                   /db_xref="GeneID:4947702"
FT                   /translation="MGLFSSNEDAGRLALPAHVFIEAVRLAAVPRRPVEGHALDEGLRG
FT                   ACVHPRYAAVDYLTDWWNHTAPSELRGAFSFTPYVKVRVGWASGDIEEGYVSEKAMAQT
FT                   EGKRGEATLLDRIVLVFYRKPTTNGHRWFAAPRVDGSHGAEGVLPAWLAAEELLATDAY
FT                   DALHEFPFRFDDLWGHLQSI"
FT                   /protein_id="YP_001110075.1"
FT   gene            complement(9397..9849)
FT                   /db_xref="GeneID:4947703"
FT                   /locus_tag="Bcep1808_7311"
FT   CDS_pept        complement(9397..9849)
FT                   /locus_tag="Bcep1808_7311"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287912"
FT                   /db_xref="GeneID:4947703"
FT                   /translation="MHHLRYGSGGPASGRTSRKRTANCKAIGLEREATEFMMRKLGDWL
FT                   AGVILFCIVASDVRSVDPVIAAQKRAVFGIIVSMISSAVFCGCAVAILPDEPSSPGVGS
FT                   LTAVFQRCVAAGFSLAALAASVAGIYFLVRYVLVLKWPERFVDLSE"
FT                   /protein_id="YP_001110076.1"
FT   gene            complement(9863..10312)
FT                   /db_xref="GeneID:4947704"
FT                   /locus_tag="Bcep1808_7312"
FT   CDS_pept        complement(9863..10312)
FT                   /locus_tag="Bcep1808_7312"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287913"
FT                   /db_xref="GeneID:4947704"
FT                   /translation="MRNLIRVALGAVVLAASVQAAVAADDLVWIRTATVGGVEVRLPTT
FT                   MRANGTMCVGYVARASREVTGELDLAISEICGKPVVPRSLSANGAESLEGYAWTKVGKG
FT                   DLSIEIPQSVAESKQGYRLLPSGAGKKCALTNVVITGNADVRCAS"
FT                   /protein_id="YP_001110077.1"
FT   sig_peptide     complement(10241..10312)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.840 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7312"
FT                   /product="hypothetical protein"
FT   gene            complement(10411..12855)
FT                   /db_xref="GeneID:4947705"
FT                   /locus_tag="Bcep1808_7313"
FT   CDS_pept        complement(10411..12855)
FT                   /locus_tag="Bcep1808_7313"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: reu:Reut_A3412 DNA topoisomerase III; PFAM:
FT                   TOPRIM domain protein; DNA topoisomerase, type IA, central
FT                   domain protein; SMART: DNA topoisomerase I, ATP-binding;
FT                   DNA topoisomerase I, DNA-binding; Toprim sub domain
FT                   protein"
FT                   /db_xref="GI:134287914"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="GeneID:4947705"
FT                   /translation="MGKKLIVAEKFSVAADIARALGGFEEKRAGDRKWYERDDFVISCG
FT                   IGHLVEIGVSDEQNTYDITRLPMIPDPFVLKPVQKTLGQLQLLIKLIGRPDVDGLINAC
FT                   DAGREGELIFRYIYAAAKSRKPFERLWLQSMTPEAIRTGMKNLRSAQDMQTLFEAARCR
FT                   SEADWLMGVNPTCALTGLYTRETGDLDKHSTGRVQGPTLAIIVDREDKIRTFVSKDYWE
FT                   VHAKFGAQAGAYSGVWIDPQFVKDDSNEDARAERLWSASRASEIAQRCRGAESTSVVDE
FT                   TKPVAKPPPLLFDLTALQREANAKFGFSAKQTLDLAQALYEKHKVLTYPRTDAKALPED
FT                   YVETAKGVMQALSSSSSAKFAAEALNNGYVIFKKRIFDNSKISDHFAIIPTLTPAAALS
FT                   DAERKIYDLVVRRFIAAFYPDAEFQKTVRLTTVAGEVFKSSGSVTTRAGWMAVYGREEG
FT                   EEDADMCAVQPGERPLARDVDVKACETKAPARYTEATLLAAMEHSGKFVEDEALREALA
FT                   GRGIGTSATRAGIIEGLLFADAKKRPYVLREGRELVPTEKAFKQVRFLRENGVEALTSP
FT                   ELTGEWERKLKLMEAGKYRRGDFMAEIVAETKRIIERIRAKALATDAAATATLTTPCPK
FT                   CNGAVMCQPAAYACNCGLRISRVILKRRLTEAEAEVLMRDRKSGVLEGFVSPRTGNKFT
FT                   AILKFSEALDKLEFELPARGAAAGTGETSATIGACPKCGSQMVQRGDNYFCEKNRPAGG
FT                   ECDFVIWGTIAKKRLTPEVVKALLDPGRTSLLNGFTSSGGKKFSAYLVRKPDFKIGFEF
FT                   ES"
FT                   /transl_table="11"
FT                   /protein_id="YP_001110078.1"
FT   misc_feature    complement(10417..12855)
FT                   /note="DNA topoisomerase III; Validated; Region: PRK08173"
FT                   /db_xref="CDD:169253"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(12415..12849)
FT                   /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to topoisomerase III.
FT                   Type IA DNA topoisomerases remove (relax) negative
FT                   supercoils in the DNA by...; Region: TOPRIM_TopoIA_TopoIII;
FT                   cd03362"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(12529..12531,12535..12537,12541..12543,
FT                   12817..12819,12826..12831))
FT                   /note="active site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(12499..12504,12508..12513,12532..12534,
FT                   12538..12540,12808..12810))
FT                   /note="putative interdomain interaction site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(12535..12537,12541..12543))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(12532..12534)
FT                   /note="putative nucleotide binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(11023..12390)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(12220..12282,12301..12324,12337..12390))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11230..11235,11260..11262,11266..11271,
FT                   11278..11283,11863..11865,11890..11892,11902..11904,
FT                   12319..12321,12343..12345,12355..12357,12364..12369))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11158..11160,12235..12237,12247..12249))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11398..11430,11497..11553,11557..11601,
FT                   11992..12036,12184..12207))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11602..11664,11680..11706,11797..11874,
FT                   11878..11967,11971..11991))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11200..11202,11281..11283,11287..11289,
FT                   11623..11625,11635..11637,11644..11646,11701..11703,
FT                   11938..11946,11956..11958))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11701..11703,11863..11865,11869..11871))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   misc_feature    complement(order(11023..11139,11158..11202,11212..11238,
FT                   11254..11304,11353..11397))
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7313"
FT   gene            complement(12877..13488)
FT                   /db_xref="GeneID:4947706"
FT                   /locus_tag="Bcep1808_7314"
FT   CDS_pept        complement(12877..13488)
FT                   /locus_tag="Bcep1808_7314"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287915"
FT                   /db_xref="GeneID:4947706"
FT                   /translation="MAARVHRKKASTPNDRNRVFDHIRKRIGEELQRPDLRVRPSSQLE
FT                   LAISTFAPSQVLIGFEVSDYPFFDARYVSVRDGHVYIVKGSTDDGEQIVAYRLNFIQSI
FT                   MTTQGGIGVAITPDGWMESTMVMYSLTHEHFEMKGGVLQGINDQMLERRSYPIKKAHAY
FT                   WAHWTRRGRARLTALPMIGKLFERKRPAPRDEGDDAELKY"
FT                   /protein_id="YP_001110079.1"
FT   gene            complement(13491..13712)
FT                   /db_xref="GeneID:4947707"
FT                   /locus_tag="Bcep1808_7315"
FT   CDS_pept        complement(13491..13712)
FT                   /locus_tag="Bcep1808_7315"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287916"
FT                   /db_xref="GeneID:4947707"
FT                   /translation="MKTHKRRAILLVVLATFLAGLGFYAMFRGDTNHFVAGGIALALFA
FT                   CFFVVFNRAWEAFEASSADAGSEHMRGR"
FT                   /protein_id="YP_001110080.1"
FT   sig_peptide     complement(13644..13712)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.419 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7315"
FT                   /product="hypothetical protein"
FT   gene            complement(13713..15188)
FT                   /db_xref="GeneID:4947708"
FT                   /locus_tag="Bcep1808_7316"
FT   CDS_pept        complement(13713..15188)
FT                   /locus_tag="Bcep1808_7316"
FT                   /gene_family="HOG000113196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DnaB domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DnaB domain protein helicase, N-terminal
FT                   domain protein; DnaB domain protein helicase, C-terminal
FT                   domain protein; KEGG: vpa:VP2735 replicative DNA helicase"
FT                   /db_xref="GI:134287917"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="GeneID:4947708"
FT                   /translation="MLQSETNRRRNEAVERRREDAEVAAVEAEECAVAALFGEHGAAAF
FT                   DTLSLRLRAEDFFVPAYRLVFESFGEIVDRGAKADQATLVTHLKSKESFSDRARELVEQ
FT                   AIVVSYSIENIESYADAIVEKARARAIHAELQLVQKEIPRVGGDVRSADVLQRIDAISL
FT                   KFADRQTDDTLLKSASDGLSAVVARWEKIESGEVLGIKTGIDDLDDRLGGLHGGQLIIL
FT                   AGRPSMGKTAKALNIAAHASILSVDELSLDELVMNPDPSPDLSPMGAIFSLEMGQVQLT
FT                   MRILSNIANVEYRRLVRGEFDTSDWTNLNGAFVRYGRSNIHISQESYLTPASLRAKLRM
FT                   LIQRTKRKLRYVIVDYLQLMDADGPSAGANRTNDIGAISRGLKKIATEFDVPVIALSQL
FT                   NRELEKRADKRPVMSDLRESGAIEADADVILFIYRDEVYNPDSPHKGMAELIIGKGRDA
FT                   GLGMVPAHCQLEYQRFSSMPKGAYSYESAYGGS"
FT                   /protein_id="YP_001110081.1"
FT   misc_feature    complement(13752..15059)
FT                   /note="replicative DNA helicase; Region: DnaB; TIGR00665"
FT                   /db_xref="CDD:161985"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(14817..>15059)
FT                   /note="DnaB-like helicase N terminal domain; Region: DnaB;
FT                   pfam00772"
FT                   /db_xref="CDD:144390"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(13782..14516)
FT                   /note="DnaB helicase C terminal domain. The hexameric
FT                   helicase DnaB unwinds the DNA duplex at the  chromosome
FT                   replication fork. Although the mechanism by which DnaB both
FT                   couples ATP hydrolysis to translocation along DNA and
FT                   denatures the duplex is unknown, a...; Region: DnaB_C;
FT                   cd00984"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(14496..14516)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(order(13788..13790,13821..13823,13887..13889,
FT                   13995..13997,14124..14126,14496..14501))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(14124..14135)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Bcep1808_7316"
FT   misc_feature    complement(order(13848..13853,13887..13892,13974..14000,
FT                   14073..14081,14106..14111))
FT                   /note="DNA binding loops"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Bcep1808_7316"
FT   gene            15430..16059
FT                   /db_xref="GeneID:4947709"
FT                   /locus_tag="Bcep1808_7317"
FT   CDS_pept        15430..16059
FT                   /locus_tag="Bcep1808_7317"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287918"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:4947709"
FT                   /translation="MLPIPTCPTGATPYLQIATEEVITALAQLGEDPTVTNAESIRARL
FT                   DVPTILVASDRAAAIRDSIRTVSRDRAPTPPPAQEGNPDLGSTLTFEDNRTGETPWRLD
FT                   THSDTIARLTAADGTTLATVWCNRSDTCLQIEYSEVRPDARRQGVYRRLLERISTHYNV
FT                   YSDEAHNNAAKSAYHALGALETRSGRMLLRKQPAASLEISTPNAEL"
FT                   /protein_id="YP_001110082.1"
FT   gene            16668..17318
FT                   /db_xref="GeneID:4947710"
FT                   /locus_tag="Bcep1808_7318"
FT   CDS_pept        16668..17318
FT                   /locus_tag="Bcep1808_7318"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287919"
FT                   /db_xref="GeneID:4947710"
FT                   /translation="MTKIPQSSSTTYSAEAVIEVLARHGKDPTASQIEEIRSRLNWDVQ
FT                   APASDNIDEAVMDAARYVLEDPPKLVLRRGAKPSEALREIKMRFDQNPFNPRQRIVTDD
FT                   GKQLALLEVSASPNGGLHISDIMAVESGKGYGARALAIVLKIADEHHEEITLTAKAYSS
FT                   KRRALDTPDLRDWYARHGFVVEGGDEIDGFDMVRAPRPKLTLSRKPDDKDPQP"
FT                   /protein_id="YP_001110083.1"
FT   gene            complement(17315..17554)
FT                   /db_xref="GeneID:4947711"
FT                   /locus_tag="Bcep1808_7319"
FT   CDS_pept        complement(17315..17554)
FT                   /locus_tag="Bcep1808_7319"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287920"
FT                   /db_xref="GeneID:4947711"
FT                   /translation="MTSPPLKPMRGLMEIGQSRSYAGLLSGSLDEAGFGVVGLRYRENR
FT                   ERLFFDFSFFAKTAPGRRQLTASLPPVCLIPCPS"
FT                   /protein_id="YP_001110084.1"
FT   gene            complement(17699..18190)
FT                   /db_xref="GeneID:4947712"
FT                   /locus_tag="Bcep1808_7320"
FT   CDS_pept        complement(17699..18190)
FT                   /locus_tag="Bcep1808_7320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287921"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="GeneID:4947712"
FT                   /translation="MIDAIRIESKASILGQKADPLGVVVSITDPYWSVALQSGWAAVLP
FT                   LTFHDATRPAQFRELFGGHHKRVLLEFVSRWLAEKESFTLYVHCDYGISRSSAVAVALS
FT                   EQLQIPMESWDGDGSVLSPNAHVLAVMRGDALGVHAVPRARRKGWRDVLDRLLSIGQTD
FT                   "
FT                   /protein_id="YP_001110085.1"
FT   misc_feature    complement(17738..>18121)
FT                   /note="Protein tyrosine phosphatases (PTP) catalyze the
FT                   dephosphorylation of phosphotyrosine peptides; they
FT                   regulate phosphotyrosine levels in signal transduction
FT                   pathways. The depth of the active site cleft renders the
FT                   enzyme specific for phosphorylated Tyr (; Region: PTPc;
FT                   cl00053"
FT                   /db_xref="CDD:173992"
FT                   /locus_tag="Bcep1808_7320"
FT   gene            complement(18187..21543)
FT                   /db_xref="GeneID:4947713"
FT                   /locus_tag="Bcep1808_7321"
FT   CDS_pept        complement(18187..21543)
FT                   /locus_tag="Bcep1808_7321"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dps:DP1991 hypothetical protein"
FT                   /db_xref="GI:134287922"
FT                   /db_xref="GeneID:4947713"
FT                   /translation="MATSSNDSILWPDLRAYGSALSVAFNPSIGRNLLKFSIHDRELFR
FT                   DRSGVRGDLNTVLRQAGFSLCANETQVNQARAYSMAVSRGLTVEAAEAAQLQAREALFF
FT                   YSPTIPFNRERLRGFIPALRDTDFQRIAVSEVKHFDFLFADEELVDSFVSQQQRLDGAE
FT                   AGVFFTTAPTRALTAQLAKSSYSLHELLEYRDLPPADARGITFDGALAEVLAFHPAGDV
FT                   ERAVRRQTIGIDGMPLRAPSMRSAFIGYATREAAEAANGGGLDGIERVEVPYGIPFGFA
FT                   SDDARPLVLNDARYLEFNSVEFPELDASLTSNVQRNREFLTHVRRVIQAYEGLRADGLL
FT                   NPAQWSSLPVTADVKARFEQVFSDMKAALAPVMPHQGFFTVEALAAYGGQRAARFGEHF
FT                   PAGFLSFVDDFRTNLYNAAQRRHDELTAEASFRAGMQRVMQAVLPASQVQGRREDAGEK
FT                   IGGARKDYAQRALQRSEVSSLSPRERIDIVTKDNVWPKLDMAEMRDRGVEPQVAFVIRE
FT                   FRHALPATPCRGGRNRKRILLERRAAEPLTVERCDSFIRAVELVRDRLATVKTEGDLHR
FT                   ACFEIRQAADLPVELRPIKDDGIDRRQLYCGEAKYYFWDSAHWFFDGAGQKFTDALPNV
FT                   IYDEATSQVRASYTLVRMLDAARVSTEGGWNWAIKGRRTSSDEEGVQRKKERVEPIIPH
FT                   LDDIRRIGPDHREGADVDEGAFMLAFGFRGVEYGKWLPQGERQTVLNHAYDAFMDLAEV
FT                   MGLPARAMGLGGELAIAFGSRGSGGKQAASAHYEPGRRVMNLTRLSGAGFLAHEWWHAF
FT                   DDWLARASGLSASHFATELAVRAQATRVERLAKIPRSVSDLAGLLTKAKSVPMSLPEVL
FT                   VQHASVEVHKERVPIDEFVDGRLRDWISSLDRLLPEERRDGAFKEQALSELEKHRTDVE
FT                   GFEGLRLQRINDGDQFVERIADAMDAAFGSPDWRQRSSTIVTRASHTISVQERLLKKLT
FT                   DVRDGYVPGKYLKDSVYFRDALFYDDYRSKPYWSTDTELSARMFETWVQDSVASERGRR
FT                   SDYLVYGRDDCVKPEHWGYPRGIERRVIGAAIDRYFETHRPELLRMLDDPDIQKRTSLR
FT                   TITDPVESGPS"
FT                   /protein_id="YP_001110086.1"
FT   misc_feature    complement(<20728..>21027)
FT                   /note="lipid-transfer protein; Provisional; Region:
FT                   PRK07937"
FT                   /db_xref="CDD:169158"
FT                   /locus_tag="Bcep1808_7321"
FT   gene            complement(21583..21942)
FT                   /db_xref="GeneID:4947714"
FT                   /locus_tag="Bcep1808_7322"
FT   CDS_pept        complement(21583..21942)
FT                   /locus_tag="Bcep1808_7322"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287923"
FT                   /db_xref="GeneID:4947714"
FT                   /translation="MYDTINSLSRGGVFWGVVVNQWPLPFSLGELDGVVLAMGSDEGLV
FT                   LVLVPSERLDSSDCLNLQLKDRRKDQIYLAVTITREGRFIAGAHMGQTIDELGAVDALA
FT                   LYVPLIRGQWERVFV"
FT                   /protein_id="YP_001110087.1"
FT   gene            complement(21945..23306)
FT                   /db_xref="GeneID:4947715"
FT                   /locus_tag="Bcep1808_7323"
FT   CDS_pept        complement(21945..23306)
FT                   /locus_tag="Bcep1808_7323"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pde:Pden_1931 hypothetical protein"
FT                   /db_xref="GI:134287924"
FT                   /db_xref="GeneID:4947715"
FT                   /translation="MTIKFGALSQAPAGDEDAERLLSLSEDELEASSRGKPMRELSGGA
FT                   ARPDDAPATGSAADEAIEPVAAADVAKAEDAWVGEGGNPAPDDLPEDQEPKLATDPKVD
FT                   EAGAQKAVRSRKEKGLSSLARLASGKLDKSDVSLKPSGAAQSIMKSAPADRFATDADLQ
FT                   DLLSGLSGPTPASELHEKPAADSAPAQAQHELAAAPTRTAAVGAAAVPAAAQTVGDVVG
FT                   QGIAGVVAAPFLAMTSAHRHLRQRFSTQPAAERAAGAQASAALSAGVPLAALARLEKIS
FT                   TWKCDQIEKSANAVLAAADGLRGVDGFVVWEDGVTKEANKRGVSPSEVIVQMRHDADLA
FT                   PLREQMTALWRDNPAAVAAYRRESDVFEKHLKDVREKFANSDETVRSRVTEAMKGVETQ
FT                   TSDLPGFGTNEGEYTATLGERVREMARAMIALLEALVARLTGKAPADSAPEISG"
FT                   /protein_id="YP_001110088.1"
FT   gene            complement(23330..24430)
FT                   /db_xref="GeneID:4947716"
FT                   /locus_tag="Bcep1808_7324"
FT   CDS_pept        complement(23330..24430)
FT                   /locus_tag="Bcep1808_7324"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M23B"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M23B; KEGG: xcv:XCVd0033 putative
FT                   family M23 peptidase precursor"
FT                   /db_xref="GI:134287925"
FT                   /db_xref="InterPro:IPR002886"
FT                   /db_xref="GeneID:4947716"
FT                   /translation="MNVRLSVSIGMVLTIMSAHAGAQCLADPVNIPTNMVTSTFGKTRL
FT                   LAQYSSPRVHWGVDFQARNPSNPSQGAQLKAVDNGTIIGAGFWGSGYGNRVALRRANGD
FT                   IVTYNHLASVEPKLKSGGAVGFRESSGSPLGTTQVAVGDVVGVAGGTGNHMDRYDLPIH
FT                   LHLEYVTGYGGTKLRETNDGTNKTRSHYLRNALEYMCKTYPFAPGAGQVTQGTGGQAPT
FT                   PIAEGGAAASETVPTSADQIYEARQTQPTVTDRERYGFPDVPPYQTYDGMSESQIVDAE
FT                   MLRRALDTEWEVRLTDLSERGLIAEISRMFSARLWMQRKISERRARIEAMQSMVVAYKT
FT                   NRYLTPKVQAAYSRVTNAMADRKIAN"
FT                   /protein_id="YP_001110089.1"
FT   sig_peptide     complement(24368..24430)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.829 at
FT                   residue 21"
FT                   /locus_tag="Bcep1808_7324"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<24089..24274)
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="Bcep1808_7324"
FT   gene            complement(24427..25563)
FT                   /db_xref="GeneID:4947717"
FT                   /locus_tag="Bcep1808_7325"
FT   CDS_pept        complement(24427..25563)
FT                   /locus_tag="Bcep1808_7325"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287926"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947717"
FT                   /translation="MSRTFKKAVVCTVLLSVTGFSVASGCPAVMDSAWQAGLTAAQSSI
FT                   AVAIQGMAQGISVARALNLERIMGSIRVLNAQISASSNKSSQMNLSAKQASANLAVEIS
FT                   NRKAVMQAIADYSPETGQGFDPCGEGQRSKNIATALGEAATDMQEKVVREIDSAPGRFV
FT                   ADPSTVVAQRMQLAKSTYCTADEARAGLCAAPGQLAGKDVDGANFFTSVQAGSGLDNAK
FT                   SALLNNMFGTPDIALNKSTAALPAGQAYMEQKRSKDAVASVAQASLKTIQSYTAARGGS
FT                   GSDTQSVLDAVSSKIDTYAGGANYDAWAQTLASQSQRGLLVVFAKMLSTDLYLTYLNYQ
FT                   SGEREEAIAAARLALHASDMPTGDVALQNAAARPKVVQ"
FT                   /protein_id="YP_001110090.1"
FT   sig_peptide     complement(25492..25563)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.544 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7325"
FT                   /product="hypothetical protein"
FT   gene            complement(25560..26621)
FT                   /db_xref="GeneID:4947718"
FT                   /locus_tag="Bcep1808_7326"
FT   CDS_pept        complement(25560..26621)
FT                   /locus_tag="Bcep1808_7326"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0030 putative secreted protein"
FT                   /db_xref="GI:134287927"
FT                   /db_xref="GeneID:4947718"
FT                   /translation="MVIGAGVAWASCGGTEALVTSAASAMAGAIVAQITANTAQIVALD
FT                   TVQTNTITGALKVATKQVEMSGDQHDNAVLQAEQAAASVATDLANKEMVDKTIEDYTSQ
FT                   GYNPCVQLTATKQMAAAEAKVNASVPARVQSEVQAGGGKYGGTAAVLAQREQLHRSLFC
FT                   TQSDVDAGICSSVGAIPGGDSNASLIFSTDTSANMVAAKNATINGIIGLPDAPMPAGMG
FT                   NTPAGAAYVMQKKEKDAYLAFPAYSLKSIQADAEGFDTFMAERVGQYFGSPAAQKWAQD
FT                   QASQAERGIIVDLVKLEGLTLKVREREFRQSLRREANAAAELALENDRINGTKTAAAAE
FT                   RALAAQSSAKVVQ"
FT                   /protein_id="YP_001110091.1"
FT   gene            complement(26684..27481)
FT                   /db_xref="GeneID:4947719"
FT                   /locus_tag="Bcep1808_7327"
FT   CDS_pept        complement(26684..27481)
FT                   /locus_tag="Bcep1808_7327"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287928"
FT                   /db_xref="GeneID:4947719"
FT                   /translation="MKWRLGIALLVVPLAAHAQLVQWLYEFQRSTSALGVLTAQISLSG
FT                   AQANNLALQAQQALSSSAIDLYIRDQVRQTVDKYGEKGQLIDGCYQVSMATQMGGISDS
FT                   AASNAASALARIYTQSESGSASAGGIAGALGATKQVTQFPFAASVALRSARHASNYCTV
FT                   SEAQLGYCSLNANGMQGGDQDFSLHLQPGKTYGWDQTEAMTDFTKRIAPVKPVPQSGKC
FT                   STPACVAALAARRDQEALMSMARFSFMRFSEAHETQKSATAGE"
FT                   /protein_id="YP_001110092.1"
FT   sig_peptide     complement(27425..27481)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 19"
FT                   /locus_tag="Bcep1808_7327"
FT                   /product="hypothetical protein"
FT   gene            complement(27483..28157)
FT                   /db_xref="GeneID:4947720"
FT                   /locus_tag="Bcep1808_7328"
FT   CDS_pept        complement(27483..28157)
FT                   /locus_tag="Bcep1808_7328"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287929"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="GeneID:4947720"
FT                   /translation="MGAGAALATGIAVMAQQSSTDANTSSTNCAVSAAAQSALSNRITM
FT                   IGMTQPDPAKYFTVGGVSSCIGALSNIDLSKLIPDPMGILTSLAQQALQMGVNAACTAA
FT                   RNSLSDLIGKYNYAAGILNNGSGMITGYLDQQIGKSVGVALTTYGTSYSAPPGTPTTID
FT                   PLSGVTAALNNSVGSTASQFTSTAQSTAQAAASAVTAPVTSAANSALSAPSSLGSKIFG
FT                   GN"
FT                   /protein_id="YP_001110093.1"
FT   sig_peptide     complement(28095..28157)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.656 at
FT                   residue 21"
FT                   /locus_tag="Bcep1808_7328"
FT                   /product="hypothetical protein"
FT   gene            complement(28217..28744)
FT                   /db_xref="GeneID:4947721"
FT                   /locus_tag="Bcep1808_7329"
FT   CDS_pept        complement(28217..28744)
FT                   /locus_tag="Bcep1808_7329"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287930"
FT                   /db_xref="GeneID:4947721"
FT                   /translation="MAENPNGAGASGHGAPERLFRVSDPDHVAAHLNAKDQTGMTLYQM
FT                   GFLGKVEHWVLNRLAEKDEELADDVTMRLQRLDDIVANFRNKIPADNPAFLQILSWLTI
FT                   EQAMYTVEYLQGYQDEFFMQLVDYCRLNEFNDVNADLALKRIRALNKTRLLDRWFSKAN
FT                   VDFVVTTLTGIQ"
FT                   /protein_id="YP_001110094.1"
FT   gene            28827..29090
FT                   /db_xref="GeneID:4947722"
FT                   /locus_tag="Bcep1808_7330"
FT   CDS_pept        28827..29090
FT                   /locus_tag="Bcep1808_7330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287931"
FT                   /db_xref="GeneID:4947722"
FT                   /translation="MQVLSWQHKRHRLVLALAKLDTQIASRAEILERTWVEKYRLTPHE
FT                   TGQTPPVTIAKSAPPAANIAAAPTPAAEPATPPKPAVPDYML"
FT                   /protein_id="YP_001110095.1"
FT   gene            complement(29111..34291)
FT                   /db_xref="GeneID:4947723"
FT                   /locus_tag="Bcep1808_7331"
FT   CDS_pept        complement(29111..34291)
FT                   /locus_tag="Bcep1808_7331"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: putative RNA methylase; helicase domain
FT                   protein; KEGG: xcv:XCVd0155 hypothetical protein"
FT                   /db_xref="GI:134287932"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:4947723"
FT                   /translation="MAVKGTEVTWVDLSTIGVYMGSWQHPSDPSKSLPLAMVDMGGAHD
FT                   AAIRKLGFRPMTGVKAAGIYVRDDTAVSREMLHEAFGHENVRFVRGAREVITGIFQRQF
FT                   REKTQLNAKAAFAQQRALGLNHRGEVVFETALGRHVVRRVNGESRLIAEAQGAPEDFLH
FT                   AHTRDQLRKVVQGFVQRITLRSDKLRRENVENLIKISNDGGFAPREYQEAIEVEIGALF
FT                   AREVVAAGLARGAAPLAAYDIADRIYHGMPELRERTPNSIANQQYSTPIPMSTLAQALL
FT                   TCGSELQGATYLDPTIGNGSLVSLIAAQRASGLTATVCGVEIDPARVEAAQDFADQVVL
FT                   GDATEIDFRRQFACSEGFDFVIANPPFGSMDQRETVELPKNSAVRSMSVQRLDHFLLLK
FT                   SLHARKDQGRAVFITGADNVMKAGEIIGASKHLLAYLYDHYEIDGVVDVSGELYKKQGA
FT                   GYPLRLYVIGDRKAEPEQTAEPKSLPVIRSYEGLRAWAEELISVRAPAVQSKRASATLS
FT                   TDAGTPIDTPAPVAEASAGPAGVNDGIQQGEVPAPQVSESEREDVRQESEFQQRYIAFS
FT                   NSGEASTMIPANLSGPVFEALAQIKSESGDIDEYVARELEYAVNDLPKYFSPEQIDALA
FT                   MICSATSRNLGFLLADQMGVGKGRVLAGFARRERLHGRVPMFVTVTDNLFSDFLERDIA
FT                   SIDSRHLFQAPLIVNNESKTVDADGNIVVRSMKRPEYRAHAEEGRLPEGTDLIMLTYSQ
FT                   LSRQHEKHLTSRYMRALCASYPISLILDESHKGAGASNTSENLAAMINGLELTGGNIVY
FT                   SSGTPIKGAKNLSLYRRILPAGVNPDELLDAVLSDPISLQEALNYEIAAQGCLISRELD
FT                   NTGIEKEFVVSRYVKRNEEVADQLSEILSAMNFISGDVRKVVGKLNREFEKQLEKIPEE
FT                   QRAGQRMAATSVNFASRMHALVCQMLLAMKAREIVDLTIEAIEANEKPIIALQRTGESM
FT                   LADYLTENSAAYDDSEDRVRKDFGGVTLEKPINFRDYLHKTLERLMWITTVERYGEVKK
FT                   TRASSKAIEEAAERIASLIDALPDDLPLAPIDYLREALEARGYTLGEISGRNLRSRTLP
FT                   NGKVTIEAMPGRTDKTRVNRVVREFNNGDLDAIVLTGAGSTGISLQASPAVGADVRPRV
FT                   MIKGEMQQDITAERQMDGRHNRTGQIERPRYKVPVTGLPADDRQAMMFNTKNRSLTAST
FT                   VANRDSKEIIREVPDLLNVVGDMVAEELLQENFDLADRLDIAMKDDSDSYQKPPLYYIK
FT                   VLTGRICLLRVEEQRSLYADLQARFHEKVDKLKAEGRNPLEVQCHEWRARRVDRRVFMG
FT                   ASNASTNQKSQLNAPVYLSQLEYEEELKAFKATEVDGRIAAACAEGVPNVAVIGAYLRE
FT                   QRHEILKRHTPKRFESVEEALIDKEPNEAKNAAAKLVWLDQNLQYLRPGAVYHQADLEG
FT                   VLIPTVIVRVAVPNKLEGYLRLSEYAFYTMRPGSDEVRLETASSLFAGGLDLDWAPFAE
FT                   HEEARDAFDAAENGIVTRRARVLDGNLFEATSLNLRQRIGRKIVYTDEAGARQHGILVY
FT                   ANVSEVELAKIPERIRDPGLVARFAEYRPVTTDASGDWNEDAGVLIRKNSVGRLELVAP
FT                   GTKKWGGYIFLDEALTPIAGKESECRFALTFRSAGGKMIATIPQESVRDVVLYLMDRHG
FT                   LSFYTRDREELARVRELDGRTCVGEVAPV"
FT                   /protein_id="YP_001110096.1"
FT   misc_feature    complement(33050..33493)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Bcep1808_7331"
FT   gene            complement(34716..35192)
FT                   /db_xref="GeneID:4947724"
FT                   /locus_tag="Bcep1808_7332"
FT   CDS_pept        complement(34716..35192)
FT                   /locus_tag="Bcep1808_7332"
FT                   /gene_family="HOG000263338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mav:MAV_4676 transcriptional regulator, XRE family protein"
FT                   /db_xref="GI:134287933"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4947724"
FT                   /translation="MRLGGSNRIQLPSLRKEEYPARIAALFDDFNETDLMSTLGDFIRA
FT                   RRKILGLTQTALAIRIGVDDTYVSAVETGRRTPDGQQFLDSLSVALELTDELRQQLAAA
FT                   ARTSQRIFRLPAEISMRKHEVLQAIALDSSLTDEDIEAFAAIHAALTRRRRAES"
FT                   /protein_id="YP_001110097.1"
FT   misc_feature    complement(34905..35069)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Bcep1808_7332"
FT   gene            complement(35229..35939)
FT                   /db_xref="GeneID:4947725"
FT                   /locus_tag="Bcep1808_7333"
FT   CDS_pept        complement(35229..35939)
FT                   /locus_tag="Bcep1808_7333"
FT                   /gene_family="HOG000263240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287934"
FT                   /db_xref="GeneID:4947725"
FT                   /translation="MEDFSAKGFLSASLATQRALAREQFKDEFRECEQWSDRAMASLGA
FT                   LTPGDKQLSTVVAAAYWMRCIRACQGGILLAERGMIPDALTLARSAVESLFHAVAVIDK
FT                   PELLERLIEHDMLERIKQARGIMSVASIMNHVAPDARVGIEALISAAAEKPRQWAAYDA
FT                   AKEAGLVELYETMFRGFSRSAAHSTLTALDHEFDQSSVGDLEFGPNYEHLSWTLEMLGI
FT                   CLRVGIERIAGKLE"
FT                   /protein_id="YP_001110098.1"
FT   gene            complement(35958..36482)
FT                   /db_xref="GeneID:4947726"
FT                   /locus_tag="Bcep1808_7334"
FT   CDS_pept        complement(35958..36482)
FT                   /locus_tag="Bcep1808_7334"
FT                   /gene_family="HOG000263339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sde:Sde_2749 hypothetical protein"
FT                   /db_xref="GI:134287935"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="GeneID:4947726"
FT                   /translation="MMKADSRASRMSSTKTDLSGASITDLLAAHCAVLEELKQRGVTRS
FT                   GNNPTGDYAEWLVASKLALRLAGKSSKGFDATDERGARYEIKGRRVTPQNRSTQLSPIR
FT                   SLAAAHFDYLVGVVFDSEWNVMMAAKIPHNVVSTVASYKAHVNGHVMHLRSNVLVIEGV
FT                   EDITALLRGLP"
FT                   /protein_id="YP_001110099.1"
FT   gene            complement(36512..36793)
FT                   /db_xref="GeneID:4947727"
FT                   /locus_tag="Bcep1808_7335"
FT   CDS_pept        complement(36512..36793)
FT                   /locus_tag="Bcep1808_7335"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287936"
FT                   /db_xref="GeneID:4947727"
FT                   /translation="MAMHEQFLVIRGDAALKDFLAAYGFREIEADAKWNIGEYETIYQG
FT                   LTYRVGYRWHDPSQVYSIQRDVHKAQLWSIDAAGGVRVRANIEFDEDA"
FT                   /protein_id="YP_001110100.1"
FT   gene            complement(36893..37570)
FT                   /db_xref="GeneID:4947728"
FT                   /locus_tag="Bcep1808_7336"
FT   CDS_pept        complement(36893..37570)
FT                   /locus_tag="Bcep1808_7336"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287937"
FT                   /db_xref="GeneID:4947728"
FT                   /translation="MSDTLGRTAKNCRIDVGHYLPLLGTAAVLIGIALESAHAYLSWTL
FT                   RAEMAHAIGFFGIVVFAAGTTIEARGYSLGWQPIIGLAVLAVFVSGPALLAKDWLIAHS
FT                   LTYFAAVGQAIISFVVVGMVFFVVAPFVLKWEKKKKERNERQVKSSKAMAQCWWLYLFV
FT                   AIACQLGAFWYELWQQPFVAVSISQPARGFVEWYQVVADAAGIWIGFFFSRAVDPTIPR
FT                   STR"
FT                   /protein_id="YP_001110101.1"
FT   gene            complement(37700..38188)
FT                   /db_xref="GeneID:4947729"
FT                   /locus_tag="Bcep1808_7337"
FT   CDS_pept        complement(37700..38188)
FT                   /locus_tag="Bcep1808_7337"
FT                   /gene_family="HOG000229102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4426 hypothetical protein"
FT                   /db_xref="GI:134287938"
FT                   /db_xref="GeneID:4947729"
FT                   /translation="MQVLKTQNGRPPFGSVLGTVQLPADVVRGAASIAEEFFSAAEASE
FT                   FSGDPVETLAVPRWASRGSSAWLPNLSQLGYRRAEGGYRGRDDLWVVTAGVDLHTDDEG
FT                   LVLMIVLHNDALSFQQGRTRHRPYAGDWFIFDDRLPHGVREAPGRSTFVGWNIPVVPA"
FT                   /protein_id="YP_001110102.1"
FT   gene            complement(38176..39330)
FT                   /db_xref="GeneID:4947730"
FT                   /locus_tag="Bcep1808_7338"
FT   CDS_pept        complement(38176..39330)
FT                   /locus_tag="Bcep1808_7338"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_2171 hypothetical protein"
FT                   /db_xref="GI:134287939"
FT                   /db_xref="GeneID:4947730"
FT                   /translation="MAKAITQFFRDLGYPFKNPRWSWGARRNDVIILRTWADEYSGKTR
FT                   QVVVLDPDRFDDDESYGFDERIGHLRAIWAGGCAAYTVIVEAADTNARPRKIASYRDDA
FT                   IFVIKGLDVRDDGAIVADLSELVEVRRISQHVRWFRTDAGEGSFPVDTALETGVSGSTL
FT                   VQKLPAFREWLVGIARKRTTARYGVAMKRFGLGYYQLYNAMRKLGRECVSAGEPVLTSL
FT                   LLSAEGRCSDGFEDEFGIVDDEAERQRCYQYWNDAEPDPMPASEDAHRQGIEGDSLEVR
FT                   AERFASVLVRQHQSKFRKAVFLAYGGCCAITGCAIPEALEAAHLHGRDWREGHNNAEDG
FT                   VLLRRDLHALYDRELLSLVDGIAHFDEQVLDHYEVYEGVQVCKY"
FT                   /protein_id="YP_001110103.1"
FT   misc_feature    complement(38251..>38778)
FT                   /note="Predicted restriction endonuclease [Defense
FT                   mechanisms]; Region: COG3440"
FT                   /db_xref="CDD:33245"
FT                   /locus_tag="Bcep1808_7338"
FT   gene            complement(39367..39849)
FT                   /db_xref="GeneID:4947731"
FT                   /locus_tag="Bcep1808_7339"
FT   CDS_pept        complement(39367..39849)
FT                   /locus_tag="Bcep1808_7339"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287940"
FT                   /db_xref="GeneID:4947731"
FT                   /translation="MLTATRGGSVVMGTLKFLVCSSDEPISRSFGYIVDAQTADEARLI
FT                   YLSRIYAKDSIFRDSVLDLSMNLTFVERFYLGTPQETYRFEQTGLASVPDGVVAERVRE
FT                   FFATKPSLGEEFLKFMGDGDKSRVTEEMFEFIATHDGDGGVEVLELDNMPTLSALR"
FT                   /protein_id="YP_001110104.1"
FT   gene            complement(39903..40280)
FT                   /db_xref="GeneID:4947732"
FT                   /locus_tag="Bcep1808_7340"
FT   CDS_pept        complement(39903..40280)
FT                   /locus_tag="Bcep1808_7340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287941"
FT                   /db_xref="GeneID:4947732"
FT                   /translation="MKVLVDKAALDALLRSAVPAYEGDTSVIAHELNLDELVGEAVAAA
FT                   QPRKRGRAGDSNIDPLDQLVQVVIGVPESMNRFIKAQVTEAGTNVQAYTRAVLHLAMRA
FT                   GLMERVTAAMCNEGSKQGRCL"
FT                   /protein_id="YP_001110105.1"
FT   gene            complement(40280..40525)
FT                   /db_xref="GeneID:4947733"
FT                   /locus_tag="Bcep1808_7341"
FT   CDS_pept        complement(40280..40525)
FT                   /locus_tag="Bcep1808_7341"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287942"
FT                   /db_xref="GeneID:4947733"
FT                   /translation="MRRRKLPPIVTKLSESENQTVWRVELPPNGSGFRSTYRATTYPNS
FT                   DLVFVETWVKKLKSSNKKVVEVMRAHLAGGDRPGEV"
FT                   /protein_id="YP_001110106.1"
FT   gene            complement(40766..40984)
FT                   /db_xref="GeneID:4947734"
FT                   /locus_tag="Bcep1808_7342"
FT   CDS_pept        complement(40766..40984)
FT                   /locus_tag="Bcep1808_7342"
FT                   /gene_family="HOG000229101" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_5379 hypothetical protein"
FT                   /db_xref="GI:134287943"
FT                   /db_xref="GeneID:4947734"
FT                   /translation="MKKDLPQEQQDFLRHAMDVLGMTREEFAERIGAKKRALDNWLLPS
FT                   SSAEHRAMPDMAWKFIREILSHLEQKP"
FT                   /protein_id="YP_001110107.1"
FT   misc_feature    complement(<40784..40960)
FT                   /note="aspartate carbamoyltransferase; Provisional; Region:
FT                   PRK11891"
FT                   /db_xref="CDD:171326"
FT                   /locus_tag="Bcep1808_7342"
FT   gene            complement(41152..41970)
FT                   /db_xref="GeneID:4947735"
FT                   /locus_tag="Bcep1808_7343"
FT   CDS_pept        complement(41152..41970)
FT                   /locus_tag="Bcep1808_7343"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287944"
FT                   /db_xref="GeneID:4947735"
FT                   /translation="MSNPNKLYISDEIIAGALTELGEDVSVDRVRQVQSKLEDMGRLDG
FT                   ADVDSLRAAVDVARNARDVYPIQDRQRHDDAILEKYIKMSAESVASLRKDDVFRVLDGI
FT                   AKENVDGVTRAELASFIANARPDLESEVREVMTEEFPADNWSATSAMLAPHARRAHALA
FT                   ASAQLANSGAMSKEAVLARLPGVWDDVGGGFYVKRYQNTDDFLEANVLSDGVLRLQAKA
FT                   VGGVGDVMNAVQCVLERRVDPRDAMAIPSVVEELEGAFPWQRDESPSPEM"
FT                   /protein_id="YP_001110108.1"
FT   gene            complement(42053..43351)
FT                   /db_xref="GeneID:4947736"
FT                   /locus_tag="Bcep1808_7344"
FT   CDS_pept        complement(42053..43351)
FT                   /locus_tag="Bcep1808_7344"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287945"
FT                   /db_xref="GeneID:4947736"
FT                   /translation="MVIARDHARVVPPDVDDKTYWEREIRAYDDAFAAYSPSSIPDDFR
FT                   THHSAWREGLVIARDRALLQPPEINDRLYWEHELTAYDRAFAAIGIEFVNDLPAWTSED
FT                   CAIADVQGWNIFDVDGTGYLEIQKDDEAQVFESDDDAVAYVRERAQGGCPVALKAMKIA
FT                   ELVAQSAGIVGRRLPSVSLEASTAGKDNAPTVTLADGYDGRMVRFGANPIEVDGELVKL
FT                   RCEEPGKEYMTAWRSADVLRDAIDSQEEARNANRDWIREVARNVLKQYAGVDRVSNLYD
FT                   SDEKFSAALRDLAGTDFEYPDFSHLSVADAMRKAIRLGSMTPTSEASLKNTVANDSGTR
FT                   RDKANFEPHIEQFRGGLLRVHTSESHADFLIPEGVTDRKDHLMEAARLARIESESLQRR
FT                   ANEMAERARCAVVAAGLCEPPVAQPEQSPSLGM"
FT                   /protein_id="YP_001110109.1"
FT   gene            complement(43522..44715)
FT                   /db_xref="GeneID:4947737"
FT                   /locus_tag="Bcep1808_7345"
FT   CDS_pept        complement(43522..44715)
FT                   /locus_tag="Bcep1808_7345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287946"
FT                   /db_xref="GeneID:4947737"
FT                   /translation="MRCDGRRCLAAAPNWATKDSFQTTNFRRIPAMDVRPTNSALASDE
FT                   VLEALVALGEDPKASRVEQVRGLIDSASLQAGERADAVRRAVDDARNQIDAVQTMFRDV
FT                   QPEPRTRVEIDTYGPDGIRLQSRSRWFVGEWQHAWSWSNDGRAEAHCRVVVDISNEKLT
FT                   AAQVADRGKWANATEDQFTELAASLFVEHKVSIDPKAYDLFELDRLPRWAAAMVGGGEI
FT                   PSYRDGDVIGFDRHGNAIEWSAGADMPVESGLTRDMIVLAKRSAMGRFFFVPSAEDDDD
FT                   GFDRLMAMQSIDDIAAASSDRNGWGHIFLADHWQGHQLTNIQKWVFKDAARLIATMCGV
FT                   SPDVAIKHIQTLRTTYVANDNRTRIGDWDISFSPSAKSASRDCVEQCSDASTQSFEM"
FT                   /protein_id="YP_001110110.1"
FT   gene            complement(44802..46187)
FT                   /db_xref="GeneID:4947738"
FT                   /locus_tag="Bcep1808_7346"
FT   CDS_pept        complement(44802..46187)
FT                   /locus_tag="Bcep1808_7346"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287947"
FT                   /db_xref="GeneID:4947738"
FT                   /translation="MQLNALNVNGAKKQRKAEVPKNVVMRLDRIVNEPDKPAVFHGIDP
FT                   DTNEPIRVRMMFVDEGALANARKGELLDAAKARIENQYLGTGEKHRPRPSEIGNPKSKV
FT                   HCGQGGLLMFTKVLPAEDGLLKAHWVETLESGPGVACQKVCAHIAVGEIRDRENKERVV
FT                   SSFVHADIIKPEAATILTNENAEEFLLGAFANRDEEALRKPFVLMRLVGKDGSVITDLP
FT                   EMRVNPLIVEEKIRDHDLGIDKAVYRIAPADDTLKHIMSPDNVERDALILRSVVFGLSE
FT                   EPGYPDFGKVESDQLRGDLNNIVDAVRSGAVVAEIIPGERISAGPATKASFLKQAQNEK
FT                   HPLHQYRGTQFVPTIEDGKETRKQRDNVKFYFDTYVTTKVGAGEYRYFVKANPVELFPT
FT                   RQSLYTLATANDHKATAEASRERANEATAELVDTSGEQFDPDALSNVDGELAASADAVD
FT                   LSM"
FT                   /protein_id="YP_001110111.1"
FT   gene            complement(46404..46853)
FT                   /db_xref="GeneID:4947739"
FT                   /locus_tag="Bcep1808_7347"
FT   CDS_pept        complement(46404..46853)
FT                   /locus_tag="Bcep1808_7347"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287948"
FT                   /db_xref="GeneID:4947739"
FT                   /translation="MNTFIDGLSRIARKVAHDYEARGGKLLRDGDGLDADELAAPDGGL
FT                   GALLWMTGEFVSDFGVDFATISFERTERASTGYRLVSVATTKPGWSEVVALAFSDFLRS
FT                   EVMGPNVESVDLGPLFENFSEWVRERGHERVITVAMAAAEPRQPE"
FT                   /protein_id="YP_001110112.1"
FT   gene            complement(47027..47428)
FT                   /db_xref="GeneID:4947740"
FT                   /locus_tag="Bcep1808_7348"
FT   CDS_pept        complement(47027..47428)
FT                   /locus_tag="Bcep1808_7348"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287949"
FT                   /db_xref="GeneID:4947740"
FT                   /translation="MTIERLPPGEIVEMRDPVMGGLKLGLVDDTGLGYFDIHGENELPK
FT                   VIHSELQPRSLGPVESWLRDLEPEFAEALSRAWVEMTNKRLDVLTLARALRAGIEQHIT
FT                   VVELLEEAGKQATDRILAGREAVRLALPR"
FT                   /protein_id="YP_001110113.1"
FT   gene            complement(47449..48999)
FT                   /db_xref="GeneID:4947741"
FT                   /locus_tag="Bcep1808_7349"
FT   CDS_pept        complement(47449..48999)
FT                   /locus_tag="Bcep1808_7349"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TOPRIM domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TOPRIM domain protein; SMART: Toprim sub
FT                   domain protein; KEGG: xcv:XCVd0036 putative DNA
FT                   topoisomerase"
FT                   /db_xref="GI:134287950"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="GeneID:4947741"
FT                   /translation="MRNLVIVEAAGKVDTLRASLKSIGFSADVIATVGHVADNPRSLNP
FT                   ICLDTDLRETAYAFREDRLALLGKIQRAAFNADRIYIATDDDHEGDVIAQDMARYLSDY
FT                   SDRLYRVRLRAITESELKESFGGSLSRDFDTPAWHGICRRIVDRAIGAAFTQVDGAATI
FT                   PVGRVQSSLLANLQSEPPVIGKYEVPLKLSDGGVYWTSIPIKTDADVERAMELERLAAT
FT                   AKVHLLDALEVDVPAARPWGYEDVVAETSLRLRIGIDDAAAVFQEAYERGLVSYPRVRA
FT                   GAFTQDAVEVAAAIAVHNGCVFDAAQLPLRNADAEGRRAHECPRPLQDDLLLGRPMSVL
FT                   DNAEALAVLVARNVIECGQLAKRRRVRARVDGEVLGFECDLARPRRPWKLVERQAGLSL
FT                   VPRPVALLRYMVKVGLGKPSTVVAHASKFLQRGLLEEKGVGFRLNERGTRWLAYASSCG
FT                   FRSDTSARIEHAIEQPMSDPHARVREVLRQHGLLDQIKRAAAATQKSAVLDESVPEPF"
FT                   /protein_id="YP_001110114.1"
FT   misc_feature    complement(48625..48996)
FT                   /note="TOPRIM_TopoIA: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in the type IA family of DNA topoisomerases (TopoIA). This
FT                   subgroup contains proteins similar to the Type I DNA
FT                   topoisomerases: E. coli...; Region: TOPRIM_TopoIA; cd01028"
FT                   /db_xref="CDD:173778"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48733..48735,48739..48741,48745..48747,
FT                   48964..48966,48973..48978))
FT                   /note="active site"
FT                   /db_xref="CDD:173778"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48703..48708,48712..48717,48736..48738,
FT                   48742..48744,48955..48957))
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173778"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48739..48741,48745..48747))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173778"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(48736..48738)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:173778"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(47659..48582)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cl11986"
FT                   /db_xref="CDD:143769"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48430..48456,48478..48513,48532..48582))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(47707..47712,47722..47724,47728..47733,
FT                   47740..47745,48166..48168,48190..48192,48202..48204,
FT                   48535..48537,48547..48549,48559..48561,48568..48573))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48445..48447,48478..48480))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(47788..47796,47827..47838,47839..47877,
FT                   47881..47925,48337..48381,48385..48390,48400..48417))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(47926..47928,47929..47985,48016..48042,
FT                   48106..48114,48115..48243,48283..48291,48298..48312,
FT                   48316..48336))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(47677..47679,47743..47745,47749..47751,
FT                   47944..47946,47956..47958,47965..47967,48037..48039,
FT                   48238..48243,48283..48285,48301..48303))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   misc_feature    complement(order(48037..48039,48166..48168,48172..48174))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Bcep1808_7349"
FT   gene            complement(49035..49904)
FT                   /db_xref="GeneID:4947742"
FT                   /locus_tag="Bcep1808_7350"
FT   CDS_pept        complement(49035..49904)
FT                   /locus_tag="Bcep1808_7350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287951"
FT                   /db_xref="GeneID:4947742"
FT                   /translation="MPTPLSKHRDLDELQLRGMIRHAAKSYPFLDASSEDAVYALARLM
FT                   VDVDYVVDRMTTPVRASLEFLRSLADERLGPGARIAERDFVFVIKMFGLKIRNKGGLLE
FT                   FLPRNEWIKEANGEKPAIEVTIDDQTQAKTVEFEISDVQKHRKIHGRRIEAAYNRLVRL
FT                   HRDTELALIFVSLVNSGQTIGEAKDELRNRFDVKDHEYNRIRERALDLGIFDRSRKRTR
FT                   TQGRITLDPDVMAFVEEEAAASQGGRMHRRTPTQMANQMLRDFHLMLKKRPLIPVPKAP
FT                   RGKSASEK"
FT                   /protein_id="YP_001110115.1"
FT   gene            complement(50250..50804)
FT                   /db_xref="GeneID:4947743"
FT                   /locus_tag="Bcep1808_7351"
FT   CDS_pept        complement(50250..50804)
FT                   /locus_tag="Bcep1808_7351"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287952"
FT                   /db_xref="GeneID:4947743"
FT                   /translation="MTGRGSFFIVHSLPSGDLMLSVVELAIIREKARTLMDRWIKPDEG
FT                   EVSIAYGAYLPQVGVSMGQAAADMKASVGHGLGFVFGDIVRTLELIDVEVRPGLSETDR
FT                   IPFAALVRAPSDVSKEMRHQKAVLGAFLRYGNLDPATNILNRPGVFAMQMFSPAMEAGE
FT                   AGRWVERINERQLKRSARWIH"
FT                   /protein_id="YP_001110116.1"
FT   gene            complement(50801..51559)
FT                   /db_xref="GeneID:4947744"
FT                   /locus_tag="Bcep1808_7352"
FT   CDS_pept        complement(50801..51559)
FT                   /locus_tag="Bcep1808_7352"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287953"
FT                   /db_xref="GeneID:4947744"
FT                   /translation="MTTTLAKFDILPQQSSAGLTLTIRLRAFDWVVPEGVRIESHIAKL
FT                   TCEDLEQTKIEIESANETNFRVIVVGGQGGALVANVEVDSPDTAPVEIKGRLGRVFESL
FT                   REGYQSAVFDAIGKLHEQRVAGGLQYVVGANAAVAATQHGQQFGPEVATARRWMSPGRL
FT                   MFAAAMLVALAMAGYGIYAKTRPSEDPIASALMSPDAQKRVNAMIGSALKQPPEGGGIL
FT                   QGQSVTLDTLKAMGLDPGKANTGCLVGVKP"
FT                   /protein_id="YP_001110117.1"
FT   gene            complement(51556..52398)
FT                   /db_xref="GeneID:4947745"
FT                   /locus_tag="Bcep1808_7353"
FT   CDS_pept        complement(51556..52398)
FT                   /locus_tag="Bcep1808_7353"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_2787 thiol:disulfide interchange
FT                   protein DsbG"
FT                   /db_xref="GI:134287954"
FT                   /db_xref="GeneID:4947745"
FT                   /translation="MKKTLFAGMAALAVTQAFADGPSVPAGVERPAFFASSDIKVLDFR
FT                   KGPGGLNVWSVERNGVQTVLYTTADNKVLMSGVLWDAKSGVNLSDAFLKPSMIQSASAQ
FT                   AAESNGAPARAKAGAPSTPIAAVAALRGIKEGSGAAEKTIYILFDPRCPHCQNVYRDTR
FT                   NFVKNGGSIKWIPTTVLGRDQMGTAMVADILQSRNPIEAMGRVESGGFRQPGKIEQSTL
FT                   DAIRDNEEYFWAAFDRNKGAGTPGVPVAFFQTSDGAPQMVANLDDRELLNRIFKDMSK"
FT                   /protein_id="YP_001110118.1"
FT   misc_feature    complement(51574..52398)
FT                   /note="disulfide isomerase/thiol-disulfide oxidase;
FT                   Provisional; Region: dsbG; PRK11657"
FT                   /db_xref="CDD:171232"
FT                   /locus_tag="Bcep1808_7353"
FT   sig_peptide     complement(52339..52398)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_7353"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(51574..52284)
FT                   /note="DsbA family, DsbC and DsbG subfamily; V-shaped
FT                   homodimeric proteins containing a redox active CXXC motif
FT                   imbedded in a TRX fold. They function as protein disulfide
FT                   isomerases and chaperones in the bacterial periplasm to
FT                   correct non-native disulfide...; Region: DsbA_DsbC_DsbG;
FT                   cd03020"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7353"
FT   misc_feature    complement(order(52159..52209,52222..52254,52258..52284))
FT                   /note="dimerization domain; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7353"
FT   misc_feature    complement(52159..52182)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7353"
FT   misc_feature    complement(order(51934..51936,51943..51945))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48569"
FT                   /locus_tag="Bcep1808_7353"
FT   gene            complement(52395..52853)
FT                   /db_xref="GeneID:4947746"
FT                   /locus_tag="Bcep1808_7354"
FT   CDS_pept        complement(52395..52853)
FT                   /locus_tag="Bcep1808_7354"
FT                   /gene_family="HOG000263340" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   eba:p2B13 TrbN protein of DNA transfer system"
FT                   /db_xref="GI:134287955"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947746"
FT                   /translation="MNYYDVEQYRPASIECVLQSAVRYQVPADVLLAIGQHEAGDEGSA
FT                   IRNGNGTFDLGRAGINTVHVEELERYGVSAATAVHYLRFDGCYNYAMAAYLLRRQLAGC
FT                   QQSYWTCVANYHSRTPRFNAIYQQKIIPLARQWAVYLREHYRVKGFER"
FT                   /protein_id="YP_001110119.1"
FT   misc_feature    complement(<52419..52814)
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:176812"
FT                   /locus_tag="Bcep1808_7354"
FT   gene            complement(52962..53312)
FT                   /db_xref="GeneID:4947747"
FT                   /locus_tag="Bcep1808_7355"
FT   CDS_pept        complement(52962..53312)
FT                   /locus_tag="Bcep1808_7355"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287956"
FT                   /db_xref="GeneID:4947747"
FT                   /translation="MIELDDKAELVLRRFGGVCLTGKDLAAIRSSVLDITQEQLANAWG
FT                   ISRTLVSRMESSSNPDERTCDQYRGLLMRAFFFKNFANGDDHDSHAARDRDGDQSVPGR
FT                   QPAGEDAAECAA"
FT                   /protein_id="YP_001110120.1"
FT   gene            complement(53309..53866)
FT                   /db_xref="GeneID:4947748"
FT                   /locus_tag="Bcep1808_7356"
FT   CDS_pept        complement(53309..53866)
FT                   /locus_tag="Bcep1808_7356"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287957"
FT                   /db_xref="GeneID:4947748"
FT                   /translation="MGFFQRTGRFAVRQASYIAGYQHIAAGWRTVRRNWDNATKRGCPS
FT                   CRKGTLYPFSEVVDAKRVDALGCDRCDYFEFAGDESNPESMAALRASADEVLSDASFRD
FT                   TRLAQLQRSSRTFFALSIFCLALSVVALCLKSSFFFTAMMVALLLFVRGAIASYRFWQL
FT                   QEDKLFVPGSLKVWIKRGAWFV"
FT                   /protein_id="YP_001110121.1"
FT   gene            complement(53871..54230)
FT                   /db_xref="GeneID:4947749"
FT                   /locus_tag="Bcep1808_7357"
FT   CDS_pept        complement(53871..54230)
FT                   /locus_tag="Bcep1808_7357"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287958"
FT                   /db_xref="GeneID:4947749"
FT                   /translation="MNVTDAAGFLAEYGARFANEEVRAWSWSDGDDECGKRASWPVGQG
FT                   ATVEAIASVDLSENQLQLTITERDVATSSEGGDTQIVFDLLLDFEEQALTVDGEVLMCS
FT                   HEAVLEAIEQFNRRA"
FT                   /protein_id="YP_001110122.1"
FT   gene            complement(54321..56888)
FT                   /db_xref="GeneID:4947750"
FT                   /locus_tag="Bcep1808_7358"
FT   CDS_pept        complement(54321..56888)
FT                   /locus_tag="Bcep1808_7358"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbu:CBU_1632 IcmO protein"
FT                   /db_xref="GI:134287959"
FT                   /db_xref="GeneID:4947750"
FT                   /translation="MTPPLLDSNKFIEYFELPVIEQIVWDKRITIDGKEIQIKDPLFDK
FT                   VLEPLKAFVLTLPGYTQEKKGKQEQKTLEQHGFITMQLTRLFGDLSFTYGYIFQTLLGE
FT                   VDMYDVVINRRILAVLLPALERAPDSLKMLGKLIVGAIKQMMAGCLGNRVEGSVREIVK
FT                   ARPTNAAVPFYVVLDEYGYYAVLGFAVAPAQARSLGFPQPLHSLVRMADGTVRKMSEMQ
FT                   VGDEILAPNGTAVRVEQVLEYKELPIARLTLESGRSVEAARVHHWPVRVMYQQLRVVTT
FT                   QEIEVLVKSGMTVELATAGGDELGWEVVTSVSTIGNQPARCLVVADEMHCYITDHDIVT
FT                   HNCITFAAQDFSSLQKASKEEADATWENTNVRCVGKITSGEKSETWERIRGVAGETLVY
FT                   ENGAKEHNADSMFKWSTNMDARVNRVRRLEYDDLAQQENGEFTFLIGKKNSQSAGGVRV
FT                   IRARTFFTQVDEAPDEIRINHFLKVEPPKSGFGEQDLERLDQLEQLLGKMIADGSLAKA
FT                   FPNEPEAMLAMKQPFYKMSTFMREAREKHSLSLPEAWRVAFVCDDQEMKVVAGAAALAA
FT                   APAPADGELLASSALAAAAPVVASSAEVGESDVAVLDEAPEEPALEFDPTEETPFESDG
FT                   TAVSASLLGLEPISLDHDVDPPNYDADKSGKIESSGGTAAGDAGSGDAGDGRDGGSSGG
FT                   GSSGGMGMALKPTPVRVEHEVSQETVSLDPKTQVTDFLDGYDFGRSDEQSADSSSGAAD
FT                   AAGAEEPQTRVSALTFRVLGQAEEPNEIQSYLADAIETTRIALGTSRDSLENKTAAQRG
FT                   VQELERVTSYVEGITPGPATLEDWDATIEDLESAADANPPNWL"
FT                   /protein_id="YP_001110123.1"
FT   gene            56942..57997
FT                   /db_xref="GeneID:4947751"
FT                   /locus_tag="Bcep1808_7359"
FT   CDS_pept        56942..57997
FT                   /locus_tag="Bcep1808_7359"
FT                   /gene_family="HOG000114767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rme:Rmet_6282 integrase, catalytic region"
FT                   /db_xref="GI:134287960"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="GeneID:4947751"
FT                   /translation="MGTHYQHLSAEERATIMILLQQGCSARGIARTLRRSPSTITREIR
FT                   RALQWPQRTAFVPAGSGGCTYDARAAGARACAMRLKRRRHPKLAEDGVLFGVVHHFLLE
FT                   GWSPSQIAGTLKRMWPDDLDRRVSHETIYNCIYAMPRGELRKELIACLRRAQAKRMPRS
FT                   RGQDRRGQLPDAVSIHLRPPEANERAFPGHWEGDLLKGAANRSAVGVLVERSSRLVLLA
FT                   KLKDATAASALEGFTAKLRSIAEPMRKTLTYDRGKEMARHPELSEATGIRVYFCDPRSP
FT                   WQRGSCENINGLLRQYLPKGTDLSVYSQEELDAIADRLNSRPRAIHGFYPPIAVYQAML
FT                   EKVTQASHSLQ"
FT                   /protein_id="YP_001110124.1"
FT   misc_feature    56942..57967
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Bcep1808_7359"
FT   misc_feature    <57686..57835
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7359"
FT   gene            complement(57969..58883)
FT                   /db_xref="GeneID:4947752"
FT                   /locus_tag="Bcep1808_7360"
FT   CDS_pept        complement(57969..58883)
FT                   /locus_tag="Bcep1808_7360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IcmO protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbu:CBU_1632 IcmO protein"
FT                   /db_xref="GI:134287961"
FT                   /db_xref="GeneID:4947752"
FT                   /translation="MAETKQRGVERSEELESSQIRPDTRPLLTKARSYFSTTDGVVAAM
FT                   LWLQGIALLTVFVPMSGELVVVASWLFYQLYVNPGHNDPKRKVPGTNRIAGKFRIYDFP
FT                   YRVPFSAKRFDGSYAVPRLGNGITYLGKEISSKLEIWSSDSDLRTHMLVLGTTGSGKTE
FT                   LLLGLVFNALVQNSGFIYTDGKGDVALWNNVFRLARYLGRECDLLLINFLTSGRDFLDK
FT                   QVDRTTNTMNPFALGSSGMLIELIISLMDDSGGGGDMWKGRAIAFVAGLTRVLCFLRDR
FT                   GYILAVSSTKCNGGITEGSGWLG"
FT                   /protein_id="YP_001110125.1"
FT   misc_feature    complement(<58353..>58622)
FT                   /note="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins [Cell division and chromosome partitioning];
FT                   Region: FtsK; COG1674"
FT                   /db_xref="CDD:31860"
FT                   /locus_tag="Bcep1808_7360"
FT   misc_feature    complement(<58251..>58436)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7360"
FT   gene            complement(58896..61997)
FT                   /db_xref="GeneID:4947753"
FT                   /locus_tag="Bcep1808_7361"
FT   CDS_pept        complement(58896..61997)
FT                   /locus_tag="Bcep1808_7361"
FT                   /gene_family="HOG000263341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IcmB protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbu:CBU_1622 IcmB protein"
FT                   /db_xref="GI:134287962"
FT                   /db_xref="GeneID:4947753"
FT                   /translation="MGMRAAFAETLDSVASSLMGLLKFHINDYCDLETTHGNALVARDG
FT                   SMGTILRYDGFRSLLGQSEFKSMADELANSMEHFFSSRGHQMQVVFMREQDPDDEVMRY
FT                   LQPMYETAETIHMNISDVLDEKREVHRRLCMDEKVYFVLWTRPTVLDPTEVKIGREEAR
FT                   EFATRYKTPSLRSAQDIFRPNRFLIDRHESFVEKVVDDMLRLRCSVGVVPIHAAFCEMK
FT                   RYFFRTTPIAWKPVLIGDPVMVRWKNNRKLRDASELLYPRLDDQLFNAPAVNGNSKKVG
FT                   GLSDTGAVRIGNRVFSPVVMKLGPNRPKPFADLFRAMNKATTTDQNGKISSVPWSISFN
FT                   IEGDGLSTIMLRKIFATLLGKLSSDNSNLSASARVLERYRENNNQSVVKFQATMVTWAD
FT                   HGDERQLMMRRSKMVRAFEGWGNVVPQEERGDALAVLVGAAPGVTLQSVAPAAAPPLHD
FT                   VAYMLPLTRPGSPFPRGSSLFRSLDGKPLPYEIFSSEQNTWLTLLFGGPGNGKSVLANR
FT                   LNLEMCLLPGLKRLPYIGVIDIGISSTGFISLVKDSLPEHLKHLAVYVRLQNREDYGIN
FT                   QFDTQLGMRFPLPREREQMKNFLVALATPANRGKPHDYMDDFAGRVIDLAFRKRSDQDD
FT                   RGEPTKFVPNINRELRKKIDEAGIEYVEDVTTWWEISDKLFELGMVYEASVAQRYAVPT
FT                   LSTIVEAASDPKLASEFVANAKQTSVVSVVDEFNLMIRSAIGDFPVFRGVTQFDVGESR
FT                   ILAIDLQDVVQTGSDGAKKKASLMYMVALNVIMRRISIIKEDLDDPNMPALYRRYHATR
FT                   VDQLAEDFKRLFVDEYHKTGDNPNLREAFLIFGRESRKWLLEIMLASQLPDDFRELAQI
FT                   ATSVIILDQGNEQTRRKIAEIFGLSPVEVAALKTYVNGPEPGVGATFLAKIKTKGGEMS
FT                   QLFTASSGGTELWGLSTTGEDRKLRSMLYDVMPGPEARAMLKGMFPSGSCKKFVDAEKA
FT                   RTKDERGASFIEEDAENTVIETTAKRLIADWKRKAAQVSEEALN"
FT                   /protein_id="YP_001110126.1"
FT   gene            complement(62198..63415)
FT                   /db_xref="GeneID:4947754"
FT                   /locus_tag="Bcep1808_7362"
FT   CDS_pept        complement(62198..63415)
FT                   /locus_tag="Bcep1808_7362"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0163 hypothetical protein"
FT                   /db_xref="GI:134287963"
FT                   /db_xref="GeneID:4947754"
FT                   /translation="MQYGVVLFDDEVRKSSTNKKRVASGASVSIDGAPSRRIVSVSELE
FT                   SNVKWLTNFGFTDFNANGLGRNPNFYFSGFLRTELKAIAEEIGAGDEQLSADNAAEVLS
FT                   GLFGRVMRIATSTLNVDLKTTSISTKGLAEFIAARVVNKNKIPDEINTALLHAYQTYTS
FT                   VMTRVPREWKKVVLRRPRYLHALDVLSTPVPSEHQWVYVQNARLPADNSDRIDWCLGNE
FT                   LPVLANVTVKPRRGEYANLISYNAGAANARSWVCQPELMMLAQFCDVEVIGAFVCEAGF
FT                   EPQKEIETFPDFGDFSLASYSLGLIAENFWVSMASPRTSPTNQKFIPPRAVWYRAIDRL
FT                   SMFMHAVKLQRERYQVFAYGIGNATVYYPPGATKDVVDFAIHEGLDIPAATYAEIKTEL
FT                   RLNADE"
FT                   /protein_id="YP_001110127.1"
FT   gene            complement(63418..64242)
FT                   /db_xref="GeneID:4947755"
FT                   /locus_tag="Bcep1808_7363"
FT   CDS_pept        complement(63418..64242)
FT                   /locus_tag="Bcep1808_7363"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0164 putative IcmJ-like type IV
FT                   secretion system protein"
FT                   /db_xref="GI:134287964"
FT                   /db_xref="GeneID:4947755"
FT                   /translation="MLKRVLPELVISAKRKVWRMNDHAGEDADKAFQQVRRAILDACGN
FT                   ECAFCQHTSSKYQEVHHADDDHTNNSRENLFGTCPLCHQVFHLGLAAIRDGGQIIYMPE
FT                   MSQAELNQLVMLIWIIDSTQELVKAGPSPFKDAGERQLFERVHSAATKLRGYLVNRRAP
FT                   VLMRIGGYVKENNALDFEPTLSQITPSLFANVLMQLDEETFAKRGQALGGLRLLPQPER
FT                   FGERIKHWRDEANKILPVWRWTKILPEESIRELVLDSVKRVDEANARLANPE"
FT                   /protein_id="YP_001110128.1"
FT   gene            complement(64260..64688)
FT                   /db_xref="GeneID:4947756"
FT                   /locus_tag="Bcep1808_7364"
FT   CDS_pept        complement(64260..64688)
FT                   /locus_tag="Bcep1808_7364"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287965"
FT                   /db_xref="GeneID:4947756"
FT                   /translation="MCSICFCFKCYHSLRRTKLKNPLDLQYKVAAALTVAMLSTVARAD
FT                   QQFDLNNISGTSGAGSADFTAWANKIKGYLQSGVNLVLLFFAAAGIVLCGTSIKKVYDA
FT                   NKDNREPPKVAIIGIIVGAALTIVTVIIGIIRNSATPG"
FT                   /protein_id="YP_001110129.1"
FT   sig_peptide     complement(64554..64688)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.961 at
FT                   residue 45"
FT                   /locus_tag="Bcep1808_7364"
FT                   /product="hypothetical protein"
FT   gene            complement(64663..65229)
FT                   /db_xref="GeneID:4947757"
FT                   /locus_tag="Bcep1808_7365"
FT   CDS_pept        complement(64663..65229)
FT                   /locus_tag="Bcep1808_7365"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287966"
FT                   /db_xref="GeneID:4947757"
FT                   /translation="MDSTSSTGLLNLLTLVAGAAPALLALVLAFFAVAGVIMVGTAVKG
FT                   FYDLTAYGNYGHGGYQHRTHGGLMWRLFIGSVLTSLPVAIGVLGNSVFGTEVATGLMAY
FT                   QTGGMSAVQRAALDGIFKVFAIMGVMSFGHGWVVLNAHKSGTSNVSPRTPLVWIGAGLG
FT                   LIYLPQVLKVISWATGIDVLNLLLF"
FT                   /protein_id="YP_001110130.1"
FT   sig_peptide     complement(65125..65229)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.921 at
FT                   residue 35"
FT                   /locus_tag="Bcep1808_7365"
FT                   /product="hypothetical protein"
FT   gene            complement(65251..66423)
FT                   /db_xref="GeneID:4947758"
FT                   /locus_tag="Bcep1808_7366"
FT   CDS_pept        complement(65251..66423)
FT                   /locus_tag="Bcep1808_7366"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cjk:jk0177 putative Fe-S oxidoreductase"
FT                   /db_xref="GI:134287967"
FT                   /db_xref="GeneID:4947758"
FT                   /translation="MNDAIDTIRFSEDSDHDDERDPEDLARAQPTGGGPAKPHKPFPLM
FT                   KLMGGIGAVSVVLVVGAVGLAKVLQQPKQSQDQFGSVPQPQMGAGASVPPPLAQIGAPC
FT                   APNGLIAQAATGRAFCMSGVWAQENSPGTLTPQGQAPLPQGQYAQQAASSMPPQGQQIA
FT                   ATVPNAPVGSQFASTQQQAGNEANPIGPVPHRAGPSDAAQPAQTGGASGQQAAANTAAV
FT                   DHAPQAASADVATQLAAMQATIAELQKQLAGRGARPVVKSAVHVKKEAQKAAPVQAATG
FT                   EDAEQGDGEATTATVTHREKVTRAKPHAKKTASSGDKGKPDTSYVVTGMIGTRAFITKK
FT                   GGNDVNPDSTVAVGDTLDDGRKVLSVDPKTKRVWLSGNQYISTGNAGGDE"
FT                   /protein_id="YP_001110131.1"
FT   misc_feature    complement(<65845..>66213)
FT                   /note="Topoisomerase II-associated protein PAT1; Region:
FT                   PAT1; pfam09770"
FT                   /db_xref="CDD:150441"
FT                   /locus_tag="Bcep1808_7366"
FT   gene            complement(66475..67878)
FT                   /db_xref="GeneID:4947759"
FT                   /locus_tag="Bcep1808_7367"
FT   CDS_pept        complement(66475..67878)
FT                   /locus_tag="Bcep1808_7367"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_B0061 TraO protein"
FT                   /db_xref="GI:134287968"
FT                   /db_xref="GeneID:4947759"
FT                   /translation="MATDNSTVFDPAKQRQAEAATRDLKRNNINQVFGQGKGRIAAMAV
FT                   GGTFVVLAIVGSCTLMGGGPSAPQAAAPMGAVPNANGMQGDPMVTTAREAALRRQANQE
FT                   GASEAQANKQPYIATPVLAASSTQTVGGGDWGGFGAGEPVTASQPAAKQPDPNSANLNA
FT                   NATSNNGSNAANAPRPLNDVRTIAMALGASDGDVTSQIDHVLGVQPRNNQQGQQGGSGR
FT                   RSFTTGYYPVVAQQVSGQVPAQQGSAPQSIFPGAQPQPTATTAANQSQRRTIPNWEMGD
FT                   AGYCRIQYAVNSDLQRKDVFAKCFGGPWDGAIFNGKAEPSPEGVADPGFVVTLSSARVP
FT                   GYGTLPVQAVAFTNDTLEAGVQDSVNSHAFVKFSELAIAGLLKGVGQAAQLVTGTSSTQ
FT                   TIGNVSTTSLSVQRPDLAQIAESAAGGVGQSIGDFVQRRSDALKTTIKIYPGKDIGIVL
FT                   LSDVVNQKQ"
FT                   /protein_id="YP_001110132.1"
FT   misc_feature    complement(66490..>66807)
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:174812"
FT                   /locus_tag="Bcep1808_7367"
FT   gene            complement(67889..68890)
FT                   /db_xref="GeneID:4947760"
FT                   /locus_tag="Bcep1808_7368"
FT   CDS_pept        complement(67889..68890)
FT                   /locus_tag="Bcep1808_7368"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative IcmK-like type IV secretion system
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0169 putative IcmK-like type IV
FT                   secretion system protein"
FT                   /db_xref="GI:134287969"
FT                   /db_xref="GeneID:4947760"
FT                   /translation="MKKKLFLASLALIAVAAGQSSGSLAAGQGTTVQAQQPAADPKAPA
FT                   VIAPNMDDATPPIPVTKDVIQRLVDDRNARVLTPKQIDSVRRTVDAARRAGVSPYPGGM
FT                   IAEPRSRQIPWRPDVVKRPETIEMWQGTLSTFVFTDMSGNAWNIKSVSFDCTLFDDGRS
FT                   CDGGTSAQGKAGATDATNMVSLQANSPYSYGNVVIRLDGLPTPIIFVLRTGKSAKTDMA
FT                   IDVRVEARNPSAPPQLISSTSLPAFDDRMDGFLSGVPPQGASQMKVAGGQAEAWMLNGS
FT                   LYVRTRLSLLSPAFTDRVGSAEGISVYKYPRFVPSLLASVNGVPTSLLVSGN"
FT                   /protein_id="YP_001110133.1"
FT   sig_peptide     complement(68813..68890)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7368"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(67895..68665)
FT                   /note="Protein of unknown function (DUF3625); Region:
FT                   DUF3625; pfam12293"
FT                   /db_xref="CDD:152728"
FT                   /locus_tag="Bcep1808_7368"
FT   gene            complement(68900..69607)
FT                   /db_xref="GeneID:4947761"
FT                   /locus_tag="Bcep1808_7369"
FT   CDS_pept        complement(68900..69607)
FT                   /locus_tag="Bcep1808_7369"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lpp:lpp0515 hypothetical protein"
FT                   /db_xref="GI:134287970"
FT                   /db_xref="GeneID:4947761"
FT                   /translation="MTAQTTTQKQASAPGQGGTQVVDLVIENARLREEAKKSESKHSIN
FT                   YLAIIVGESVAIAFLLWLTFFYYPLQKYVPTQNAAAICVFEPIDKPNVNAAQIVDYAKD
FT                   AVVTIYSTDYANYKRTITNAADKFMVPEFRSPFMQTISNSDFLKALVSNQFTVTAITTP
FT                   NQPPQVVREGVLNGAYAWKVQVPLTFYYTSGRQQHDDRVVAEVTVTRTDPTKIRLNPSA
FT                   IGVSWIDLKTAVN"
FT                   /protein_id="YP_001110134.1"
FT   misc_feature    complement(69041..69373)
FT                   /note="Macrophage killing protein with similarity to
FT                   conjugation protein; Region: IcmL; pfam11393"
FT                   /db_xref="CDD:151833"
FT                   /locus_tag="Bcep1808_7369"
FT   gene            complement(69604..69882)
FT                   /db_xref="GeneID:4947762"
FT                   /locus_tag="Bcep1808_7370"
FT   CDS_pept        complement(69604..69882)
FT                   /locus_tag="Bcep1808_7370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287971"
FT                   /db_xref="GeneID:4947762"
FT                   /translation="MSDDRQVSARRAPIQPTTWGNPRQNRTPRFNQQMLGLLRRLNKWL
FT                   GPIALFEFLIIVALILTLAFGTQFARLFASDGSMYSCEIPLVAAHRK"
FT                   /protein_id="YP_001110135.1"
FT   gene            complement(69879..70478)
FT                   /db_xref="GeneID:4947763"
FT                   /locus_tag="Bcep1808_7371"
FT   CDS_pept        complement(69879..70478)
FT                   /locus_tag="Bcep1808_7371"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287972"
FT                   /db_xref="GeneID:4947763"
FT                   /translation="MSGSERGAVERMGAGAHTVLRVLEKKAYFKHRFLEQVQALYQADS
FT                   EHSLPTLPASLYLTALFARVPEEVRSKVAEIASRRIVNTFEHCPTPVETRTLVAEATLA
FT                   ALGLSFDQLAERAKLFMACPPTEQAVADRWIEQVIYTVMIHIGRDRFVAISHSEWKDEV
FT                   SQTILGDAEALRSYQVPLANQVTIVRKSFRELLPKV"
FT                   /protein_id="YP_001110136.1"
FT   gene            complement(71003..71263)
FT                   /db_xref="GeneID:4947764"
FT                   /locus_tag="Bcep1808_7372"
FT   CDS_pept        complement(71003..71263)
FT                   /locus_tag="Bcep1808_7372"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287973"
FT                   /db_xref="GeneID:4947764"
FT                   /translation="MVSQRRNCELAIVGLLRIASFHSVPHAFRTGANAATHETSVPNSE
FT                   RNTATTMPLRTGRRAELGKHCATIPVVHLRAAALRAEVGNG"
FT                   /protein_id="YP_001110137.1"
FT   gene            71477..72703
FT                   /db_xref="GeneID:4947765"
FT                   /locus_tag="Bcep1808_7373"
FT   CDS_pept        71477..72703
FT                   /locus_tag="Bcep1808_7373"
FT                   /gene_family="HOG000229202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   eba:p2A292 partitioning protein, ParA"
FT                   /db_xref="GI:134287974"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:4947765"
FT                   /translation="MTANDLLTSTAPAIDPSVSIADIRDGIAPHALDFLDLVRSTLLEP
FT                   YPRKLPPTYTAANIATLCGIDKKRMPYLTTKLALPTGTQTGAGRAKIFTLEEAIVWVQA
FT                   TSNRVQRRAGSRGRVVAFANYKGGVAKTTTSISIAQKLTLMGRKVLLIDCDPQGSATQL
FT                   CGYAPDAEIGYNDTILPLIDGEESTLHYAVHDTYWKNLHLIPSCNAVQEAEFGVPAQLL
FT                   TNSRFEFWDILNKGIRPLLDDFDVVVIDTPPALSYITTNVLMAADAIVMPLPPEALDFA
FT                   SSTQFWQMFAEIAARLPKVMESKRYDFINIFMTKVRSTEASKGVQGWIRKAYGDLVFPH
FT                   FVPESKVQAAALGALSTIYDQRRIDVDSDGDAPRMSGEQYERLREPHDALAEHIDNQFS
FT                   QIWAREAAE"
FT                   /protein_id="YP_001110138.1"
FT   misc_feature    71579..72688
FT                   /note="plasmid partitioning protein RepA; Region:
FT                   partition_RepA; TIGR03453"
FT                   /db_xref="CDD:163271"
FT                   /locus_tag="Bcep1808_7373"
FT   misc_feature    71831..>71947
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7373"
FT   misc_feature    71852..71872
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7373"
FT   misc_feature    71870..71872
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7373"
FT   misc_feature    <72179..72376
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7373"
FT   misc_feature    72224..72226
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Bcep1808_7373"
FT   gene            72700..73749
FT                   /db_xref="GeneID:4947766"
FT                   /locus_tag="Bcep1808_7374"
FT   CDS_pept        72700..73749
FT                   /locus_tag="Bcep1808_7374"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB, partition protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p2A290 ParB, partition protein"
FT                   /db_xref="GI:134287975"
FT                   /db_xref="GeneID:4947766"
FT                   /translation="MTKKGSLLDRTAQLEVGDRPERPAGGARGPLSAPGRMFDLTQRIN
FT                   DAEDRATAAVAEAETAKQQLEEARRTIEALERNGSAAGAMEIDISTLVEVPGRRRVLSP
FT                   AEYNELRDNLAKNPLVHPIVYRSLGNGKNEIISGGNRVAIYRDDLGRTKILGVPFTGDA
FT                   KAAEMGATFANLLAPSLPDFEKFRQFERLQHESGFTRSDIIEASGLTKQHVARILSFEK
FT                   LPQAARDAISKRPDRVGGHAAEDFAQLAANGNAEAVVKAIEALVADESLTQKRALELAK
FT                   PKAAPKTPQVAARTISIGRKKFCDVSVRSGTVGLRFAGKGADADANAQTWADKIEAFIR
FT                   RELEAQGGE"
FT                   /protein_id="YP_001110139.1"
FT   misc_feature    72952..>73506
FT                   /note="Stage 0 sporulation protein J (antagonist of Soj)
FT                   containing ParB-like nuclease domain [Transcription];
FT                   Region: Spo0J; COG1475"
FT                   /db_xref="CDD:31664"
FT                   /locus_tag="Bcep1808_7374"
FT   misc_feature    72952..>73161
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Bcep1808_7374"
FT   gene            74066..75358
FT                   /db_xref="GeneID:4947767"
FT                   /locus_tag="Bcep1808_7375"
FT   CDS_pept        74066..75358
FT                   /locus_tag="Bcep1808_7375"
FT                   /gene_family="HOG000263342" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6317 hypothetical protein"
FT                   /db_xref="GI:134287976"
FT                   /db_xref="GeneID:4947767"
FT                   /translation="MSIAQHSVAGEGEAHPLDSESNALNAQLEELELGRNLPYATLRAH
FT                   QRALNLTTLSKRARAALASIALVVDARKPLNSVFARRSYLSRRAGLSERTWYRAEQDLV
FT                   DAGLVTVSEQIRKPRGGLFGAAYIHLSEQAARALGLIATKKPAIEAPAAQADATAGTED
FT                   SSLPAQPTAKVSDRFTYKDYQYPPTQRRQPGQLPEDVQPLLAVGFRKYFIFWLMGIARR
FT                   NHGKQLGHVVTACWETIKKARNPIAYVFALLRSATDFAWLAKQRHAAKIEAQDVAERHA
FT                   AAEAERERIAGKRFVAVDGSKRFEVSADGSSLTVECVVEHAVRTAGGYWIDDFVVALHA
FT                   GKIRLAVSADHAAFEKARDANLQAQLIEQMRQAQLARDAAAAITGAVSAVRRQSADLPP
FT                   TECSWKLSGLGHTTLGGLRTLLAKAPRSVAA"
FT                   /protein_id="YP_001110140.1"
FT   gene            complement(75529..76050)
FT                   /db_xref="GeneID:4947768"
FT                   /locus_tag="Bcep1808_7376"
FT   CDS_pept        complement(75529..76050)
FT                   /locus_tag="Bcep1808_7376"
FT                   /gene_family="HOG000273967" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: xcv:XCVd0044 putative secreted protein"
FT                   /db_xref="GI:134287977"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="GeneID:4947768"
FT                   /translation="MLIPQIGHATDNDFWVRDRELWVRRARPRRELEEFRVVYWSGGRF
FT                   DANNYVRLCYLFRDSNEDVVAEIDPRLFHLLFGLQRWVQLETGRLLPIDLTSGYRTPEH
FT                   NSMLIAEGASPTSEHLNGRAADIKIPGVQPGAVVSMARFFEMGGVGIYNSFTHVDVGRV
FT                   RAFTGRRPRR"
FT                   /protein_id="YP_001110141.1"
FT   misc_feature    complement(75556..75954)
FT                   /note="Peptidase M15; Region: Peptidase_M15_3; cl01194"
FT                   /db_xref="CDD:120464"
FT                   /locus_tag="Bcep1808_7376"
FT   gene            complement(76098..77489)
FT                   /db_xref="GeneID:4947769"
FT                   /locus_tag="Bcep1808_7377"
FT   CDS_pept        complement(76098..77489)
FT                   /locus_tag="Bcep1808_7377"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppd:Ppro_0271 TrfA family protein"
FT                   /db_xref="GI:134287978"
FT                   /db_xref="GeneID:4947769"
FT                   /translation="MTDASDYVLVNGAQVPIDKSEHTPLIQQTANDLNCSVEEAWEHVK
FT                   HAVVRLLMENPRAARKGGRKETANAVDVQPAVVSPAPKPVTDTRPRMPRIEVEIDQRVL
FT                   HLNGAPANAIRELDRGELGLGHEESVVEAITSGKIKLADEHPDVSILRAASPRFIEFGA
FT                   VSESRRAAMETIHQRQYRFPFHSDTVRIMATDLNKTSLFHVASNNTARRFCRDEPLGRI
FT                   GETVSAVYRGEELRHDDELVLMQLMQVARGKYPYEWFSIFSVPFFKGSRGVTRRASSKD
FT                   IDSVMESLARMRGGYLVVKSRSNYITVNLIKDLAGSGSNHHVQIDPALIILYSSFTALD
FT                   TDHLFKTSGVARQLLKYISTIPSAYEDTRPIKITSLFELCYGTLDSLERHYRETNPGKT
FT                   DAQVRIAMSKKLSDFRRKNLPAGLDNLKEMNIIRSYKLDESTDKVVINRNPDASPVRVL
FT                   AGPSA"
FT                   /protein_id="YP_001110142.1"
FT   misc_feature    complement(76311..77000)
FT                   /note="Replication initiator protein A; Region: RPA;
FT                   cl02339"
FT                   /db_xref="CDD:154863"
FT                   /locus_tag="Bcep1808_7377"
FT   gene            77606..78397
FT                   /db_xref="GeneID:4947770"
FT                   /locus_tag="Bcep1808_7378"
FT   CDS_pept        77606..78397
FT                   /locus_tag="Bcep1808_7378"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287979"
FT                   /db_xref="GeneID:4947770"
FT                   /translation="MDEKRPLSRRQLRNIQLARGIPALEFQHRTGMPRASYEALLGASS
FT                   GEEGKDAAKLISRQTFDRVVSLLGIDEEFTSLRRKGVIEWRAEGTSKVTAASWREAVES
FT                   LVSELFSDDLLLVEVRTEGAKRFGRGSERMVLLHDRVNEFRIAIMNAADDLVGLLEKAF
FT                   GTTCERRVTISAPEFHDAREMISHEVFRSVQFDAISGAIAPKYSWRDVQAGAREFGFLP
FT                   DDLIEMMHQRAQERAQRGSVGPASGGEEEYAVRRLQLVTTA"
FT                   /protein_id="YP_001110143.1"
FT   gene            78541..79179
FT                   /db_xref="GeneID:4947771"
FT                   /locus_tag="Bcep1808_7379"
FT   CDS_pept        78541..79179
FT                   /locus_tag="Bcep1808_7379"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p1B120 hypothetical protein"
FT                   /db_xref="GI:134287980"
FT                   /db_xref="GeneID:4947771"
FT                   /translation="MTRQFSADEMRAVIRAKGWSHTELARHWDISTVYLSRLINNDQRR
FT                   IHWNDAVEGLPPYKLCAQHLAMRHARAAALLDEPQPRKRGPRPGSVRSSGYDDGEERWP
FT                   EAGQTTVPSTGYRYRGYIVAGSILTATQEIGEMAQEGERGIVFAVEDVGIGERYGVIFE
FT                   RGLWDWFLAHHVDACLAETGLDAEGFDGFVYDGDFGLKNAYDSGRFNFW"
FT                   /protein_id="YP_001110144.1"
FT   gene            complement(79249..79608)
FT                   /db_xref="GeneID:4947772"
FT                   /locus_tag="Bcep1808_7380"
FT   CDS_pept        complement(79249..79608)
FT                   /locus_tag="Bcep1808_7380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287981"
FT                   /db_xref="GeneID:4947772"
FT                   /translation="MNPLTYRCASTGFSVDEVPTEAVWIDGDDHESLDAVRMRCATTAA
FT                   RFIEVARAAGLVTAQEIARGDVWVTVDRSDFDERGDVNVETRIDIFAFEPLERSRAGGP
FT                   SFVPVRGLDILDDER"
FT                   /protein_id="YP_001110145.1"
FT   gene            complement(79912..80181)
FT                   /db_xref="GeneID:4947773"
FT                   /locus_tag="Bcep1808_7381"
FT   CDS_pept        complement(79912..80181)
FT                   /locus_tag="Bcep1808_7381"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287982"
FT                   /db_xref="GeneID:4947773"
FT                   /translation="MDELDPKTIRDGAVQCAVDALRQELDAQMAVAPLDQRSTRDELVA
FT                   WVKGFNRDRARMIEIIERRNPWAAKFATGIPDFWDRVERRLGID"
FT                   /protein_id="YP_001110146.1"
FT   gene            complement(80183..81175)
FT                   /db_xref="GeneID:4947774"
FT                   /locus_tag="Bcep1808_7382"
FT   CDS_pept        complement(80183..81175)
FT                   /locus_tag="Bcep1808_7382"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0004 hypothetical protein"
FT                   /db_xref="GI:134287983"
FT                   /db_xref="GeneID:4947774"
FT                   /translation="MEPFASFTPTISDKTKIEYEQCYERNRKRFMSDLGKPDMAPDEVV
FT                   AHLILTRTEYAARTWRFYKSSAIYYLETYHPHHETAIDELKRHGSGDLRNGGSNTSGRK
FT                   RKDVPDSVWNEIKHAIQERIKQQYKHAATLLAVLEGTLLTGLRPNEWAFSELGQHEADG
FT                   RRVLRVRNSKHTNGRGNGTHREMYVDELEVREIEVIARALAACKSESAEEATRLQLALK
FT                   HELEAARALAVAGKRRARSSVTLYSFRHQFVANAKLTFENPVITAALSGHSSTKTAHQH
FT                   YGKRRNGRAMVRVYPTESSVAAVQNRYLETYRDFVARRGANITHSPSSH"
FT                   /protein_id="YP_001110147.1"
FT   misc_feature    complement(80324..80833)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7382"
FT   misc_feature    complement(order(80330..80332,80438..80443,80657..80659,
FT                   80732..80737))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7382"
FT   misc_feature    complement(order(80330..80332,80360..80362,80429..80431,
FT                   80438..80440,80657..80659,80735..80737))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7382"
FT   misc_feature    complement(order(80330..80332,80360..80362,80429..80431,
FT                   80438..80440,80735..80737))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7382"
FT   misc_feature    complement(order(80330..80332,80429..80431,80735..80737))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Bcep1808_7382"
FT   gene            complement(81324..81701)
FT                   /db_xref="GeneID:4947775"
FT                   /locus_tag="Bcep1808_7383"
FT   CDS_pept        complement(81324..81701)
FT                   /locus_tag="Bcep1808_7383"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287984"
FT                   /db_xref="GeneID:4947775"
FT                   /translation="MSAHRKRVDDIGAKRVGKFLRSAQIFAPVQRGTTAQISLARRTTP
FT                   MLRNESRTYIGSITNICEILWCQQYLTGCAAAGRSLFMVPLPDALFVNRRGLQRYQSAR
FT                   VMTPVTNRTKCCVVEHGRDCL"
FT                   /protein_id="YP_001110148.1"
FT   gene            81926..82417
FT                   /db_xref="GeneID:4947776"
FT                   /locus_tag="Bcep1808_7384"
FT   CDS_pept        81926..82417
FT                   /locus_tag="Bcep1808_7384"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287985"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947776"
FT                   /translation="MTKRASGPACRARALAVVAALAALSGCAVQPPAPTTEEQRRLDVL
FT                   TRLDQATALAVNAQRELAMTADASVQRQATERTRLLTDKVSYDFYGDVEELLADIASKY
FT                   GYAFKVFGKRPPDRVNVNVYVKKMPVLEVLRYVGNTASSWLDVAVKPGVIELTYKPSNT
FT                   "
FT                   /protein_id="YP_001110149.1"
FT   sig_peptide     81926..82012
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.697 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_7384"
FT                   /product="hypothetical protein"
FT   gene            82428..83270
FT                   /db_xref="GeneID:4947777"
FT                   /locus_tag="Bcep1808_7385"
FT   CDS_pept        82428..83270
FT                   /locus_tag="Bcep1808_7385"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DotC protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbu:CBU_1644 DotC protein"
FT                   /db_xref="GI:134287986"
FT                   /db_xref="GeneID:4947777"
FT                   /translation="MPIDAVSLEALQNYSQPAAEQRVVAGAGSGDLGNFRLNALRDAAF
FT                   GLGARGGLIAESRLINQALSTQARKLDVTWDFTPMMIQGRVLPPVLNRVDDIYAQPGDQ
FT                   VIRIARTKWAFQAQARFTSRPPTWREYLMNDPGPLAPPSSVLYPRDGAERQIWQQAVAE
FT                   GWSNGVKQADDIFQLNLNRLTRDYTGMKNYRVLAYKHMVTMPIVAQMDMPLNTTGQSMS
FT                   VDETLLRLTVLPEFNTNMKDWQALGSEVDRLQQPVPANGASADGLPSQADLAQPDEVQ"
FT                   /protein_id="YP_001110150.1"
FT   gene            83271..84458
FT                   /db_xref="GeneID:4947778"
FT                   /locus_tag="Bcep1808_7386"
FT   CDS_pept        83271..84458
FT                   /locus_tag="Bcep1808_7386"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cbu:CBU_1645 DotB protein"
FT                   /db_xref="GI:134287987"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4947778"
FT                   /translation="MVFRSKDGVPDRLTDFREPDMFRDGRHLQELMLEIVALNASETII
FT                   QPGEQVLVEIGGRLRPITERRMTIEEVKSFANWAADNDKAAAELIQRREVKASYVVKDP
FT                   VARDARGERKATRFRVAAGRGELRGTMAVQIVMRRINSEPAYMNDSELPPEVVEALTPK
FT                   DGVIWVTGPTGSGKSTFFSGIVRYVLENDTPIKGNIVLLEEPIEQVYDSIECDHSVVFQ
FT                   IEVGKDVDTWEAGIEQLMRRLPRFIIIGETRSRPTVDAVLQAAVTGHPVGTTLHANDVP
FT                   GIFPRLLSFFSDEAKEAALYSAISTARVMFNQVRVPKLGGGMTVLREYLVVDADLRADL
FT                   QRRATPAKIEAQMREALESQGFPMWKAAEQAHARGMISADLMRFYQSQATGANRG"
FT                   /protein_id="YP_001110151.1"
FT   misc_feature    83352..84410
FT                   /note="Tfp pilus assembly protein, pilus retraction ATPase
FT                   PilT [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]; Region: PilT; COG2805"
FT                   /db_xref="CDD:32636"
FT                   /locus_tag="Bcep1808_7386"
FT   misc_feature    83760..84344
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7386"
FT   misc_feature    order(83781..83786,83796..83804)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7386"
FT   misc_feature    order(83784..83786,83796..83804,83871..83873,83877..83882,
FT                   84018..84023)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7386"
FT   misc_feature    84006..84020
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7386"
FT   gene            84723..85784
FT                   /db_xref="GeneID:4947779"
FT                   /locus_tag="Bcep1808_7387"
FT   CDS_pept        84723..85784
FT                   /locus_tag="Bcep1808_7387"
FT                   /gene_family="HOG000263343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="StbA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: StbA family protein; KEGG: noc:Noc_0623
FT                   hypothetical protein"
FT                   /db_xref="GI:134287988"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="GeneID:4947779"
FT                   /translation="MTKNAAVSEEVGNVVHLQPEGEVRFAGTDDGHDGIKIVTDDWRQI
FT                   HVPSRITRGADLISLNDADDNVYEGPDGTLYAVSPTLPYFDTTFSDYALSDINLVLVHH
FT                   ALAKAGLGGQRVNLVTGLPVGDYYVANRPNVDFISRKVAHLRENTVRNKNESVALATIV
FT                   KHNVVSEAIAAFFDLLLDREGNQRDDVAEMVATGGIAIVDIGGKTTDTAVVMNGGRDVD
FT                   GKRSGTDPIGGLSLNKAVENELKAEFSVTALNPAQVDRAVREGVLRLYGKDHDCRAIID
FT                   KQKSELAKQIIAATHRKMRDASDLERVFFVGGGALLLCDQLEELYQHAEFVEDPQFANA
FT                   RGMLKAAMFLQPR"
FT                   /protein_id="YP_001110152.1"
FT   misc_feature    84936..85760
FT                   /note="StbA protein; Region: StbA; pfam06406"
FT                   /db_xref="CDD:115086"
FT                   /locus_tag="Bcep1808_7387"
FT   gene            85798..86367
FT                   /db_xref="GeneID:4947780"
FT                   /locus_tag="Bcep1808_7388"
FT   CDS_pept        85798..86367
FT                   /locus_tag="Bcep1808_7388"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134287989"
FT                   /db_xref="GeneID:4947780"
FT                   /translation="MSETDTTLRFVVPLDLARPEDRALFDAFQAVSNGLNGSVARLLMQ
FT                   RSLPKHADGIDALLIEAVRDQAARKRLRGRPVGSGSRRPASASAEVPPAQAVSRAAVVP
FT                   VAIESMVAAPVAPSHVTDMADAAAVNRATPEPVVASTVEVERVAPTVVRGDEKTAGGER
FT                   AAAKEPVSGPKKGDVKANIGGLVAWN"
FT                   /protein_id="YP_001110153.1"
FT   gene            86560..87216
FT                   /db_xref="GeneID:4947781"
FT                   /locus_tag="Bcep1808_7389"
FT   CDS_pept        86560..87216
FT                   /locus_tag="Bcep1808_7389"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0011 putative PilL-like lipoprotein"
FT                   /db_xref="GI:134287990"
FT                   /db_xref="GeneID:4947781"
FT                   /translation="MAAAAATAAAVPAATVSTTTLGVPSDAWGEKIDGFGRNQPARQAL
FT                   THLVPSGGKLIVNTAISPTARVSWKGNDSRLAIARKILADAGIDGRFDGDNLIIGAAPA
FT                   LVAAPVVAPQDPAVESRLWTMAKGVMLSDGLADWMEQTAAPSERYRWTLDWAAFDGVNG
FT                   ERRIDYRIVAPLRFNGTIDQAVAQLIMLYKKSTKPLEVKINKDQRLIHIKLRGAN"
FT                   /protein_id="YP_001110154.1"
FT   sig_peptide     86560..86628
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.808 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7389"
FT                   /product="hypothetical protein"
FT   gene            87255..88946
FT                   /db_xref="GeneID:4947782"
FT                   /locus_tag="Bcep1808_7390"
FT   CDS_pept        87255..88946
FT                   /locus_tag="Bcep1808_7390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IVB pilus formation outer membrane protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IVB pilus formation outer membrane
FT                   protein, R64 PilN family; PFAM: Secretin domain protein;
FT                   KEGG: pau:PA14_59250 type IV B pilus protein"
FT                   /db_xref="GI:134287991"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="GeneID:4947782"
FT                   /translation="MLVIALSGCETVQHADRTDSKADQRASMIDHKMNDQLRDARPDAD
FT                   IVQYLDHQYVSLEPVEREVQPVAGTKKSLNCHIQIATEQPISILEAAQIVTRECHVPVR
FT                   VTQDAMQQIANPAGSLAQLQGQGGGTIPMAGGTVPVVGAIGGAPNYASQMARYGGGAGF
FT                   DNSLIDVNYDGEGDGFLDMLTARMGGLSWRQDESGVIRIYAVDTRTFSIASIATDTQLD
FT                   SNFQSGTTMVAGATSGGTGGSSGGGQSGSGQGTSTTMQSTAIKMKTDLWKDIQNTLDTM
FT                   AGKGNAVVAPSMGSVTVRANVDVLDQVKKYIDYQNKRLSKFVQFNVKVYSVTLSNNDSA
FT                   GVNWNALYQTVTGKYGIKLSGAAFSAPAAAVSAGFSVLKSSGSPWSGTEAVVSALNEQG
FT                   KANLERSQALPTLNFQAVATQVGTQTGYVAGTQTTQTAQVGSSTSIQMGTINVGFNLSL
FT                   FPYVQDNNDILVQFNLNLSNLDSIRKVNIGDSSAEAPNINLPLNTVQKVRIRPGDTLML
FT                   TGINQNDDSSNRTGTGMHWNWALGGGVNAQSNRTMLVVLITPIMLD"
FT                   /protein_id="YP_001110155.1"
FT   misc_feature    87414..88937
FT                   /note="type IVB pilus formation outer membrane protein, R64
FT                   PilN family; Region: pilus_B_mal_scr; TIGR02520"
FT                   /db_xref="CDD:162902"
FT                   /locus_tag="Bcep1808_7390"
FT   misc_feature    <88587..88943
FT                   /note="Bacterial type II and III secretion system protein;
FT                   Region: Secretin; cl02829"
FT                   /db_xref="CDD:164025"
FT                   /locus_tag="Bcep1808_7390"
FT   gene            88952..90439
FT                   /db_xref="GeneID:4947783"
FT                   /locus_tag="Bcep1808_7391"
FT   CDS_pept        88952..90439
FT                   /locus_tag="Bcep1808_7391"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psb:Psyr_1516 hypothetical protein"
FT                   /db_xref="GI:134287992"
FT                   /db_xref="GeneID:4947783"
FT                   /translation="MSDLINKLLPSGFAELRNKLSMRGRQARVMHEEERLDLEIEILEY
FT                   HGRKFVTGLHWAPLTSPLKYKKEAKQMAAQWHWDVVAYRREAGGVQAGFVSTSSGAYKR
FT                   MYSVASTLAGELSKQYGNRWIGLFAVSEEKYLFVAVWDGLVVAGTDRIVSRSEARGAFN
FT                   EIINRHTQGEDRFEDDKQFAPVELELTHTELSLTEILSVKKLSREYQLRAITFSLSAAE
FT                   TRKMILLAVIGCVAWAGYSKWSDDQHEKIAARQAAEKAANDARLAQANRNARNKLLEQA
FT                   LAHPWAFAPSARDYAAACESMTDALPLSIAGWLFASAHCEGPKVTITYQRKTGTTQGTF
FT                   GQSVGQVLMAYGAQRAKPVLSFAESGSEATITIPIDAPAAGDDALLPAFEATSELLGTL
FT                   EPANSNDLQIISGMNVTEVPVEIKLPPSAQGASDVAVPSPTWRHYGFKFDSVIKPEAIM
FT                   ASMKLSNGLRFNGIETKFNAESGTLTWSISGDLYVQR"
FT                   /protein_id="YP_001110156.1"
FT   misc_feature    89099..90433
FT                   /note="Pilin accessory protein (PilO); Region: PAP_PilO;
FT                   pfam06864"
FT                   /db_xref="CDD:148465"
FT                   /locus_tag="Bcep1808_7391"
FT   gene            90426..90977
FT                   /db_xref="GeneID:4947784"
FT                   /locus_tag="Bcep1808_7392"
FT   CDS_pept        90426..90977
FT                   /locus_tag="Bcep1808_7392"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV B pilus protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pau:PA14_59280 type IV B pilus protein"
FT                   /db_xref="GI:134287993"
FT                   /db_xref="GeneID:4947784"
FT                   /translation="MFKGNVAIGLICAFALTCLTPQAYAEDGDNVGTLGRIQTHTYILN
FT                   ARYLEKQAQDKLDGKVAADGTATPAATASIAPRSVVDSALPNVKMIINGDAGPSAVLLY
FT                   AGGIQAAGKVGSKLPGGYTIKAISASNRSVDVTDRNGKSLTLGMSSTPPQVQEQTPGQP
FT                   QFGAPVPMRMPAMGATTMLR"
FT                   /protein_id="YP_001110157.1"
FT   sig_peptide     90426..90503
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7392"
FT                   /product="hypothetical protein"
FT   misc_feature    90522..90827
FT                   /note="Type IV pilus biogenesis; Region: Pilus_PilP;
FT                   cl11837"
FT                   /db_xref="CDD:164275"
FT                   /locus_tag="Bcep1808_7392"
FT   gene            90987..92531
FT                   /db_xref="GeneID:4947785"
FT                   /locus_tag="Bcep1808_7393"
FT   CDS_pept        90987..92531
FT                   /locus_tag="Bcep1808_7393"
FT                   /gene_family="HOG000219430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pau:PA14_59290 type IV B pilus protein"
FT                   /db_xref="GI:134287994"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4947785"
FT                   /translation="MGANDLLKPTGRPAVISVGDSQLRPPPNLKGKVALMSNNELLVGD
FT                   AYANDPAVHSYLSLVRRARKVHVGIKSIGLDELGEILSSADKISHTGKRSATQSEVLAR
FT                   IRDGYQRRSSDIHFVNGETTTKIKYRIDGVLRTVDEITVADGMALCRSMYESMTDVSQG
FT                   TYNEHVSQDARIERAWLKEIGLTGSRIATRPLEVNNLFVLRLLYPGSLGNKTLPGLGYS
FT                   PEQIAEINRMIRRDGVNLFSGSTGSGKSTSLMVICKMILELFSYNIHLLTIEDPPEYDI
FT                   PGANQTPLKYDATKPDEVGRAWALAISNAMRLDPDFLMVGELRDFSSTMAAIQAAMTGH
FT                   GLWTTTHAKHIFASLDRLADLNVPIGRLTDASLITGLINQSLVPRLCPHPGCARPFSKF
FT                   KDEVAEDVRERIIKYCDADRVMIRCRADNTDCPVCGGLGYYERTVAAEVATPTQKLMDV
FT                   YRTHGSHEARRYWVKEMGGMTSMQHMIRKINEGIVDPVAGEEAMRRGLDEDELTLA"
FT                   /protein_id="YP_001110158.1"
FT   misc_feature    91497..92312
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7393"
FT   misc_feature    order(91713..91718,91728..91736)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7393"
FT   misc_feature    order(91716..91718,91728..91736,91800..91802,91806..91811,
FT                   91947..91952)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7393"
FT   misc_feature    91935..91949
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7393"
FT   gene            92539..93633
FT                   /db_xref="GeneID:4947786"
FT                   /locus_tag="Bcep1808_7394"
FT   CDS_pept        92539..93633
FT                   /locus_tag="Bcep1808_7394"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   psb:Psyr_1513 type II secretion system protein"
FT                   /db_xref="GI:134287995"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:4947786"
FT                   /translation="MIDWLMDLMLEVAEFYRRSRFSSKERSSFYSKLGMLTKNGLTLKT
FT                   ALTTLHNVFSEGGTKPNKIKAIVTEECLAGQRAGKEIALTLMEWVPYEEAATIAAGARS
FT                   EGGQHSAFLRARQIVKRKAEMRKLLTKALSYPTMLWVAMAGLLYYTSKTVMPNLIRMTK
FT                   PENWDTTAQIMSVMANIVGEHGKLVLLLIFAVVASVIWSIGHVTGLPRVYLDRVPPWSI
FT                   VRTVRGATFLYNFGVLQASGVKALSILHSELKHANAYMKERIEGAIMGVKNGRNIGEAL
FT                   HLAGHEFPSREAIEYLRVIAPLNGGPEQMMEFAEDWMAESMEQVEAIAAVLGNLSLIAV
FT                   FGVMGFLLSGAGAIGMQAMGSMGQ"
FT                   /protein_id="YP_001110159.1"
FT   misc_feature    92635..93582
FT                   /note="Type II secretory pathway, component PulF [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: PulF; COG1459"
FT                   /db_xref="CDD:31648"
FT                   /locus_tag="Bcep1808_7394"
FT   misc_feature    93229..93582
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Bcep1808_7394"
FT   gene            93667..94272
FT                   /db_xref="GeneID:4947787"
FT                   /locus_tag="Bcep1808_7395"
FT   CDS_pept        93667..94272
FT                   /locus_tag="Bcep1808_7395"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV B pilus protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pau:PA14_59320 type IV B pilus protein"
FT                   /db_xref="GI:134287996"
FT                   /db_xref="GeneID:4947787"
FT                   /translation="MNSLFKNQPVLDACGTTDANEEAIIEGQLRSQRGIGALEWIAIIA
FT                   VVLFMLYQIIGRVSVMNTSNSTLGETSSVSALHTALRSNLKSGTGYAANGADLIVPLYN
FT                   AKGIPTNLSYNGGVLLNTYGSQYTIVAANAGFGFAITDPGVPAADCIKLVIQQSQSGNW
FT                   TGGISVGGSNLGNAPVTTANAQTACNGATNSIVFTSNS"
FT                   /protein_id="YP_001110160.1"
FT   misc_feature    93856..94266
FT                   /note="PilS N terminal; Region: PilS; pfam08805"
FT                   /db_xref="CDD:149762"
FT                   /locus_tag="Bcep1808_7395"
FT   gene            94296..95252
FT                   /db_xref="GeneID:4947788"
FT                   /locus_tag="Bcep1808_7396"
FT   CDS_pept        94296..95252
FT                   /locus_tag="Bcep1808_7396"
FT                   /gene_family="HOG000263350" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pfl:PFL_4681 type IV pilus biosythesis protein"
FT                   /db_xref="GI:134287997"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:4947788"
FT                   /translation="MKISEAEFADLYIGEDFADVAGLNGMDKDELIPVPAQFDDEIVQL
FT                   RAQCFKIIADQPVGEFSLRKGNVLLRVTCLPSTDGKDVFVIRKPMAKLLDREEIGLGKS
FT                   DLEYLMRPELRGLVLFVGEMRSGKTTRAASFVKARLETHGGTAIAIEDPPETALDGMHG
FT                   RGRCIQVDARGSGAYQEQLKRSVRTGAGMIYLGEVRDGETAMQVVSACNNGHLILSTTH
FT                   ALSVQDAIMRICNFCAGKLEDPEKALASGLAVVVHLKLFSKWVNSATGPKEVKRVEYTM
FT                   LRVEGNKQVQGLIRTKQFHLIDNAVEEQQAKQRSGSF"
FT                   /protein_id="YP_001110161.1"
FT   misc_feature    94473..>95003
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7396"
FT   misc_feature    order(94659..94664,94674..94682)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7396"
FT   misc_feature    order(94662..94664,94674..94682,94740..94742,94746..94751,
FT                   94881..94886)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7396"
FT   misc_feature    94869..94883
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Bcep1808_7396"
FT   gene            95275..96888
FT                   /db_xref="GeneID:4947789"
FT                   /locus_tag="Bcep1808_7397"
FT   CDS_pept        95275..96888
FT                   /locus_tag="Bcep1808_7397"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psb:Psyr_1510 prepilin"
FT                   /db_xref="GI:134287998"
FT                   /db_xref="GeneID:4947789"
FT                   /translation="MSRKILLQLGGPSASIEARRQREGGVGALEMIAVIGIFISMIALS
FT                   APFVTQWSNSRTDQIVADQFKLAMQGANTFIQNNSATIVAAANPTVVYSWAQMAGSMPA
FT                   GLSPTNTFGQTYQLAIQKTGTAPNYTLNPMLQTTGGQPIPENELRAISASVGGSGGYIS
FT                   TLTPTVATGAKGSWGPLTLTSFGANPGAGRLAGALFYQTSTQANQYLYRVNVPGHPELN
FT                   QMQTSVDMQSNNVNNAGIVNTNKLATNGLNANDMPPTWGGGIRTWDVYAGGTVGVGPGG
FT                   GAPPVAWMAQNGVVQGQWLNATNDVNAQGNVNASNSVNASVGVNTGGQIWAGGNITTNG
FT                   SIGLNSSGAAITNPGRMHINTGENLYLQPWSGGSTIVGGGGGSGNLIVTGNLDGNGYIK
FT                   PGQIAWAGAGCGPNGALGTDGQQALFCNSGVWTAAGGGGSAVSHCKGSSCTITLPSAGT
FT                   WDIFGVAYVHQYAWLGGWFYINGALVDTNANEGDQDGTGWGIMSGSYRIAVGGPTTIGA
FT                   NTVWNGTWGDFTINLHATKE"
FT                   /protein_id="YP_001110162.1"
FT   misc_feature    95332..>95970
FT                   /note="Bacterial shufflon protein, N-terminal constant
FT                   region; Region: Shufflon_N; pfam04917"
FT                   /db_xref="CDD:113681"
FT                   /locus_tag="Bcep1808_7397"
FT   gene            complement(96975..97601)
FT                   /db_xref="GeneID:4947790"
FT                   /locus_tag="Bcep1808_7398"
FT   CDS_pept        complement(96975..97601)
FT                   /locus_tag="Bcep1808_7398"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_1033 hypothetical protein"
FT                   /db_xref="GI:134287999"
FT                   /db_xref="GeneID:4947790"
FT                   /translation="MAGATKTSLIKSTRRALKERYPAVFGGKWRPLCVGVVDMLVADMG
FT                   ADAPRRDLHRAIAARAGKLEYLTAVAGGGPRYDLQGNERGHVTAHEQEYAKQRLAQMEQ
FT                   ARLRAGEEVVRRAIFLKAFEKSGLSTASYASVNGLDYDRVQSEYHRALREREQRREERK
FT                   QLVVKLEASGLSLEEFAKRKNVRLAKLRKAVDYVASLRATATPTA"
FT                   /protein_id="YP_001110163.1"
FT   misc_feature    complement(97278..97553)
FT                   /note="FinO bacterial conjugation repressor domain;  the
FT                   basic protein FinO is part of the the two component FinOP
FT                   system which is responsible for repressing bacterial
FT                   conjugation; the FinOP system represses the transfer (tra)
FT                   operon of the F-plasmid which...; Region: FinO_conjug_rep;
FT                   cl00174"
FT                   /db_xref="CDD:174017"
FT                   /locus_tag="Bcep1808_7398"
FT   gene            97708..97950
FT                   /db_xref="GeneID:4947791"
FT                   /locus_tag="Bcep1808_7399"
FT   CDS_pept        97708..97950
FT                   /locus_tag="Bcep1808_7399"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ajs:Ajs_1349 transcriptional regulator, XRE family"
FT                   /db_xref="GI:134288000"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4947791"
FT                   /translation="MTNSYNRAFGTVLRSFRIERRVTQESLGFSAGRDRTYISLLELGQ
FT                   RSPTLDTIVVLCRALNVTLNEFIAAVEREADSSVD"
FT                   /protein_id="YP_001110164.1"
FT   misc_feature    97735..97908
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7399"
FT   misc_feature    order(97747..97749,97759..97761,97834..97836)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7399"
FT   misc_feature    order(97756..97758,97831..97833)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7399"
FT   misc_feature    order(97777..97782,97813..97815,97822..97824,97834..97839)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7399"
FT   gene            98119..98358
FT                   /db_xref="GeneID:4947792"
FT                   /locus_tag="Bcep1808_7400"
FT   CDS_pept        98119..98358
FT                   /locus_tag="Bcep1808_7400"
FT                   /gene_family="HOG000225390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ava:Ava_2195 transcriptional regulator, XRE family"
FT                   /db_xref="GI:134288001"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4947792"
FT                   /translation="MERHNRCFGRVLRRLRRDMHLSQKDLAVHAGVDRTYISLLELGRR
FT                   SPTLESIVALAAALKIPLSRLFAELEVEIARDVD"
FT                   /protein_id="YP_001110165.1"
FT   misc_feature    98173..98316
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7400"
FT   misc_feature    order(98185..98190,98221..98223,98230..98232,98242..98247)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7400"
FT   misc_feature    98239..98241
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7400"
FT   misc_feature    98242..98244
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Bcep1808_7400"
FT   gene            complement(98355..98630)
FT                   /db_xref="GeneID:4947793"
FT                   /locus_tag="Bcep1808_7401"
FT   CDS_pept        complement(98355..98630)
FT                   /locus_tag="Bcep1808_7401"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288002"
FT                   /db_xref="GeneID:4947793"
FT                   /translation="MFRLICLGGIYEPLGLEEVCAAINTLRDVDVQVVDLREGGKSHRL
FT                   TIGPSGFVHETFGARRVVNDVRLLLATPGRPVYASASNANSEDLIN"
FT                   /protein_id="YP_001110166.1"
FT   gene            complement(98879..99139)
FT                   /db_xref="GeneID:4947794"
FT                   /locus_tag="Bcep1808_7402"
FT   CDS_pept        complement(98879..99139)
FT                   /locus_tag="Bcep1808_7402"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288003"
FT                   /db_xref="GeneID:4947794"
FT                   /translation="MSIAIKPSFARRWVAASIGLWMKIAPMVVVVSVALKLLGVGMWAA
FT                   MTWASVVLYPSLAALSTLAIFGGWLALMTHDWNCREIGTTQ"
FT                   /protein_id="YP_001110167.1"
FT   gene            complement(99186..99713)
FT                   /db_xref="GeneID:4947795"
FT                   /locus_tag="Bcep1808_7403"
FT   CDS_pept        complement(99186..99713)
FT                   /locus_tag="Bcep1808_7403"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288004"
FT                   /db_xref="GeneID:4947795"
FT                   /translation="MKRLWEETLEQISLEKLLTEEPSRPGLVELYQRTMLHRTNEAMNG
FT                   LSHRLDQIIDQAKQNGKAQGRQQKAMIALTTVLAVATVVYTATTVYATRETVKAQQASA
FT                   ATQVKVEYVRSSGAVPESAAVHMGVDEKGNPAVCVDGTAYDIPAPNDAHLKVRPQPSHP
FT                   GGAILPVLLCQN"
FT                   /protein_id="YP_001110168.1"
FT   gene            complement(99725..100195)
FT                   /db_xref="GeneID:4947796"
FT                   /locus_tag="Bcep1808_7404"
FT   CDS_pept        complement(99725..100195)
FT                   /locus_tag="Bcep1808_7404"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288005"
FT                   /db_xref="GeneID:4947796"
FT                   /translation="MSNAVLSPEVVSDLIADCLGVVKVLCIVGPCCTGKTTSLKRWSEA
FT                   ARDIGSMRVAYIDCHTLLISSKVDVAFDGQVKGALPGHYPMFDLESADVVIVDEPLQNR
FT                   DLVARVLAHIAPIKGPFMHRLLVLPVQQERVLDLLEIPRSVTRLYSIEGTRR"
FT                   /protein_id="YP_001110169.1"
FT   misc_feature    complement(<100016..100117)
FT                   /note="cell division control protein 6; Reviewed; Region:
FT                   cdc6; PRK00411"
FT                   /db_xref="CDD:166946"
FT                   /locus_tag="Bcep1808_7404"
FT   gene            complement(100308..100562)
FT                   /db_xref="GeneID:4947797"
FT                   /locus_tag="Bcep1808_7405"
FT   CDS_pept        complement(100308..100562)
FT                   /locus_tag="Bcep1808_7405"
FT                   /gene_family="HOG000263351" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288006"
FT                   /db_xref="GeneID:4947797"
FT                   /translation="MIVQSLEAAVTLILTLQMLMLIWSSETSLRAAYADSWRKTGTALT
FT                   HLFQIQAGPDRRIGVVAFGLVGFYVAITAAIEFAGHFAH"
FT                   /protein_id="YP_001110170.1"
FT   gene            100810..101106
FT                   /db_xref="GeneID:4947798"
FT                   /locus_tag="Bcep1808_7406"
FT   CDS_pept        100810..101106
FT                   /locus_tag="Bcep1808_7406"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288007"
FT                   /db_xref="GeneID:4947798"
FT                   /translation="MSFLSPEVVVTFEGIVRQAAFAHRLEHYMTILHVSRGLTQFIERR
FT                   GRLKVNFDVGETSLIGVHGPSREQPPFGTRLLEAFHICRTFGAKRKILHVISR"
FT                   /protein_id="YP_001110171.1"
FT   gene            complement(101495..101947)
FT                   /db_xref="GeneID:4947799"
FT                   /locus_tag="Bcep1808_7407"
FT   CDS_pept        complement(101495..101947)
FT                   /locus_tag="Bcep1808_7407"
FT                   /gene_family="HOG000263352" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilM protein, putative"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_4683 PilM protein, putative"
FT                   /db_xref="GI:134288008"
FT                   /db_xref="GeneID:4947799"
FT                   /translation="MIGFIPLVAIFIFFQMMVSLTSVDDGKIAVAQSDTVTVGQSMLAL
FT                   HGFAALYASQNPGYSGYANDATLGSPSWYNRPTYVATYLNGGKAYVYYNGPVQGLPAYL
FT                   VATSGDIYGAGINQNGVLVSPSALPSDTASLTIPSQVPNGSVVVMP"
FT                   /protein_id="YP_001110172.1"
FT   misc_feature    complement(101501..>101827)
FT                   /note="PilM; Region: PilM; pfam07419"
FT                   /db_xref="CDD:148813"
FT                   /locus_tag="Bcep1808_7407"
FT   gene            complement(101951..102658)
FT                   /db_xref="GeneID:4947800"
FT                   /locus_tag="Bcep1808_7408"
FT   CDS_pept        complement(101951..102658)
FT                   /locus_tag="Bcep1808_7408"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bch:Bcen2424_3312 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:134288009"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:4947800"
FT                   /translation="MRRSIVGVTVAAISLGASVQASGQSLESMLPVCAPLVHPLTMGKI
FT                   VKVESRGRQYALADAGPKGLPWKGVREKMVRSYFPATADEAEQIATRLIAANHIVAIGL
FT                   SQVSSENLKRFGLNVRQVLDPCTNLRTGSTILTEFYLKARKTIADPNRAILAAISAYNT
FT                   GNFTSGFSNGYVKSVVDAKSPSEPTIPAMVDTDILGNGDPSLPSAASAYAVRQRPQLLS
FT                   QKLAVLHVTDEEP"
FT                   /protein_id="YP_001110173.1"
FT   sig_peptide     complement(102593..102658)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7408"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<102125..102562)
FT                   /note="lysozyme_like domain.  This contains several members
FT                   including Soluble Lytic Transglycosylases (SLT), Goose
FT                   Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL),
FT                   chitinases, bacteriophage lambda lysozymes, endolysins,
FT                   autolysins, and chitosanases...; Region: lysozyme_like;
FT                   cl00222"
FT                   /db_xref="CDD:176812"
FT                   /locus_tag="Bcep1808_7408"
FT   gene            complement(102660..103175)
FT                   /db_xref="GeneID:4947801"
FT                   /locus_tag="Bcep1808_7409"
FT   CDS_pept        complement(102660..103175)
FT                   /locus_tag="Bcep1808_7409"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288010"
FT                   /db_xref="GeneID:4947801"
FT                   /translation="MEAEKRSVFVSDRIIATVDFIKWTSTFGEDAIKQMETPVSGVRLT
FT                   SALLHLFGMVRGEHFPMLTMQESEAPWLAHLPLQMALVGYGDGVILVTAEHTIFEQPFP
FT                   SIGVDIFIPHEYRNEFAAARMMGFCHVTESGPTPINKAIPVYTRERYERERRTLPRGAV
FT                   ETSLFSGV"
FT                   /protein_id="YP_001110174.1"
FT   gene            103427..104266
FT                   /db_xref="GeneID:4947802"
FT                   /locus_tag="Bcep1808_7410"
FT   CDS_pept        103427..104266
FT                   /locus_tag="Bcep1808_7410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288011"
FT                   /db_xref="GeneID:4947802"
FT                   /translation="MKVVSALMSAVATAPGGNASAEDIADAATTLLERATQLADAATPL
FT                   LRVDEASPQFPALRNALREGAADTISMQWRLAHATGMRELSVSQIADIYRSVKEADFLP
FT                   NADLEYSASHVVDPVVARRLALFGAATEIHNAVSAFGYFHPQPDELVAVGLSAVVSCCD
FT                   RAIARIVSSREASATTRAAVEQTLIERSGLLYAQNYRAIANRDIKDLSVLDPEERMCRI
FT                   REHRATGMPTAHIGDGFTRLMDRMIDMILESAPELAEAEVPSSDANSVSLQEIGAKA"
FT                   /protein_id="YP_001110175.1"
FT   sig_peptide     103427..103492
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7410"
FT                   /product="hypothetical protein"
FT   gene            104263..104616
FT                   /db_xref="GeneID:4947803"
FT                   /locus_tag="Bcep1808_7411"
FT   CDS_pept        104263..104616
FT                   /locus_tag="Bcep1808_7411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288012"
FT                   /db_xref="GeneID:4947803"
FT                   /translation="MNLTVIPFGPELVARARQEKIDQEVYQSIPALNSLANASLALSTK
FT                   LTLDARNALFYANRAIDPSLRRVAVELGVERRLSMESAMPDPEYLAGQDKATRQQYETA
FT                   ENDIWLAPDEPNA"
FT                   /protein_id="YP_001110176.1"
FT   gene            104644..106167
FT                   /db_xref="GeneID:4947804"
FT                   /locus_tag="Bcep1808_7412"
FT   CDS_pept        104644..106167
FT                   /locus_tag="Bcep1808_7412"
FT                   /gene_family="HOG000263353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afu:AF1030 hypothetical protein"
FT                   /db_xref="GI:134288013"
FT                   /db_xref="GeneID:4947804"
FT                   /translation="MKAMFGYDSGELSRGKKVPVMWDTKQVVNPHMLIAGISGMGKTYT
FT                   LKKIISHVASTLSPGQKMRVHVIDVHGDIDIPGASTVVFSEQSPYGLVNPLKINPDPHF
FT                   GGLRKQIQGFIATMNRVMRQLGNKQEACLRNLLTDLYITHGFKQDDPSTWMIDPESARF
FT                   LSDGSNRLYIDVPRAEKDQAKALGARWEPTLTCWWVQPDKYQGGITRWPPKTLGRTQPS
FT                   IRDALVLARRILSQSFLGADEEAITNLEIFQRASDQYQSSVLEAMRRGEKLVEDEALIA
FT                   TLDKKKHAAIDTFTQYVESIKTGREIETLMKYSSTDVLASVVDRLENLDAMGMFKTEPA
FT                   PHDENVMVWRYVTNALLLDERRLAGLFKMEEIFLNAIQRGEQDDVVEIIIADEGHIYAD
FT                   DDPENIMNKIGLEARKFGLSLIVATQSPKHVPDGFMMSCGTKVILGLDESEWRSSATKF
FT                   RVTEQALAWTKAREKMLVQTKQKGQSKNDWKWTAIADTMPEMEAVALEA"
FT                   /protein_id="YP_001110177.1"
FT   misc_feature    104671..>104949
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7412"
FT   misc_feature    <105307..105987
FT                   /note="HerA helicase [Replication, recombination, and
FT                   repair]; Region: COG0433"
FT                   /db_xref="CDD:30782"
FT                   /locus_tag="Bcep1808_7412"
FT   gene            106244..106663
FT                   /db_xref="GeneID:4947805"
FT                   /locus_tag="Bcep1808_7413"
FT   CDS_pept        106244..106663
FT                   /locus_tag="Bcep1808_7413"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0140 hypothetical protein"
FT                   /db_xref="GI:134288014"
FT                   /db_xref="GeneID:4947805"
FT                   /translation="MARIEQIDRSKSVTITGHKTVQHTDQFLVDLAKHMQLPQLLNCDV
FT                   PVGLPKVTDAELGASLLDRLSESRWRALFEADLQCICEDSDGNPLLTTWMPIDVFSRFA
FT                   SSLDDTMVRIELEATISDWEALGVETVYIDAYQRP"
FT                   /protein_id="YP_001110178.1"
FT   gene            106874..108799
FT                   /db_xref="GeneID:4947806"
FT                   /locus_tag="Bcep1808_7414"
FT   CDS_pept        106874..108799
FT                   /locus_tag="Bcep1808_7414"
FT                   /gene_family="HOG000247563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: bte:BTH_I1858
FT                   acyltransferase family protein"
FT                   /db_xref="GI:134288015"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:4947806"
FT                   /translation="MNTVDQRSVLAAAQASGMRKHADVRPASGYRPDIDALRALAVLSV
FT                   VVFHAFPGILPGGFVGVDIFFVISGYLITSHILRELEVEQFSIGNFYSRRIRRIFPALL
FT                   IVLVGSYLIGWFNLLPAEFKELGKHVAGGALSVANLVLWKEAGYFDASADHKPLLHLWS
FT                   LGVEEQFYLFWPLILWAVTRVKRSPMWAISALGILSFVSCVIVVRSDPTTAFYWPITRA
FT                   WELMVGSLLAYREFSRDQRDVHHAETGVIAGVVLLVASIVLMNSRLTFPGWWALGPTVG
FT                   AYLVIRGGQQSRLMRRICVRPVLLAGLISYPLYLFHWPLLSFLRMMSTGVPAWYMRAAA
FT                   VAVAIPAAWVTYRFIELPIRRSRWPSSLAVTLLVLVLGAGFAGYNAFDRNGMEFRMAHL
FT                   TSQFADGNFDLDHEWRKGACYLESPVETFSPQCVEQGAAPLVFLWGDSRAAAIYPGFRD
FT                   QRAAFGVRVAEYSASGCPPLLGGTDRCGRINEGALSALKAARPHTLVLTANWTEDRLAG
FT                   LDRTVSAAREAGVARIVLLGQVATWQSPLPTLYWVYWRAHHQELPARSNYAVDPRATQL
FT                   DREGEETAKRLGIEYVSAYRAMCDANGCLTRTGSGRGMLMSFDDSHLTPSGAHVVVRAL
FT                   STQLLH"
FT                   /protein_id="YP_001110179.1"
FT   misc_feature    106925..107848
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:174391"
FT                   /locus_tag="Bcep1808_7414"
FT   gene            109153..109563
FT                   /db_xref="GeneID:4947807"
FT                   /locus_tag="Bcep1808_7415"
FT   CDS_pept        109153..109563
FT                   /locus_tag="Bcep1808_7415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_1565 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="GI:134288016"
FT                   /db_xref="GeneID:4947807"
FT                   /translation="MRFWVSPKSLEICSILVKLKTTRHFFEFIVKKALHADLLPFEAEE
FT                   VVTSLGETVTLARRAREWTQADLASKMGASVNTVVNIEKGRPSVAFGQVLNALWALDLL
FT                   GGLRESLRPEDVPDIKRAAMRRFKRSSRGAHG"
FT                   /protein_id="YP_001110180.1"
FT   misc_feature    109294..109461
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Bcep1808_7415"
FT   gene            109556..110899
FT                   /db_xref="GeneID:4947808"
FT                   /locus_tag="Bcep1808_7416"
FT   CDS_pept        109556..110899
FT                   /locus_tag="Bcep1808_7416"
FT                   /gene_family="HOG000229017" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HipA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: HipA domain protein; KEGG: pol:Bpro_1566
FT                   HipA-like"
FT                   /db_xref="GI:134288017"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="GeneID:4947808"
FT                   /translation="MAEQERPVWVWLPGSITPVECGTFTWEPGEGKFLYSQDYLDRKDA
FT                   AVAIDPINLPFSRSKKPARTTAMNGVFGVLRDAAPEGFGLDLLNAKHGNRTLDEIERMD
FT                   LAAGDGVGAIEVCRPEEIEKKMSFLPPREEELRDRLARTDVGESITGLVRQLTGDDDGT
FT                   SLGGEKPKLTVTREIGGKTEWWIAKLQPRNGARLLPAREYVAMKLAQRCGIDVAEVTFE
FT                   RVGVHEVVMVKRFDRKVVDGGVERTLFASGATVLRLDSDTTREDPDRSYPKLAHELRRW
FT                   SGDHEHRGAVDQQRELWRRMVYNALVGNYDDHPRNHGLLYRDGRWVLSPAYDIVAIPQT
FT                   PLVQAMAVNRHSRYASPENLVSDAQVFAYEPVQAWETLREMAATVHSSWRQMFHDECSV
FT                   SEEDVEILRPAFKLAEGIVTGEMTLDPEIFNHKRRRGVARAPGHALEP"
FT                   /protein_id="YP_001110181.1"
FT   misc_feature    110063..110266
FT                   /note="HipA-like N-terminal domain; Region: HipA_N;
FT                   pfam07805"
FT                   /db_xref="CDD:149074"
FT                   /locus_tag="Bcep1808_7416"
FT   misc_feature    110291..110554
FT                   /note="HipA-like C-terminal domain; Region: HipA_C;
FT                   pfam07804"
FT                   /db_xref="CDD:149073"
FT                   /locus_tag="Bcep1808_7416"
FT   gene            110952..111413
FT                   /db_xref="GeneID:4947809"
FT                   /locus_tag="Bcep1808_7417"
FT   CDS_pept        110952..111413
FT                   /locus_tag="Bcep1808_7417"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288018"
FT                   /db_xref="GeneID:4947809"
FT                   /translation="MFGMNAKDAQGALEDLTMLKSAAAGSTVGAADLYRAGAALQNAKR
FT                   AIAVRTDKLNDVGSRLKDLTGEYNDLRAISNASRKVIDALAEDLANALGLDVVDVRKRA
FT                   YGAMTKAYDAEVAEMLSTGYLEQDPRQNPQIAARKSRDWYTPSADSPAL"
FT                   /protein_id="YP_001110182.1"
FT   gene            complement(111452..111799)
FT                   /db_xref="GeneID:4947810"
FT                   /locus_tag="Bcep1808_7418"
FT   CDS_pept        complement(111452..111799)
FT                   /locus_tag="Bcep1808_7418"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bam:Bamb_6089 histone family protein
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:134288019"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947810"
FT                   /translation="MYLRLPIVTHSLKDLNAQLRELNIRIANAKREEKHAALVAFKLQV
FT                   DLYAISQEELLEALGFTKRKPARAAAKYYDPSSGKTWSGRGPMPKWLQGKNSDHYLVDR
FT                   KPKTWWPGEDT"
FT                   /protein_id="YP_001110183.1"
FT   misc_feature    complement(111518..111763)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep1808_7418"
FT   gene            complement(111866..114193)
FT                   /db_xref="GeneID:4947811"
FT                   /locus_tag="Bcep1808_7419"
FT   CDS_pept        complement(111866..114193)
FT                   /locus_tag="Bcep1808_7419"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_1097 hypothetical protein"
FT                   /db_xref="GI:134288020"
FT                   /db_xref="GeneID:4947811"
FT                   /translation="MANPFTPSPTDAAVKYLQMIFGDVITHLVSGLSPSAASNAAATML
FT                   GVAFHYFNGGVLVFGTFILTWVTIFGIANSANDGEVLGKQWSTFYTPIRTFSAAAVLMP
FT                   TSSGFAGIQIILLLVVTWSIGFASNIWTAVANYSISQSITSAAMSSITSDPNFESNIAA
FT                   AIRMGSCAQGVNTAMASVMPDSRISLQLQTAQTTEQHFGETTYITTYTYADPNWAGSGA
FT                   ICGTMTLTDSYPIVSNALNSIFSGNPSSANTSSNTQTADMLRRNIANARNNFFTSVFEQ
FT                   FVPNAVSQIVSAAVSTTDIQLSATALSNAIAAEKQQLASVVQQAVQQTIAGQNSSFVST
FT                   MTSQGWIFAASYWTDLGRIKDAVRTSTTSKANFTAGSNTLENLLPNGSVLTAANATMSS
FT                   ITNLATLLTNKALSTPSTNNSASAPAIPSLQTTFTLNDFTDGDSAAKTMFGKWFRHLGT
FT                   SLIAGMISYLDDPNEDPVMQVKSLGDWISSFAEGVFLLKTTVHAALEGLGAAAASSMLP
FT                   GTSIAAGWAKAAAVFFTDMFALVSPSLFMLMYAGYFLGIWIPMVPFYVFAIGVVGWLVF
FT                   VIEMMAAGVLWAAAHTTPARDNSFIGSQMQGYMLVMSGFFRPALMVVGLVASNAVLYPS
FT                   ISYINAAFLARVQAIQQDTVTGPLSIAAFMLVYCVIIFAVFMLVFSLPQTLPDRILRWI
FT                   GAGVGDLGEQNSMGKIEGSASSQARTAMVTAATKQAHLSQARQKQRDDDARRAFAAADD
FT                   SMMQTALDTPATETGPGPLRIE"
FT                   /protein_id="YP_001110184.1"
FT   gene            114361..114861
FT                   /db_xref="GeneID:4947812"
FT                   /locus_tag="Bcep1808_7420"
FT   CDS_pept        114361..114861
FT                   /locus_tag="Bcep1808_7420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288021"
FT                   /db_xref="GeneID:4947812"
FT                   /translation="MQPSERHAIADQLVASLAEASPEYGPNVLGSLIASRIVTLIAAAD
FT                   ALVQSTSHPILLAEIIPGVDVIGVRDYTRPPREDADAVSLESIWEQGDSGFEWMAALGN
FT                   VAVRYLTSRAAGATGPGAISHSGADGIYYFAFKAEYRGIALAQIGLTQDEVRIVDTGAP
FT                   VGA"
FT                   /protein_id="YP_001110185.1"
FT   gene            114864..115760
FT                   /db_xref="GeneID:4947813"
FT                   /locus_tag="Bcep1808_7421"
FT   CDS_pept        114864..115760
FT                   /locus_tag="Bcep1808_7421"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288022"
FT                   /db_xref="GeneID:4947813"
FT                   /translation="MNPSLSAAEFAPTSAPAYISFADMGGLIRQRHLYADSALQVDGRR
FT                   FGAATVGAMRMAQAEEAINRLVTAARDREKPKGRPQAIREALRVAKDSDDPHELHYLTS
FT                   MFINEPTVIKELAKNPHLPEKSQRVIANDATLAANVHVMRSLASNPSLQPELMRDLLNS
FT                   SEDSIVRYEIAHNAALKSRFAPDADSPYVKLCDELADTTYDNALRLAALPGVRDADVLR
FT                   KVARTRDVVFGARELEAVADNIHTPVDVLADMANVPKSRKMLHAAFGVTVAQKAARTLV
FT                   ELRHPEGPGAGMEAALT"
FT                   /protein_id="YP_001110186.1"
FT   gene            115802..116497
FT                   /db_xref="GeneID:4947814"
FT                   /locus_tag="Bcep1808_7422"
FT   CDS_pept        115802..116497
FT                   /locus_tag="Bcep1808_7422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288023"
FT                   /db_xref="GeneID:4947814"
FT                   /translation="MYFSTSQTGNQNVAPLVNLSLREFGAHLIDDAYAHVPFESVVAAI
FT                   AKAKPIAPELAARELVAHAPDYRAKAFRVGVEEIVRAFGNDERAMQFYRSVASERSQLR
FT                   FESIGGVSDDLVTVKTRLAAHAANAYWARQHDGSAGLIPAEREYVDLMKSVRQSLEASL
FT                   TKGKVSADLAETAIAEIEAASVSAGFFGMEEVIRPLQETARDEIYTEHMERVLQRYTNA
FT                   PGADGPALE"
FT                   /protein_id="YP_001110187.1"
FT   gene            116510..117412
FT                   /db_xref="GeneID:4947815"
FT                   /locus_tag="Bcep1808_7423"
FT   CDS_pept        116510..117412
FT                   /locus_tag="Bcep1808_7423"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288024"
FT                   /db_xref="GeneID:4947815"
FT                   /translation="MTGPAGAISLDVSDEVVNIAAALDRGLVVRLVAPPDREHKFGVLS
FT                   RALTSQADTSASAWFVDAYGRKHENTLPMPIALGRVEFEALTSCPDDVAQLKALHSGET
FT                   LRTTNAILEQAERRVIRSLVAAGGSEKLYRKALTLVQSAGGLGYPNARELGIDRCAVHL
FT                   SEAGLIAERRVAVKDGHGVVRGAKILFEKPQHLSVLGDYLALKEASLGSTSSLNRLLKA
FT                   RGLDESMRVAIRALADSDLKALSARIDALYEEHTDAELDRIPKIALLYAKEFDDLIAES
FT                   PFRDSPLPQRDSADEMTPG"
FT                   /protein_id="YP_001110188.1"
FT   gene            117497..117949
FT                   /db_xref="GeneID:4947816"
FT                   /locus_tag="Bcep1808_7424"
FT   CDS_pept        117497..117949
FT                   /locus_tag="Bcep1808_7424"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288025"
FT                   /db_xref="GeneID:4947816"
FT                   /translation="MDFLYGRAVLHPIFLDELRACSVEFAESEQSIEQMRLEDGERIII
FT                   HIKFSSSSHAAVRALASQCGSALEIDAIPVEIGATKFGEMANCSAKNVAALTFFHEYSL
FT                   IASKGAAQKDLHARALERLSASWTRSIRQMTTLDCTGPEDGPLGDM"
FT                   /protein_id="YP_001110189.1"
FT   gene            118180..118491
FT                   /db_xref="GeneID:4947817"
FT                   /locus_tag="Bcep1808_7425"
FT   CDS_pept        118180..118491
FT                   /locus_tag="Bcep1808_7425"
FT                   /gene_family="HOG000263354" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288026"
FT                   /db_xref="GeneID:4947817"
FT                   /translation="MRAFLLGLAILMAEPAAWADQIGRGPQIGWQVKQPIRFVVSGILR
FT                   KDGSTDVIRPVHAIFEAPTDKDAVRQFEDEVGRRFRGYTLVGVLVDPIPPVGRCENGI"
FT                   /protein_id="YP_001110190.1"
FT   sig_peptide     118180..118239
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.994 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_7425"
FT                   /product="hypothetical protein"
FT   gene            complement(118549..118791)
FT                   /db_xref="GeneID:4947818"
FT                   /locus_tag="Bcep1808_7426"
FT   CDS_pept        complement(118549..118791)
FT                   /locus_tag="Bcep1808_7426"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288027"
FT                   /db_xref="GeneID:4947818"
FT                   /translation="MRIRTNFDPAHPERLLSVFLFLLKTSTTGTTSPPGFMITKMRQPR
FT                   APILGGCIEKIKNRKRALGCFDTIPADLVDVSIQL"
FT                   /protein_id="YP_001110191.1"
FT   gene            complement(118938..119273)
FT                   /db_xref="GeneID:4947819"
FT                   /locus_tag="Bcep1808_7427"
FT   CDS_pept        complement(118938..119273)
FT                   /locus_tag="Bcep1808_7427"
FT                   /gene_family="HOG000218472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: rso:RS00711 putative HNS-like
FT                   transcription regulator protein"
FT                   /db_xref="GI:134288028"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:4947819"
FT                   /translation="MTSTYLKLSQQMKDIAAQAEAAREQELPAIINQIRELMATYNLTV
FT                   DDLGVGGTTKATRKGRAKAASGEEKAPRPPKYRNPKTGETWSGFGRAPSWIASAKNRDR
FT                   FLIEQPA"
FT                   /protein_id="YP_001110192.1"
FT   misc_feature    complement(118956..119255)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Bcep1808_7427"
FT   misc_feature    complement(118953..119066)
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:175028"
FT                   /locus_tag="Bcep1808_7427"
FT   gene            119510..120379
FT                   /db_xref="GeneID:4947820"
FT                   /locus_tag="Bcep1808_7428"
FT   CDS_pept        119510..120379
FT                   /locus_tag="Bcep1808_7428"
FT                   /gene_family="HOG000236951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative adenine-specific DNA methyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0131 putative adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="GI:134288029"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="GeneID:4947820"
FT                   /translation="MRAKALNTTDELATASNPDKVRELGQYPTRVWIAEAIVEQFFPDL
FT                   SSEDCVIEPACGPGAFLGAIPPQVRAFGVELDAAIAEVARRETGRPVIVGDFRSVPLDC
FT                   QPTVILGNPPFKLSVIDGFLDRAHQMLPEGGRVGFILPAYAFQTAARVAAYADQWSLEQ
FT                   QFLPRNIYDGLSLPLVFARFSKDRRRTLVGFALYREVADVQKLRAPYREALAAGHGPVW
FT                   ARVVERALAQLGGEADLAQIYAEIEGNRPTQTQYWREQVRKVVRTHRWFTCVSTGRYAL
FT                   NQATAAAA"
FT                   /protein_id="YP_001110193.1"
FT   misc_feature    119660..119941
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep1808_7428"
FT   misc_feature    order(119669..119689,119732..119737,119792..119800,
FT                   119843..119845)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Bcep1808_7428"
FT   gene            complement(120392..121303)
FT                   /db_xref="GeneID:4947821"
FT                   /locus_tag="Bcep1808_7429"
FT   CDS_pept        complement(120392..121303)
FT                   /locus_tag="Bcep1808_7429"
FT                   /gene_family="HOG000282225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   xcv:XCV4130 putative endonuclease"
FT                   /db_xref="GI:134288030"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="GeneID:4947821"
FT                   /translation="MRAAQCVCVALAVFVVTSANANAAPTTCPQHFAGGAAPDVHIPAL
FT                   QTRTYDTCHLSYAAQASGLTKTGIWSAEHLTRDSVRAARGIARFDDFRPDPAIPSRDRA
FT                   ELSDYSGRGYDRGHLAPSGDAPSPEAQDETFLLSNMVPQSHQNNGNLWEWIEHGTRVLA
FT                   QRDGEAYVVTGPAFIGPSLKQIGAGLYVPTHMWKAVFSPDRGAAVYVTLNAPGTGYSML
FT                   SVDEFIAFAGIDPFPAIPAATKQVIGPLLRPRHDRIEIKPVALNELADADASAVETAPN
FT                   HGSDRQYSSYRSAARTIARFWR"
FT                   /protein_id="YP_001110194.1"
FT   sig_peptide     complement(121232..121303)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7429"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(120563..121177)
FT                   /note="DNA/RNA non-specific endonuclease; prokaryotic and
FT                   eukaryotic double- and single-stranded DNA and RNA
FT                   endonucleases also present in phosphodiesterases.  They
FT                   exists as monomers and homodimers; Region: NUC; cd00091"
FT                   /db_xref="CDD:28975"
FT                   /locus_tag="Bcep1808_7429"
FT   misc_feature    complement(order(120824..120826,120836..120838,
FT                   120860..120862,120950..120952,120956..120961))
FT                   /note="active site"
FT                   /db_xref="CDD:28975"
FT                   /locus_tag="Bcep1808_7429"
FT   misc_feature    complement(order(120824..120826,120956..120961))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:28975"
FT                   /locus_tag="Bcep1808_7429"
FT   misc_feature    complement(120860..120862)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28975"
FT                   /locus_tag="Bcep1808_7429"
FT   gene            complement(121300..122778)
FT                   /db_xref="GeneID:4947822"
FT                   /locus_tag="Bcep1808_7430"
FT   CDS_pept        complement(121300..122778)
FT                   /locus_tag="Bcep1808_7430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288031"
FT                   /db_xref="GeneID:4947822"
FT                   /translation="MKPQDFPTLLASLKTPRALSRLEESLRHLSVGLEVGQISNTHWTE
FT                   AKQNINRILGDAYSEHVRSTAFGHIKAIADLPEPVQELYWGTAPQLHTIGSWTKRMAKF
FT                   KVDHPLATCIREFLQEVKPLGDAAEQLKTVVVKRATKAVEDQKPRYTPPRASTGAIVKV
FT                   REALETITKNSFEELREGFFRKYKGFIDQYMTSEGACESPKHPYDFFVRGKERNSEAYH
FT                   ITSRCLETMPHGTNNVRPRLLPNHEAILGEIAEREAKDIRDTFVFKNLSKLASIVDAKD
FT                   NLSSVEVLGYSIQLTSLRGNLRLTFEDGSNFDVQNSVVWSRSVNDKVFLRYPLTFHQVV
FT                   MPDGTRMKQPSEEKMNTEFAGRYYGLVRAPENEKLLLQSFGLRLAPYDHSCGAFMAEAT
FT                   HAAMMRLAEFKGDFEADLHLRAFKPIDEMTASELEAELRWHDWANAIGATTADATGAER
FT                   AAAQAALDEIRRKDAIDQAFAGKAREEDTPRPGE"
FT                   /protein_id="YP_001110195.1"
FT   gene            123138..123692
FT                   /db_xref="GeneID:4947823"
FT                   /locus_tag="Bcep1808_7431"
FT   CDS_pept        123138..123692
FT                   /locus_tag="Bcep1808_7431"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288032"
FT                   /db_xref="GeneID:4947823"
FT                   /translation="MALSSLGEDPTASRIQAVQCAIGAMEIPDGARDEAVKAAVIAASV
FT                   KLAASDQRMSPIDRAFDQAEEALRSAQQQHTGSYWNAAVLRVRGSFIGWLRAEVSRATG
FT                   EIQLSEFLSEGDPDDTPDDEREVRDRETEGIHSCSRLIDELAAAGVRIVDLNGELRGGI
FT                   DCNAATHVTDADETVARDFTP"
FT                   /protein_id="YP_001110196.1"
FT   gene            123789..124547
FT                   /db_xref="GeneID:4947824"
FT                   /locus_tag="Bcep1808_7432"
FT   CDS_pept        123789..124547
FT                   /locus_tag="Bcep1808_7432"
FT                   /gene_family="HOG000263355" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA methylase N-4/N-6 domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   lmo:lmo0470 hypothetical protein"
FT                   /db_xref="GI:134288033"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="GeneID:4947824"
FT                   /translation="MLDKNNPVLMQGDCLELLETIPDNSIDMVCCDMPYGTTNCRWDAT
FT                   LDLRRLWAQYRRVTTENAAIVLFAQTPFDKVLGVSNLEWLRYELIWQKTHATGHLNAKK
FT                   MPMKAHENILVFYNKLPTYNPQKTTGHIRKTSVKRRDNTSVYGEQNFVELSYESTDRHP
FT                   RSVLTFPKDTQRIALHPTQKPLALIEWLVSTFTNEGDAVLDNCMGSGTTGEACQRLGRR
FT                   FVGMELDESHFAVASSRILSGGVPALRNAA"
FT                   /protein_id="YP_001110197.1"
FT   misc_feature    123813..>123893
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Bcep1808_7432"
FT   misc_feature    123864..124496
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Bcep1808_7432"
FT   gene            124584..126380
FT                   /db_xref="GeneID:4947825"
FT                   /locus_tag="Bcep1808_7433"
FT   CDS_pept        124584..126380
FT                   /locus_tag="Bcep1808_7433"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288034"
FT                   /db_xref="GeneID:4947825"
FT                   /translation="MKSTAITLLTRDEVAMALAALGEDPTLGRTDAVRSLIVRTSLSGG
FT                   DREKLIRQAADVARRKLDRLLSGDSVFPADVFVREAQVEARLREHGWRSSRMGGPADDR
FT                   GNYVAKTGNNAGSFIGLFSSGNHNGAEKLYPIAMTDEEIAGAIIEHVRQVELSRSASGR
FT                   LLATVVEFVNQHPEWWAEQGQKHGFALVPWIVDARSADSYSKATHSLREWVRLIDAGHL
FT                   DWHAGDDWEGATLEQARDELVRLDRIHSEVAFVIGAMPRDQLEEIAADNQVDFDKHATD
FT                   SELRAELIEVVAQRRSHEQVRDGAAPTQVNGAGEPPAVDMAERIVVPIAVEGRVKIALN
FT                   TLRRHELSLQNVLAVRGAGHFLALTLRESYEAIQQARGTLKEFRRLAPQNNVDAEAFIK
FT                   QCGGEPDFSVFGEPALPVGWTEATPGGLATNRDPDVGGIVDSEIGSGLWFAIANRDGIP
FT                   TLDGYGTRQAAFDALHEAINEATRVQRAGAMPSPSSGDLAAKYPARGSMPARVVEQLYI
FT                   TREAEYALLAKRERIDVSDLASLDRGARFMVADGLFDKCSGDARAALLTDASHGVRSTA
FT                   RLAGLELGSIEHAPASDTGPSI"
FT                   /protein_id="YP_001110198.1"
FT   gene            126603..128030
FT                   /db_xref="GeneID:4947826"
FT                   /locus_tag="Bcep1808_7434"
FT   CDS_pept        126603..128030
FT                   /locus_tag="Bcep1808_7434"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288035"
FT                   /db_xref="GeneID:4947826"
FT                   /translation="MITTTPFNPITGEEVLIALSSLGEDPDASRVERIRSKIDPMQVHS
FT                   GDRDEFVRHAVAEARQLVDNEKGFEVGGVKFSAVRTMTPRPHWRLKVLESGEIYEGGTA
FT                   GISNVSVPKMQADVEELFRRASNSDPIQFRAHLNLAEAGASADAVALAGAFQALYYTGK
FT                   RLPNCADDLDVRWGADAVEAIKRHESGGAARDAGSSSVEEAALADALGKIRKSVIDGAP
FT                   YTSSGLRGAEFKHARAAAMRFAPNWKVCVASYEGRQALLEAGGSVAASETIADGAAPPR
FT                   PDDKRERAQDEFEAYDFGAGVMVHDHDLWDMNDATDFTKLVYLGYPEDNPDSELHKVTF
FT                   HVGFRPDASIDQVYALEVQSGNLIGQRPAIEPIGAPSVARDAIGNLIGRFSATSAEERA
FT                   TIDHALTVYGFLIARNEHITLSQFADRIAASYDTSVPQNAAVVAALRDCAARPVMDNSK
FT                   KAADQAHMHDLDSPSMD"
FT                   /protein_id="YP_001110199.1"
FT   gene            128296..128604
FT                   /db_xref="GeneID:4947827"
FT                   /locus_tag="Bcep1808_7435"
FT   CDS_pept        128296..128604
FT                   /locus_tag="Bcep1808_7435"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288036"
FT                   /db_xref="GeneID:4947827"
FT                   /translation="MSNVKPACVQKASTATAGGAEKSQKRGRPATGVAMTGSERAEKRE
FT                   KELRAAGGRTLNRVRLGPEASSALNEIAPSYKSEREAIEAAIIGWARMGSRSSRRDA"
FT                   /protein_id="YP_001110200.1"
FT   gene            128614..129171
FT                   /db_xref="GeneID:4947828"
FT                   /locus_tag="Bcep1808_7436"
FT   CDS_pept        128614..129171
FT                   /locus_tag="Bcep1808_7436"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288037"
FT                   /db_xref="GeneID:4947828"
FT                   /translation="MSEAVRVRGGCRCVGHAGFGQQAVECHRVESRLAGRKPRLALGAT
FT                   FDGVAALRYDSCRSCSPERAEASFFSLRFPWVKRKNSSYFLGVRVSEYSIPKLPGPSVR
FT                   QDRQPRKCACRVRNWHRQVDGVKQTKTTHHTPYQKRKRSETRVSRELSSNCAHSLVFQF
FT                   SVVRHSTRLTAWPPRPHRYATR"
FT                   /protein_id="YP_001110201.1"
FT   gene            complement(129355..129738)
FT                   /db_xref="GeneID:4947829"
FT                   /locus_tag="Bcep1808_7437"
FT   CDS_pept        complement(129355..129738)
FT                   /locus_tag="Bcep1808_7437"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1250"
FT                   /db_xref="GI:134288038"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="GeneID:4947829"
FT                   /translation="MKILLDLGDLDTIADDDEVLSIIRNVVSNSHELESGELLYIASVT
FT                   AEVVESTSSTKPARSFLTWIKQQAKRDDPVGDLARDVRRDGNAPSGRVSKTGWLGYLRA
FT                   SNASSGAVAAFREAWDEFAAQLE"
FT                   /protein_id="YP_001110202.1"
FT   misc_feature    complement(129373..129507)
FT                   /note="Protein of unknown function (DUF1250); Region:
FT                   DUF1250; cl11485"
FT                   /db_xref="CDD:175284"
FT                   /locus_tag="Bcep1808_7437"
FT   gene            129794..130090
FT                   /db_xref="GeneID:4947830"
FT                   /locus_tag="Bcep1808_7438"
FT   CDS_pept        129794..130090
FT                   /locus_tag="Bcep1808_7438"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288039"
FT                   /db_xref="GeneID:4947830"
FT                   /translation="MFSCSERLLQHGRAILRAQQQIRNRREHLGHELQLNARTATMLCY
FT                   GTMKRRARCIKLRLILGRNGADRSAFGIGQNIAHEIVFDLFNYGGAPSASTLR"
FT                   /protein_id="YP_001110203.1"
FT   gene            complement(130288..130560)
FT                   /db_xref="GeneID:4947831"
FT                   /locus_tag="Bcep1808_7439"
FT   CDS_pept        complement(130288..130560)
FT                   /locus_tag="Bcep1808_7439"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288040"
FT                   /db_xref="GeneID:4947831"
FT                   /translation="MPNIERKEAFRKALVELVNAQIKSLGITPEEAAAVFAEEANAALD
FT                   HLGWKPHPQRAASEHLVAAAACLNDGRVIPVPGFDVLFPSSEAVN"
FT                   /protein_id="YP_001110204.1"
FT   gene            130997..131284
FT                   /db_xref="GeneID:4947832"
FT                   /locus_tag="Bcep1808_7440"
FT   CDS_pept        130997..131284
FT                   /locus_tag="Bcep1808_7440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288041"
FT                   /db_xref="GeneID:4947832"
FT                   /translation="MFPCSVLQLEKGPDLTAAIRARHKLPAHGRTMLIDQARNLLADFA
FT                   DQRDAAIAVALHPAGLTIAHLLGNAVARVLFEELGPRVRVCTAATAGLAI"
FT                   /protein_id="YP_001110205.1"
FT   gene            complement(131425..131745)
FT                   /db_xref="GeneID:4947833"
FT                   /locus_tag="Bcep1808_7441"
FT   CDS_pept        complement(131425..131745)
FT                   /locus_tag="Bcep1808_7441"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288042"
FT                   /db_xref="GeneID:4947833"
FT                   /translation="MMDKANRAVQQVVSGATTKASDALKEWPRHGETIGGSRWFEGVPS
FT                   VGIVDREVVWHCPTTGCEGVMKFNGSVWPTGVPGYHHTCTACAFTAAIKGALFGSPDGD
FT                   DE"
FT                   /protein_id="YP_001110206.1"
FT   gene            complement(131832..132155)
FT                   /db_xref="GeneID:4947834"
FT                   /locus_tag="Bcep1808_7442"
FT   CDS_pept        complement(131832..132155)
FT                   /locus_tag="Bcep1808_7442"
FT                   /gene_family="HOG000263356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288043"
FT                   /db_xref="GeneID:4947834"
FT                   /translation="MLAFAGLANADPMTSFNAANYTACDAHSVGAVLMAKKAVDQKRPV
FT                   EAIVNETYERPPVLDIKLSLLASDAIKAGYLHSADERSLQRFLTGVCYEGDLTGKELAP
FT                   KKP"
FT                   /protein_id="YP_001110207.1"
FT   gene            complement(132244..132504)
FT                   /db_xref="GeneID:4947835"
FT                   /locus_tag="Bcep1808_7443"
FT   CDS_pept        complement(132244..132504)
FT                   /locus_tag="Bcep1808_7443"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288044"
FT                   /db_xref="GeneID:4947835"
FT                   /translation="MDESGKFVSVRSIVKYLPDRTLAACAQEALGWKDTGTLPDGELRK
FT                   LVARLEAETGIDDLSSLAQAEAAVLREATLRFIVALPIFKV"
FT                   /protein_id="YP_001110208.1"
FT   gene            complement(132998..133348)
FT                   /db_xref="GeneID:4947836"
FT                   /locus_tag="Bcep1808_7444"
FT   CDS_pept        complement(132998..133348)
FT                   /locus_tag="Bcep1808_7444"
FT                   /gene_family="HOG000290185" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="toxin ChpB"
FT                   /transl_table="11"
FT                   /note="toxin of the ChpB-ChpS toxin-antitoxin system"
FT                   /db_xref="GI:134288045"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="GeneID:4947836"
FT                   /translation="MVRRVKFDRGDIVRVSLNPTIGREQQGDFRPALVLSPAAFNALGV
FT                   ALVAPITQGGECARFAGFAVPLSGSGTETQGVALVNMVRMLDLDARGARKIERAPAEVV
FT                   EDALARLQTIIE"
FT                   /protein_id="YP_001110209.1"
FT   misc_feature    complement(133001..133348)
FT                   /note="PemK-like protein; Region: PemK; cl00995"
FT                   /db_xref="CDD:174491"
FT                   /locus_tag="Bcep1808_7444"
FT   gene            complement(133342..133593)
FT                   /db_xref="GeneID:4947837"
FT                   /locus_tag="Bcep1808_7445"
FT   CDS_pept        complement(133342..133593)
FT                   /locus_tag="Bcep1808_7445"
FT                   /gene_family="HOG000289070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: ppu:PP_0770
FT                   PemI-like protein"
FT                   /db_xref="GI:134288046"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:4947837"
FT                   /translation="MELKIQKWGNSAAVRLPAVLLEQMHASVGGSLNADVRPDGVLLTP
FT                   ARRKYALDDLVAQCDANAPFPADMAAWGEVKPVGREAW"
FT                   /protein_id="YP_001110210.1"
FT   misc_feature    complement(133345..133593)
FT                   /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
FT                   cl00877"
FT                   /db_xref="CDD:174436"
FT                   /locus_tag="Bcep1808_7445"
FT   gene            133934..134347
FT                   /db_xref="GeneID:4947838"
FT                   /locus_tag="Bcep1808_7446"
FT   CDS_pept        133934..134347
FT                   /locus_tag="Bcep1808_7446"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288047"
FT                   /db_xref="GeneID:4947838"
FT                   /translation="MVDARVDRSTLRLLMKVVEYRDICEAVRRSSIDYHACINDAERGV
FT                   WLQCARARLRESAEAECARATNVDRERMNLATRALRVLIADVEVGDALASAVKSSAATV
FT                   GGRESLASKYNRSPGRAVRLRRAARSAMRRGYF"
FT                   /protein_id="YP_001110211.1"
FT   gene            134368..134583
FT                   /db_xref="GeneID:4947839"
FT                   /locus_tag="Bcep1808_7447"
FT   CDS_pept        134368..134583
FT                   /locus_tag="Bcep1808_7447"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288048"
FT                   /db_xref="GeneID:4947839"
FT                   /translation="MHMTVQLIPESTAIDMIGPYLAAKAVCPACQYENVLVHIEGPTSP
FT                   VKPVSICQHITAHIVDDGISHFEFQC"
FT                   /protein_id="YP_001110212.1"
FT   gene            134708..135085
FT                   /db_xref="GeneID:4947840"
FT                   /locus_tag="Bcep1808_7448"
FT   CDS_pept        134708..135085
FT                   /locus_tag="Bcep1808_7448"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6021 hypothetical protein"
FT                   /db_xref="GI:134288049"
FT                   /db_xref="GeneID:4947840"
FT                   /translation="MSIAMPKDASSLACAFKVKLRCRMNDRMTIPQEIDDDVACGHEVV
FT                   VSAAGDTVWVNGGDGSCVGRFSKRFGIDVHRTVAEMLAGADQCLFCTHEPADAAAWATF
FT                   RADMAKHHGVVVPERLITFST"
FT                   /protein_id="YP_001110213.1"
FT   gene            complement(135208..136263)
FT                   /db_xref="GeneID:4947841"
FT                   /locus_tag="Bcep1808_7449"
FT   CDS_pept        complement(135208..136263)
FT                   /locus_tag="Bcep1808_7449"
FT                   /gene_family="HOG000114767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rme:Rmet_6282 integrase, catalytic region"
FT                   /db_xref="GI:134288050"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="GeneID:4947841"
FT                   /translation="MGTHYQHLSAEERATIMILLQQGCSARGIARTLRRSPSTITREIR
FT                   RALQWPQRTAFVPAGSGGCTYDARAAGARACAMRLKRRRHPKLAEDGVLFGVVHHFLLE
FT                   GWSPSQIAGTLKRMWPDDLDRRVSHETIYNCIYAMPRGELRKELIACLRRAQAKRMPRS
FT                   RGQDRRGQLPDAVSIHLRPPEANERAFPGHWEGDLLKGAANRSAVGVLVERSSRLVLLA
FT                   KLKDATAASALEGFTAKLRSIAEPMRKTLTYDRGKEMARHPELSEATGIRVYFCDPRSP
FT                   WQRGSCENINGLLRQYLPKGTDLSVYSQEELDAIADRLNSRPRAIHGFYPPIAVYQAML
FT                   EKVTQASHSLQ"
FT                   /protein_id="YP_001110214.1"
FT   misc_feature    complement(135238..136263)
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Bcep1808_7449"
FT   misc_feature    complement(135370..>135519)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bcep1808_7449"
FT   gene            136739..136936
FT                   /db_xref="GeneID:4947842"
FT                   /locus_tag="Bcep1808_7450"
FT   CDS_pept        136739..136936
FT                   /locus_tag="Bcep1808_7450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288051"
FT                   /db_xref="GeneID:4947842"
FT                   /translation="MEKMSVFATAQQELSEMLKVQVAITQWDDAIAHGKVKIEDVSEEA
FT                   LEGHRARIRRLEAIKDKYDL"
FT                   /protein_id="YP_001110215.1"
FT   gene            137142..137483
FT                   /db_xref="GeneID:4947843"
FT                   /locus_tag="Bcep1808_7451"
FT   CDS_pept        137142..137483
FT                   /locus_tag="Bcep1808_7451"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288052"
FT                   /db_xref="GeneID:4947843"
FT                   /translation="MQQGSEVVRCRKASSRGDTVGAAAERARLKASVAGAAIDLSAAAH
FT                   LPAVLRRALKVLKRLEEGAHPLSLGAQILVRRGGDFSVPIGYSYRLLVDACTLRPTLFI
FT                   SHETYNGLV"
FT                   /protein_id="YP_001110216.1"
FT   gene            137875..138309
FT                   /db_xref="GeneID:4947844"
FT                   /locus_tag="Bcep1808_7452"
FT   CDS_pept        137875..138309
FT                   /locus_tag="Bcep1808_7452"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288053"
FT                   /db_xref="GeneID:4947844"
FT                   /translation="MALKNEEMLIRARPDSTAATCRICRMTFVTDDVDDVRAHGDEHKK
FT                   LAKGAMPRVIREMLKGFGYAIAHNDGGLERLKDRYTAEDGTLAVAYSWWSRALMHGVPT
FT                   ADFDDYMAAHIHYADALAGRTGVPIEEAGRAIKRWERYAG"
FT                   /protein_id="YP_001110217.1"
FT   gene            138324..138725
FT                   /db_xref="GeneID:4947845"
FT                   /locus_tag="Bcep1808_7453"
FT   CDS_pept        138324..138725
FT                   /locus_tag="Bcep1808_7453"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288054"
FT                   /db_xref="GeneID:4947845"
FT                   /translation="MATVNRQDVLTRLGAAAVDIVLGALRHADHGGTFKGLFTLNVDGS
FT                   SKPVLLIGAAHGTHEDGQVIAILNPDEELSARVHAGVSYTGGLLKEIIAGKCDAMVHLW
FT                   IEAYRKDPASVIDTYQPRTDPEAAKFEVR"
FT                   /protein_id="YP_001110218.1"
FT   gene            complement(138730..139965)
FT                   /db_xref="GeneID:4947846"
FT                   /locus_tag="Bcep1808_7454"
FT   CDS_pept        complement(138730..139965)
FT                   /locus_tag="Bcep1808_7454"
FT                   /gene_family="HOG000193597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   cvi:CV2396 probable integrase/recombinase protein"
FT                   /db_xref="GI:134288055"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4947846"
FT                   /translation="MTELVDPANSILPRAISFDDIIAGRANVPVYGEPGYNRTRGVANL
FT                   IGVTDDLPAIWAWLAEFAGSPHTHRSYRKEIERFYNWLSVYLRKDLGSVVRDDIDRYIA
FT                   FVKNPPSDWVRQKSGRPRRDDDGFQPFTGPLSDASCKQAIVIVGSLFSWLVDARYLAGN
FT                   PFSIRRRKAKLSAQEKREEHKTGQAEQSDRYLPAPTARLLLQFLERQADEAEGRRAKRH
FT                   AERKLFVVRFLLNTGLRRDELASARMSDIYRRYDNASAQYYWTMQVIGKGGVVRTIALN
FT                   ETARNALQRYRSFFKASTHHTQNDCPIYLPLWGEQPNARPLDGQSIYKDVAKALEDAAD
FT                   ALAASYLDESLLLKAASPHWFRHTFASMLDGLGVSITTIQAQLGHASIETTSIYIDKGG
FT                   HEQYQAISQMSL"
FT                   /protein_id="YP_001110219.1"
FT   misc_feature    complement(138736..139773)
FT                   /note="site-specific tyrosine recombinase XerS; Reviewed;
FT                   Region: xerS; PRK05084"
FT                   /db_xref="CDD:167893"
FT                   /locus_tag="Bcep1808_7454"
FT   misc_feature    complement(138784..139773)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Bcep1808_7454"
FT   misc_feature    complement(order(138784..138786,138889..138897,
FT                   139153..139155,139246..139251))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7454"
FT   misc_feature    complement(order(138784..138786,138811..138813,
FT                   138880..138882,138889..138891,139153..139155,
FT                   139249..139251))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7454"
FT   misc_feature    complement(order(138784..138786,138811..138813,
FT                   138880..138882,138889..138891,139249..139251))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7454"
FT   gene            complement(139958..140413)
FT                   /db_xref="GeneID:4947847"
FT                   /locus_tag="Bcep1808_7455"
FT   CDS_pept        complement(139958..140413)
FT                   /locus_tag="Bcep1808_7455"
FT                   /gene_family="HOG000222532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6886 hypothetical protein"
FT                   /db_xref="GI:134288056"
FT                   /db_xref="GeneID:4947847"
FT                   /translation="MTIRLRTENTAMANTPQPARGEYDLAEYFRLKRPCKNCPFLKDGG
FT                   IELAPGRMEDIVNHLYASDENSFQCHETVHSEKFGGTWDDETGDYHPSGKEAHCAGATA
FT                   FLQKTGMSSKWMRIGYVTGALDFEQVRATMPAVIDSANNLSNPDQHD"
FT                   /protein_id="YP_001110220.1"
FT   gene            complement(140391..143876)
FT                   /db_xref="GeneID:4947848"
FT                   /locus_tag="Bcep1808_7456"
FT   CDS_pept        complement(140391..143876)
FT                   /locus_tag="Bcep1808_7456"
FT                   /gene_family="HOG000263357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sty:HCM1.195 hypothetical protein"
FT                   /db_xref="GI:134288057"
FT                   /db_xref="GeneID:4947848"
FT                   /translation="MNDSTAGTPSTALTTSSARDDATVDRVARFQSLQSGQYWRAAVAV
FT                   IEQGIEQGTVLLIQSIRWVDDKPHTVILRPHPSKIGREVKLAIPQDDGSSRTKWFRYDE
FT                   HRFLLDDFLNRFEYEPDHQPIRNSEVRAVQNRVNALQAELIETQSNPALLASVVDAGLR
FT                   AQAEQAAPQDASAADAESTSTPRPSLPAAPAAADSGIVSLTTGTVANAIGSGITAERIA
FT                   AMKAAASREHQIATIKANWIQSKTKAIADTITELTPYYEEQAAAALAQTEDVRTYVAKL
FT                   LQGIESLDLYVGKGVTVDTIREGTPAAPDVPLTFVQKKLVMDEELAVWTDIDEWFDFQH
FT                   EDKFFEALRAHDGLIDQIFPTERCVLVMATTRRFIDYGDARTNVARNEENAKVFLLVRN
FT                   GMNIHRVLSPVESHLGANRLFPTQSDQDAVFRGLDGSQIKFEDVAFTDKLAKHELFALH
FT                   YKRFLLLACGLDHRLKLFGHFYEGAPSLDFVSLAFQEQHCRFLHDDDASTQLPGGERQS
FT                   LTDWIEEKNAYLRSGSRVLCNWREVMNPDTAPGACKSNGSTSGRGFDARYTPQDRLTVA
FT                   IAYRDGKSICVDVEVSGYSYSSHGDRTFNCKVNLSKFRPGAWDYVDLPFLCLDAVDPMD
FT                   LRWYIHHRGSRSNHLAYIRFFKQALKHVERERDEDRDTRNQLMQALVDGNVADPADHDA
FT                   IIDQTVLAWRAANRGKPLPRFDGDHAPAAWTALLDQMYMLAGEGKRRVAEIESFVLALG
FT                   YRPLRLVLSGAAKCIVYAAPRADECDDRLERHAWVHRITVERGKTKYVEKSRRWVALPK
FT                   HAASETTLHEWNEASEWATRTSVFASFEHKAELFAATESFGAELAQFTQPLTELAHEDL
FT                   FERWKRLRAAMLDGASSVQNPVLAIPFGIVYNERARAVRFLCIGTALPHAFLHRLAPND
FT                   AAQQSVHSAFVRPYARKERAAQEMQKALQVDAPWALFDVSISAVKPDHEPFVDYAHELD
FT                   GQGNSPLLADWFDNWRTRVEKSGSVWVAPGAITADGRLALDPLLGIALPADYEPVRMLE
FT                   ITLTSPSDQHPPPYGRWIDICRGEETVRDRWHMGDSPEMKQLLASTPKARYNGYSRRTH
FT                   KAHSPRDAREFIARHVAAEYGARFRAVPATQIAEAPQPPEGIERFFVLDDPAAN"
FT                   /protein_id="YP_001110221.1"
FT   gene            complement(144044..144412)
FT                   /db_xref="GeneID:4947849"
FT                   /locus_tag="Bcep1808_7457"
FT   CDS_pept        complement(144044..144412)
FT                   /locus_tag="Bcep1808_7457"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288058"
FT                   /db_xref="GeneID:4947849"
FT                   /translation="MIQDNFHYRCYADPTAPANACLRPPGLGEEVLRRSRKTSQEAADF
FT                   IDYYFGGGALTLVAARWTYTGKLHENQGDPVYYVSFRIKERIFFYSGMCQILGGRFLRV
FT                   KINICAYLRIKLSCGIVL"
FT                   /protein_id="YP_001110222.1"
FT   gene            144496..145443
FT                   /db_xref="GeneID:4947850"
FT                   /locus_tag="Bcep1808_7458"
FT   CDS_pept        144496..145443
FT                   /locus_tag="Bcep1808_7458"
FT                   /gene_family="HOG000262914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6192 hypothetical protein"
FT                   /db_xref="GI:134288059"
FT                   /db_xref="GeneID:4947850"
FT                   /translation="MSRPAAVTADQIRTAVLAMLAEAGDAAPASGTRFRQIVSVRKLRA
FT                   RLGAGDPATLARALNAIEAEVVRAGLTEVAIPDLPPDIADLMRALWQTAVAVQLDDVVR
FT                   LKQAADANVVAAEAARTDAELRVELLRQEVQTLRTTLVTRDAELADLRAQHGVQRDRCA
FT                   SLEAQADERQVALDALTTEQASRDHAHTTALEAAQHRYEALSKQLLQETAHQREALKKE
FT                   HTHAVTQLKFAERRIAALEGERDRLDSEVVREREARQQAVGEALALKAVNAQQHAQLGD
FT                   LLRDIAPKPAQTARAGLATAKRATGSASTKRKGK"
FT                   /protein_id="YP_001110223.1"
FT   misc_feature    <144871..>145356
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bcep1808_7458"
FT   gene            145478..146959
FT                   /db_xref="GeneID:4947851"
FT                   /locus_tag="Bcep1808_7459"
FT   CDS_pept        145478..146959
FT                   /locus_tag="Bcep1808_7459"
FT                   /gene_family="HOG000262915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   rme:Rmet_5988 phage integrase-like SAM-like"
FT                   /db_xref="GI:134288060"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:4947851"
FT                   /translation="MNFADWIDTGATPPQRLPNGLDAAIAYVSDVLGQVVYLRWTLTLV
FT                   KRRFPSLADAKVAKPAVMRLLLDQSTAVEYWDRGRARVVSVDDAPASEAVLTRVLHAHG
FT                   RRFKFGEVALLAITSGEWFRESAPLVGGVPLALRPWFARAGRFAAVASATNTLGVGDDA
FT                   QATALFLRDRASRSPHTARAYLTEIRRLAAWCIAHELGPLSDLTRHDLLEYKRMLHRPS
FT                   QDVADDAQPEGRLSEATQARALAVVASLFQYWTETGYLTANPAAGLVRGQRRHAGFAPT
FT                   RMLSAAQLGACDAEVDAVDRDVEPLIAARRRAIWSLYRFAGVRLVELAWSDARQLPVLD
FT                   VDSNGCWTLHVCGKGQKPRAIPLPAGCVSRLQTYRRLRGLPEQPEPSEHVALVHGLKGG
FT                   TLQSSGLYDEVKAIFRAAAARLDPTDPPSAATLRRASPHWLRHAYARTLVVDRQVPLPA
FT                   AQALLGHASIQTTAGYAKTDLSQLRAFVDRAFDTD"
FT                   /protein_id="YP_001110224.1"
FT   misc_feature    145982..146947
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Bcep1808_7459"
FT   misc_feature    145982..146236
FT                   /note="Phage integrase, N-terminal SAM-like domain; Region:
FT                   Phage_integr_N; cl12235"
FT                   /db_xref="CDD:176623"
FT                   /locus_tag="Bcep1808_7459"
FT   misc_feature    146390..146902
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Bcep1808_7459"
FT   misc_feature    order(146447..146452,146537..146539,146783..146791,
FT                   146897..146899)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7459"
FT   misc_feature    order(146447..146449,146537..146539,146789..146791,
FT                   146798..146800,146870..146872,146897..146899)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7459"
FT   misc_feature    order(146447..146449,146789..146791,146798..146800,
FT                   146870..146872,146897..146899)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_7459"
FT   gene            complement(146956..147414)
FT                   /db_xref="GeneID:4947852"
FT                   /locus_tag="Bcep1808_7460"
FT   CDS_pept        complement(146956..147414)
FT                   /locus_tag="Bcep1808_7460"
FT                   /gene_family="HOG000222565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bma:BMAA1052 hypothetical protein"
FT                   /db_xref="GI:134288061"
FT                   /db_xref="GeneID:4947852"
FT                   /translation="MSRKSARRSGHRPLSKEMLLPLPLARTRALSLEHHLALATIAKGH
FT                   ANVDLMVCLLKAVYTAFYLRKETPATGDDAEFQRAEAALARCIARAERGETWVMLDRDK
FT                   VVIERILVLHDEQLASIPTHCYLTALDKLNRFAVEGLQSPIPPLATEP"
FT                   /protein_id="YP_001110225.1"
FT   gene            complement(147481..150417)
FT                   /db_xref="GeneID:4947853"
FT                   /locus_tag="Bcep1808_7461"
FT   CDS_pept        complement(147481..150417)
FT                   /locus_tag="Bcep1808_7461"
FT                   /gene_family="HOG000111179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   rme:Rmet_6212 transposase Tn3"
FT                   /db_xref="GI:134288062"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:4947853"
FT                   /translation="MDHWRLAYLGVRHFPHELTEFELNTFFTFSARERALIDGRRSHLY
FT                   RLAVALHLGFVRMTGRTLDAYKQVPNRLWQHLGEQLGIDSPDLGTLRALYDDRTDTLAD
FT                   HQRLAYDALGFKPMAEHQRRYVVRWLKERLSGRQDRSTALFDLKQWLYEHRVLIVHDRA
FT                   LQQLIVQAVQDVEAALIHRLEVAFGAAALDQWGMLLPRPESGGASLQQWVWSVPLRNST
FT                   NQMGELFRKIERLTKLGVHRDWPVECNEATVRHYARRCANRPPSVSKRIRQPVRQLEAA
FT                   CFMRYALCVATDQLLWMLARWQRKMVNEAGRKVDATRPDLKAQLREFATAVKALATDAT
FT                   LAHDALVARLVQLADTTLAQSGPSRASLVRAQLLTKQRVARAMLAKLLTLPFASQTPHP
FT                   VIDALEVLRTIYVCGERELPADVSVPVGRAWQRTVAGEDRVQALLAFEWATLSALRVAL
FT                   RNGSVFVEHSFAFRSQATLLIPDDTWKAQRNHFYGHLKLSQDPKEYIEPICAHLSEGLE
FT                   RLTQAVSRGEVRVDTAIHLDPASAQRAEPAVEALRRAIFNVHPDGQLPRILLEIDSETR
FT                   FSWLLLGREPRARSELLMVYAAVLAHGTSMSAAEVARMVPELSAGAIRQMMHRVADERV
FT                   LREAADAVLGFMHRHPIAAHWGRADLASSDMMSLETTRTVWQARADPRRRTASIGVYTH
FT                   VRDRWGIFYDQPIVLNERQAGVAIEGAIRQEGTDDVSQLAVDTHGYTDFGMAVARGLGF
FT                   DLCPRLAHLRDRRLHVPVSMSVPEALAAVVDRDVQLEAIEVIWDDFVRLVASIQSGHCT
FT                   AVQALTRFGAAARGLPLYDGGVALGRLFRSIYLIDYFTLPAFRAELQHVLNRGEAVHTV
FT                   QRAIHQGKIPVELTRHRHTLMAVSSSLSLLTNSVLAWNTMHMQQAIERIETLGQTPVLP
FT                   DYLRRIAPTYLEGINLRGTFEFPVADYAHRLMPSLAIGMPMAGREARG"
FT                   /protein_id="YP_001110226.1"
FT   misc_feature    complement(147568..150330)
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_7461"
FT   misc_feature    complement(147637..148581)
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bcep1808_7461"
FT   gene            complement(150649..151779)
FT                   /db_xref="GeneID:4947854"
FT                   /locus_tag="Bcep1808_7462"
FT   CDS_pept        complement(150649..151779)
FT                   /locus_tag="Bcep1808_7462"
FT                   /gene_family="HOG000230055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="high-affinity nickel-transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   rso:RS03927 hypothetical protein"
FT                   /db_xref="GI:134288063"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="GeneID:4947854"
FT                   /translation="MTEFSTLLQQGASNAWLFIPSAILLGALHGLEPGHSKTMMAAFIV
FT                   AIRGTVGQAVLLGLSATISHTAVVWAVALAGMYFGRNWNAETSEPYFQVASAVLIVGVA
FT                   AWMIWRTWRQQRLAHAHDHHDHDHHDHGDEAKLIDTGHGVVRLEVFEDGVPPRFRLYRQ
FT                   GRHSHVWSSDEVRIETERQDGSRQAFTFRMGDGFVESVQEIPEPHEFVARLSLGHGNHS
FT                   HDYDVEFVEHGHHHHAGADQDGLNISDAGYQDAHELAHANDIRRRFANREVTTGQIVMF
FT                   GLTGGLIPCPASITVLLLCLQLKKIALGATLVLCFSIGLALTMVVSGTLAAISLKHVSK
FT                   RWSGFGDFARKAPYFSGALIMLVGLFVGYQGVVALG"
FT                   /protein_id="YP_001110227.1"
FT   misc_feature    complement(<151429..151779)
FT                   /note="High-affinity nickel-transport protein; Region:
FT                   NicO; cl00964"
FT                   /db_xref="CDD:174483"
FT                   /locus_tag="Bcep1808_7462"
FT   misc_feature    complement(150655..>151128)
FT                   /note="High-affinity nickel-transport protein; Region:
FT                   NicO; cl00964"
FT                   /db_xref="CDD:174483"
FT                   /locus_tag="Bcep1808_7462"
FT   gene            complement(151789..152055)
FT                   /db_xref="GeneID:4947855"
FT                   /locus_tag="Bcep1808_7463"
FT   CDS_pept        complement(151789..152055)
FT                   /locus_tag="Bcep1808_7463"
FT                   /gene_family="HOG000023915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   vei:Veis_2756 protein of unknown function DUF156"
FT                   /db_xref="GI:134288064"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:4947855"
FT                   /translation="MTIHASHPDIIKRLKRAEGHLKSVIAMLEEGRPCVEVAQQLQAVE
FT                   SAVGNAKQALVRDHIDHCIDHAIHEGGSADAALTELKAITKYL"
FT                   /protein_id="YP_001110228.1"
FT   misc_feature    complement(151804..152037)
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="Bcep1808_7463"
FT   gene            complement(152230..153030)
FT                   /db_xref="GeneID:4947856"
FT                   /locus_tag="Bcep1808_7464"
FT   CDS_pept        complement(152230..153030)
FT                   /locus_tag="Bcep1808_7464"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; KEGG: bxe:Bxe_B1189
FT                   ABC molybdenum transporter, fused ATPase and inner membrane
FT                   subunits"
FT                   /db_xref="GI:134288065"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="GeneID:4947856"
FT                   /translation="MWNDGIFWGSGVEPLTVAQQLAFPVDADAASARYWVDHLGLTALL
FT                   NRLPHQLSFGQRQRVAVARALTRHSHLLLFDEPFSALDTPRRRRLQRSLRELQREISAV
FT                   TIIVTHDPDEASLLADEVLVIDQGRVLQTGAIEQVFKQPASMRVAELLGLRNVGSGVIH
FT                   APGLIRVNDELFIETANRSIGVRQRVMWRVAARAIRPVGGPGSFEAVVDSIELRNGERF
FT                   ARVEIARVHFDLAIGDSSLVERHACHFAVDPDGVSVWIVGSEAT"
FT                   /protein_id="YP_001110229.1"
FT   misc_feature    complement(152257..>152988)
FT                   /note="ABC-type sugar transport systems, ATPase components
FT                   [Carbohydrate transport and metabolism]; Region: MalK;
FT                   COG3839"
FT                   /db_xref="CDD:33631"
FT                   /locus_tag="Bcep1808_7464"
FT   misc_feature    complement(152629..>152988)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7464"
FT   misc_feature    complement(152848..152877)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7464"
FT   misc_feature    complement(152800..152817)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7464"
FT   misc_feature    complement(152782..152793)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7464"
FT   misc_feature    complement(152695..152715)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7464"
FT   gene            complement(153076..154767)
FT                   /db_xref="GeneID:4947857"
FT                   /locus_tag="Bcep1808_7465"
FT   CDS_pept        complement(153076..154767)
FT                   /locus_tag="Bcep1808_7465"
FT                   /gene_family="HOG000220306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   reu:Reut_D6456 phage integrase"
FT                   /db_xref="GI:134288066"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4947857"
FT                   /translation="MKTRPTSPSAADIPTDFPDADALAALRAWYEGASSREAAHRYMQD
FT                   RLSHSQSARGVIGQIRRQLALYARNRQRADLATLFECPAQKRMHHARATTQAVELLRIM
FT                   PAPAPQIGDDIAHWLPNRAARTLHAAGIRTLADLTVRIPRRRQWWTVIPGLGPASARRI
FT                   EAFFAAYPALTERARALIIADRQSVVTPWEQLRLPHEIDGSAGAFRAPVSACILGVDND
FT                   YDAIQAWLALHESPATQRAYRKEAERLILWGIVARGKALSSLTTRDATDYRAFLRRPTP
FT                   RERWVGPPRPRTSTDWRPFVDNLSARSIAHALAVLSAMFRWLVEQRYVVANPFSGIKVR
FT                   GSKRAMALETSHAFTEGEWMLTRTIANGLEWSYGWQAPAAQRLRFMLDFGYATGLRISE
FT                   LADATLRSIEVDAAGDHWLHVVGKGGKPARVTLTPLARTALDRYLQERGLPVSRAHWNP
FT                   TTSLIGSLDDADAGIKPLRLWEVMRRFFRLVAQIIKNDHPVLAEKLHRASPHWMRHTHA
FT                   THAIARGVELSAVRDNLRHASISTTSIYLHTDDVKRARQFGQAFTD"
FT                   /protein_id="YP_001110230.1"
FT   misc_feature    complement(154192..154473)
FT                   /note="Phage integrase protein; Region: DUF3701; pfam12482"
FT                   /db_xref="CDD:152916"
FT                   /locus_tag="Bcep1808_7465"
FT   misc_feature    complement(153121..154098)
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Bcep1808_7465"
FT   misc_feature    complement(153127..153711)
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bcep1808_7465"
FT   misc_feature    complement(order(153133..153135,153160..153162,
FT                   153229..153231,153238..153240,153499..153501,
FT                   153580..153582))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Bcep1808_7465"
FT   gene            154911..157937
FT                   /db_xref="GeneID:4947858"
FT                   /locus_tag="Bcep1808_7466"
FT   CDS_pept        154911..157937
FT                   /locus_tag="Bcep1808_7466"
FT                   /gene_family="HOG000156427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   reu:Reut_D6457 transposase Tn3"
FT                   /db_xref="GI:134288067"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:4947858"
FT                   /translation="MINKNKLLSVFSDAEQEALYGLPDFDDAQRLEYLALTESELALAS
FT                   SRPSIPAQVYCILQIGYFKSKHAFFRFDWDEVEDDYDFVLSRYFHGEPFERKPITRHEY
FT                   YAQREQIAELYGYRPWVAAFLPQLMQQAAQIVRRDVTPGFVAAELIVWLNEHKMIRPGY
FT                   TTLQELVSEALSVERRRLGDLLTGVLDELTQTALDQLLVRDDTLSKLAALKQDAKNFGW
FT                   RQMVREREKRGTLQPLHEIARTLLPRLDISQQNVLYYASLANFYTVHDLRNLKADQAQL
FT                   YLLCYAWVRFRQLTDNLVDAMAFHMKQLEEESSAGAKQSLIAEQVKRHRETPQIGRLLS
FT                   LYVDDSVADPTPFGEVRQRAYKIMAKDVLQNTAQRMTVKPLSQLALHWLAVDGLAKRIR
FT                   RHLRPLYVELDFVGTSPDNPWLAALAWVKGAFAKQQRLSQRPLAECPAATLPKRLRPYL
FT                   LIFGADGQPTGLHADRYEFWLYRQIRKRFQSGEIYLDDSLQHRHFSDELVSMNEKADAL
FT                   AQMEIPFLQQPIDAQLDALAAELHAQWLAFNRELKQGKLTHLEYDKDTQKLIWRKPKTE
FT                   NQKVREQAFYEQLPFCDVADVFRFVNGQCQFLSALTPLQPRYAKKVADADSLMAVIIAQ
FT                   AMNHGNHVMARTSDIPYHVLDSTYQQYLRQATLHAANDCISNAIAALPIFPYYSFDLDA
FT                   LYSAVDGQKFGVERPTVKARYSRKYFGRGKGVVAYTLLCNHVPLNGYLIGAHEYEAHHV
FT                   FDIWYRNTSDIVPTAITGDMHSINKANFAILYWFGLRFEPRFTNLDDQLQELYCIDDPA
FT                   LYEKCLIQPIGQIDRQLITSEKTNIDQIVATLGLKEITQGSLIRKLCTYSQENPTRRAI
FT                   FEFDKLIRTIYTLRYLRDPQLERNVHRSQNRLESYHQLRSTIAQVGGKKELTGRTDIEI
FT                   EISNQCARLIANVIIFYNSAILSHLLTKWEASGNAKALARLTQISPAAWRHILLNGHYT
FT                   FQSDNKIDLDALIAGLELE"
FT                   /protein_id="YP_001110231.1"
FT   misc_feature    155223..157874
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_7466"
FT   misc_feature    156837..157784
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bcep1808_7466"
FT   gene            complement(157912..158586)
FT                   /db_xref="GeneID:4947859"
FT                   /locus_tag="Bcep1808_7467"
FT   CDS_pept        complement(157912..158586)
FT                   /locus_tag="Bcep1808_7467"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_D6458 hypothetical protein"
FT                   /db_xref="GI:134288068"
FT                   /db_xref="GeneID:4947859"
FT                   /translation="MRCVDVEHQRLYIVELEQRAIGGPRQIIVHHRAEIGFIPLAAIDT
FT                   PQQRLAGQHDLSLAIRARLLDLLALRLSCRFAGCFQLLQLFVCRIETTFQHVHSGVLFE
FT                   EAVCAGNRRAGVRRFVTFAPYCRAQVRTEGAISTNVGGMFGNTSIVQPPSRFGAIYAGR
FT                   QLPSARISITNSDVPTLSRQVLTTAGGKGLPGCGIVFHRNRNKGFQARTAENSITPIRA
FT                   LQ"
FT                   /protein_id="YP_001110232.1"
FT   gene            158633..159205
FT                   /db_xref="GeneID:4947860"
FT                   /locus_tag="Bcep1808_7468"
FT   CDS_pept        158633..159205
FT                   /locus_tag="Bcep1808_7468"
FT                   /gene_family="HOG000263181" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_D6459 hypothetical protein"
FT                   /db_xref="GI:134288069"
FT                   /db_xref="GeneID:4947860"
FT                   /translation="MLPTLRMNRNFVEALLAERAPCFAMGLVAEGQTHYACLALRPVDD
FT                   IPNDVTRSGFNFGHSIRGTDDFEVVHFGLEFYGYRIFNALINPSNFIARTILSHMVDTK
FT                   AFFFFAVNPSGGVTVFKSGIGECSLDSIESNLERILRSSTSDAQYDAALTTFSDHPDPV
FT                   GPMLHWVCRDCEDCLDLSHNVIELGPA"
FT                   /protein_id="YP_001110233.1"
FT   gene            complement(159295..160437)
FT                   /db_xref="GeneID:4947861"
FT                   /locus_tag="Bcep1808_7469"
FT   CDS_pept        complement(159295..160437)
FT                   /locus_tag="Bcep1808_7469"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B1189 ABC
FT                   molybdenum transporter, fused ATPase and inner membrane
FT                   subunits"
FT                   /db_xref="GI:134288070"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4947861"
FT                   /translation="MKRSTARPLVALAGLLAVYLCAPFVASIPQIGQADWAGVDWGTTW
FT                   SAVAVSAGSASVAALLILVGGVPLGYWLARSSSRAMALLGFVVQLPLALPPLTSGVLLL
FT                   FLVGPYSWVGRVTGGALTDSFAGIVLAETFVAAPFLIVAARSAFASIDPVFEDVAATLG
FT                   HHAGNRFFRVALPAAWPAIRAGLALAWLRAFGEFGATVMVAYHPYSLPVYTYVVFGGQG
FT                   LPAMMPLLLPTLAIAVICAMLSVYSRGARIDAAAPPVNGDEPPFAPPRAVIADALPNPC
FT                   LAVQLTKRLGTFSLDLNWTPSTKRLAIIGPSGSGKSLALRLIAGLEQNEGGTVMLGQLD
FT                   LGALPPERRQIGYTPQDYGLFPHMTGDLRRNPRKFRRSTL"
FT                   /protein_id="YP_001110234.1"
FT   sig_peptide     complement(160333..160437)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.613 at
FT                   residue 35"
FT                   /locus_tag="Bcep1808_7469"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(159805..160227)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(order(159832..159837,159844..159855,
FT                   159874..159876,159883..159888,159928..159930,
FT                   159979..159981,159988..159993,160003..160005,
FT                   160009..160014,160021..160023,160027..160029,
FT                   160033..160038,160126..160128,160132..160137,
FT                   160144..160173,160177..160188,160216..160218))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(order(159838..159855,160126..160170))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(order(159835..159837,160054..160056,
FT                   160126..160128))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(order(159907..159909,159919..159924,
FT                   159940..159978))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(<159343..159594)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(159487..159510)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(order(159370..159372,159484..159492,
FT                   159496..159501))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7469"
FT   misc_feature    complement(159370..159381)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_7469"
FT   gene            complement(160434..161309)
FT                   /db_xref="GeneID:4947862"
FT                   /locus_tag="Bcep1808_7470"
FT   CDS_pept        complement(160434..161309)
FT                   /locus_tag="Bcep1808_7470"
FT                   /gene_family="HOG000262918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bxe:Bxe_B1190 ABC molybdate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="GI:134288071"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR011587"
FT                   /db_xref="GeneID:4947862"
FT                   /translation="MGRKLLACCAMLAGVLIAKTSVAYEGTVDVLYAGSLVNVMERSVG
FT                   PAFEKDTGLRFHGYAAGSNKIANEIKGKLRRGDVFISASPKVNDGLMGAANGDHVTWYV
FT                   NFAESPLLIGYNSRSHFAGEFKSKRWDQVLREPGIRIGRTDPKLDPKGAFTVDMMKKAA
FT                   DFYHQPDLVEKTLGAPENPEQVLPEETLVGRLQSGQLDAGFFYSTETSDLKIPAVRPAP
FT                   ELQAKARYTLTILGDAPNPAGAARFVDFLLSAKGRALLKEHGVDVVKPTVAGNAQAVPP
FT                   SLQAVIDAAQ"
FT                   /protein_id="YP_001110235.1"
FT   sig_peptide     complement(161238..161309)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7470"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(160449..161297)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep1808_7470"
FT   gene            complement(161474..161680)
FT                   /db_xref="GeneID:4947863"
FT                   /locus_tag="Bcep1808_7471"
FT                   /pseudo
FT   gene            complement(161744..162691)
FT                   /db_xref="GeneID:4947864"
FT                   /locus_tag="Bcep1808_7472"
FT   CDS_pept        complement(161744..162691)
FT                   /locus_tag="Bcep1808_7472"
FT                   /gene_family="HOG000209225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bxe:Bxe_B1271
FT                   hypothetical protein"
FT                   /db_xref="GI:134288072"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:4947864"
FT                   /translation="MSSDLPSRPSRRSALKCLAFGGAGTLFVLSGGVLTPVELALAASS
FT                   KDKAAASVVPLFLQISDSHIGFNKEANPDVAGTLKQTIDYVNAMPIKPALAIHTGDITH
FT                   LSKPEEFDLAAQLLSGLNPITELHTVPGEHDVTDGPQGEYFKRFGKASDNRGYYSFDHN
FT                   GVHFIGLVNVLHFAPNALGSLGEDQLSWLESDLKARSSSTPIVVFAHMPMWTIYAPWGW
FT                   GTGDAGQAMSYLKRFGSVTVLNGHIHQIVSKVEGNVTFHTARSTAFPIPTAGNGPGPVP
FT                   LTVASDQLPRMLGVTSIKISRHPLAATVSDTTLA"
FT                   /protein_id="YP_001110236.1"
FT   sig_peptide     complement(162563..162691)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.692 at
FT                   residue 43"
FT                   /locus_tag="Bcep1808_7472"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(161879..162526)
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Bcep1808_7472"
FT   misc_feature    complement(161945..162523)
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="Bcep1808_7472"
FT   misc_feature    complement(order(161954..161956,162062..162064,
FT                   162290..162295,162389..162391,162500..162502,
FT                   162506..162508))
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_7472"
FT   misc_feature    complement(order(161954..161956,162062..162064,
FT                   162293..162295,162389..162391,162500..162502,
FT                   162506..162508))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_7472"
FT   gene            complement(162953..164095)
FT                   /db_xref="GeneID:4947865"
FT                   /locus_tag="Bcep1808_7473"
FT   CDS_pept        complement(162953..164095)
FT                   /locus_tag="Bcep1808_7473"
FT                   /gene_family="HOG000099341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c assembly protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   rme:Rmet_3282 cytochrome c assembly protein"
FT                   /db_xref="GI:134288073"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="GeneID:4947865"
FT                   /translation="MEYISNDNSGSLLTGRSAFDWFYAILIVGGAVFALMRYHEYMNVY
FT                   EETILILTAPTSILLGWHWKAARWTLMLIAILSLSAILLYAGDSSHSASNFFLKYLLSS
FT                   PTAILWMCTLFFLSTAFFWGGLVFKSELGFSLGSKLCWSATVLGSAGLMVRWYESYLLG
FT                   PDIGHIPVSNLYEVFVLFSLITAMLYLYYEERYETRAVGPFVLLVISASIGFLLWYTFS
FT                   RQADQIEPLVPALQSWWMKIHVPANFIGYGGFALASMVAVSYLLKDRGLIVDRLPSLEL
FT                   LDDVMYKSIALGFLFFTIATILGALWAVDAWGGYWSWDPKETWALIVWLNYAAWLHLRL
FT                   VKGLRGRIAAWWALGGLLVTTFAFLGVNMFLAGLHSYGRL"
FT                   /protein_id="YP_001110237.1"
FT   misc_feature    complement(162962..163678)
FT                   /note="Cytochrome C assembly protein; Region:
FT                   Cytochrom_C_asm; cl00504"
FT                   /db_xref="CDD:174248"
FT                   /locus_tag="Bcep1808_7473"
FT   gene            complement(164244..164591)
FT                   /db_xref="GeneID:4947866"
FT                   /locus_tag="Bcep1808_7474"
FT   CDS_pept        complement(164244..164591)
FT                   /locus_tag="Bcep1808_7474"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhodanese domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rme:Rmet_6200
FT                   rhodanese-like protein"
FT                   /db_xref="GI:134288074"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:4947866"
FT                   /translation="MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASW
FT                   YAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAATLAQLGFAASYLEGGFAQWLADGL
FT                   PVTSHTPGNPS"
FT                   /protein_id="YP_001110238.1"
FT   misc_feature    complement(164295..164576)
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="Bcep1808_7474"
FT   misc_feature    complement(164388..164390)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Bcep1808_7474"
FT   gene            complement(164750..165343)
FT                   /db_xref="GeneID:4947867"
FT                   /locus_tag="Bcep1808_7475"
FT   CDS_pept        complement(164750..165343)
FT                   /locus_tag="Bcep1808_7475"
FT                   /gene_family="HOG000262919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6198 hypothetical protein"
FT                   /db_xref="GI:134288075"
FT                   /db_xref="GeneID:4947867"
FT                   /translation="MAATRTIHVRWIRKQEMSPMQTSDERARLSRSGVSHGRIAASLVR
FT                   SRRLFLRVNSNDAVKVGETAPFAMVRKRWMSPLTLALALFAIGSSEAIAQNASFKLLSA
FT                   AQIRAKLTNKYVSDNAHWLHHYLPDGRLVLVERGREKTGRWFVRNGQLCLVRSERISEP
FT                   ECLDIYAQGREVEYRDKGQVIAAGSIRSSPDRSH"
FT                   /protein_id="YP_001110239.1"
FT   gene            165455..166432
FT                   /db_xref="GeneID:4947868"
FT                   /locus_tag="Bcep1808_7476"
FT   CDS_pept        165455..166432
FT                   /locus_tag="Bcep1808_7476"
FT                   /gene_family="HOG000266560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate resistance exported protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5054 chromate resistance exported
FT                   protein"
FT                   /db_xref="GI:134288076"
FT                   /db_xref="GeneID:4947868"
FT                   /translation="MTSISTWSLLVLTLPTENATARMRFWRALKAKGAAVLRDGIYLLP
FT                   HTEEREQMLRELAVAIADSGGTAHLLRAPSLDASQEAEFRALFDRSDDYATFINSLADA
FT                   RKTVSGQSATDLTRLLRRLRKDYEALVATDYFPGDAATRAEVALQDLTALVDTVLSPGE
FT                   PHPAERVIRLLSCDAYQGRTWATRERMWVDRVASAWLIRRFIDADARFVWLASPGDCPP
FT                   DALGFDFDGAAFTHVGERVTFEVLLASFGLDKDQALVRLGEIVHALDVGGPAAPETVGF
FT                   EAVMAGTRRRAENDDQLLEQMGAVLDSLYAHFASNGKNETGGRS"
FT                   /protein_id="YP_001110240.1"
FT   misc_feature    166004..166396
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcep1808_7476"
FT   gene            166429..167616
FT                   /db_xref="GeneID:4947869"
FT                   /locus_tag="Bcep1808_7477"
FT   CDS_pept        166429..167616
FT                   /locus_tag="Bcep1808_7477"
FT                   /gene_family="HOG000263790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bam:Bamb_5053 chromate transporter, chromate ion
FT                   transporter (CHR) family"
FT                   /db_xref="GI:134288077"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4947869"
FT                   /translation="MTTTVATNAPTYSLGQLVGYMLRLGALGFGGPVALAGYMRRDLVD
FT                   QRGWITEADYKEGMTLAQMAPGPMAAQLAIYLGFVHYRLLGATLVGFAFVLPSFLMVVA
FT                   LGFAYAHFGGLSWMQAVFYGVGAAVVGIIAMSAYKLTTKTIGKDKLLWTIFLTLAAVTF
FT                   ITESEIAWLFIVAGLICWFWRAPPKWLNRGGLNAIAAANLPIASNLLSGVDLSVLTQIG
FT                   IFFTKAGAFVFGSGLAIVPFLYGGVVTEHHWLNDKQFVDAVAVAMITPGPVVITVGFIG
FT                   YLVAGFSGALVAALGTFLPCYLFTVIPAPYVKKYGHRPDVKAFVDGITAAAIGAITGSV
FT                   LVIAKRSIVDIPTAILALATVVLLWRFKKLQEPVIVTAAALIGLVAYPLIHSHAI"
FT                   /protein_id="YP_001110241.1"
FT   misc_feature    166462..166992
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_7477"
FT   misc_feature    166492..167577
FT                   /note="chromate transporter, chromate ion transporter (CHR)
FT                   family; Region: 2A51; TIGR00937"
FT                   /db_xref="CDD:162120"
FT                   /locus_tag="Bcep1808_7477"
FT   misc_feature    167080..167583
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_7477"
FT   gene            167754..168266
FT                   /db_xref="GeneID:4947870"
FT                   /locus_tag="Bcep1808_7478"
FT   CDS_pept        167754..168266
FT                   /locus_tag="Bcep1808_7478"
FT                   /gene_family="HOG000262920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288078"
FT                   /db_xref="GeneID:4947870"
FT                   /translation="METVMRLQLKSTLLATVNTSGAQWIVPTRLALAVLLLFPIDGSIQ
FT                   HLFAFRVADLSALSFSSAALGKALRAIEILAGLSFVAGLGARLAAYPTVVIFAVRALAN
FT                   SANSFPWLRDAMNGVIVPHGDWGYGAMYFGVALLLGEFLDVGSGRWSIDYWLSRKLKES
FT                   GEPRSGR"
FT                   /protein_id="YP_001110242.1"
FT   gene            168304..168894
FT                   /db_xref="GeneID:4947871"
FT                   /locus_tag="Bcep1808_7479"
FT   CDS_pept        168304..168894
FT                   /locus_tag="Bcep1808_7479"
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="manganese and iron superoxide dismutase"
FT                   /transl_table="11"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   rme:Rmet_6201 manganese and iron superoxide dismutase"
FT                   /db_xref="GI:134288079"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="GeneID:4947871"
FT                   /translation="MNCEMKQLACDPSRLAGLSEKLIVSHYENNYGGAVKRLNAITAQL
FT                   ASVDVASAPVFVVNGLKREELIAANSVILHEIYFDCLGASGKPAGDLEAALTRDFGSVE
FT                   RWAAEFSAMGKALGGGSGWVLLTWSPRLGRLVNQWASDHTHTLADGAPVLALDMYEHSY
FT                   HIDFGAKAAAYVDAFMENINWTNVADRFASVSG"
FT                   /protein_id="YP_001110243.1"
FT   misc_feature    168559..168873
FT                   /note="Iron/manganese superoxide dismutases, C-terminal
FT                   domain; Region: Sod_Fe_C; pfam02777"
FT                   /db_xref="CDD:145761"
FT                   /locus_tag="Bcep1808_7479"
FT   gene            168942..170366
FT                   /db_xref="GeneID:4947872"
FT                   /locus_tag="Bcep1808_7480"
FT   CDS_pept        168942..170366
FT                   /locus_tag="Bcep1808_7480"
FT                   /gene_family="HOG000003016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   sme:SMc00808 putative chromate transport protein"
FT                   /db_xref="GI:134288080"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4947872"
FT                   /translation="MEMNSVGPPRSDVPVFEAPAHERHGVSFREAFWVWVRVAALSFGG
FT                   PAGQIAVMHRILVEEKRWISETRFLHALNYCTLVPGPEAHKLAVYVGWLLHRTRGGLVA
FT                   GILFILPGLVALGVLSWIYATYGDVGYVQALFFGLKAAVLAVVLEAVVRVGRRALKTRT
FT                   MVAVAALSFIAIFFFAVPFPAIIVAAAAVGLIGRATGAMSPRGTAAQRETEHDDGPLPA
FT                   IDAAFAVEIPEHVRPSHARALKVTAIGLLLWLGPLFAFLATIGPDSVFTHIATFFSKMA
FT                   VLTFGGAYAILTYVAQQAVDHYHWLAPGEMLAGLGMAETTPGPLISVVQFVGFMAAFRQ
FT                   PGALDPAIAGTLGGILAKWATFAPSFLFIFIGAPYVEALRHNKALNAVLSTIMAAVVGV
FT                   ILNLAIWFAIHTLFAQVDVKQALGMTLQIPVLSSLDLWSLVLSAAAMVALFRFKLGMMT
FT                   TLAGCCVAGIVIHMIG"
FT                   /protein_id="YP_001110244.1"
FT   misc_feature    169020..>169340
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_7480"
FT   misc_feature    169755..>170165
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_7480"
FT   gene            170473..170793
FT                   /db_xref="GeneID:4947873"
FT                   /locus_tag="Bcep1808_7481"
FT   CDS_pept        170473..170793
FT                   /locus_tag="Bcep1808_7481"
FT                   /gene_family="HOG000262921" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6197 hypothetical protein"
FT                   /db_xref="GI:134288081"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947873"
FT                   /translation="MKPLFRFLSATSLVALCIALVGCEKSPFEKQPGETVAIAQVPAAV
FT                   KATIDRQSQGGSVKEIEKLTRNGKTFYRASVLQNGQEQKFVVAEDGALMATRAGDDEED
FT                   DD"
FT                   /protein_id="YP_001110245.1"
FT   sig_peptide     170473..170541
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.840 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7481"
FT                   /product="hypothetical protein"
FT   misc_feature    170593..170754
FT                   /note="Protein of unknown function (DUF2874); Region:
FT                   DUF2874; pfam11396"
FT                   /db_xref="CDD:151836"
FT                   /locus_tag="Bcep1808_7481"
FT   gene            170836..171291
FT                   /db_xref="GeneID:4947874"
FT                   /locus_tag="Bcep1808_7482"
FT   CDS_pept        170836..171291
FT                   /locus_tag="Bcep1808_7482"
FT                   /gene_family="HOG000109158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C1204 hypothetical protein"
FT                   /db_xref="GI:134288082"
FT                   /db_xref="GeneID:4947874"
FT                   /translation="MKWVTRERPKIDRIACPWLIARFIDKQPEFLYVPNRDVLRVAEET
FT                   GAIPYDIPGVELSHVDDLCSFDAFLKKYGLEDSALHQLATIIRGADTSRLDLTPQSPGL
FT                   FAISLGLSQTFSDDHEMLRHGMVMYDALYAWCQLCQAEKHNWPPQMN"
FT                   /protein_id="YP_001110246.1"
FT   misc_feature    170842..171246
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcep1808_7482"
FT   gene            171319..172242
FT                   /db_xref="GeneID:4947875"
FT                   /locus_tag="Bcep1808_7483"
FT   CDS_pept        171319..172242
FT                   /locus_tag="Bcep1808_7483"
FT                   /gene_family="HOG000108825" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function LppY and LpqO"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function LppY and LpqO;
FT                   KEGG: bpm:BURPS1710b_A1560 LpqO-like protein"
FT                   /db_xref="GI:134288083"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="GeneID:4947875"
FT                   /translation="MLKRSLFRRTVLASLFALVAVNASAAAGSPAMDTTSIEQVTGLKG
FT                   TFSKDENVFKVTKPRNDIKIQVDNWTMPPFMGLTSWAAFTPGHHGQTMMMGDTVLFDDE
FT                   VNPAMSAALDAGLEVTALHNHFFFDHPRVYFMHIGGSGDAKTLAEGVRKIYDRIAEVRA
FT                   AHAEPANAFPGRIADASSITSAPLEAILGRKGQTNSGMFKVSIGKPISMHGVSVGNEMG
FT                   VNTWAAFAGTDDEAVVDGDFAMRESELQTVLKSMRASGINIVAIHEHMTGETPRVLFLH
FT                   YWGKGKAVDLAKAVKGALVAQAGVEK"
FT                   /protein_id="YP_001110247.1"
FT   sig_peptide     171319..171396
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.607 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_7483"
FT                   /product="hypothetical protein"
FT   misc_feature    171418..171792
FT                   /note="Domain of Unknown Function (DUF1259); Region:
FT                   DUF1529; pfam07485"
FT                   /db_xref="CDD:148856"
FT                   /locus_tag="Bcep1808_7483"
FT   misc_feature    171871..172224
FT                   /note="Domain of Unknown Function (DUF1259); Region:
FT                   DUF1529; pfam07485"
FT                   /db_xref="CDD:148856"
FT                   /locus_tag="Bcep1808_7483"
FT   gene            172339..173095
FT                   /db_xref="GeneID:4947876"
FT                   /locus_tag="Bcep1808_7484"
FT                   /pseudo
FT   gene            173082..174467
FT                   /db_xref="GeneID:4947877"
FT                   /locus_tag="Bcep1808_7485"
FT   CDS_pept        173082..174467
FT                   /locus_tag="Bcep1808_7485"
FT                   /gene_family="HOG000262922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1125 hypothetical protein"
FT                   /db_xref="GI:134288084"
FT                   /db_xref="GeneID:4947877"
FT                   /translation="MRSPDPRSTAAILPALFRNEVRNLLTSRALWILLLILSPLVGYSF
FT                   IQAVSLFGEASRSALQSAELARGMTPLDGILVPTFGGFYLVVTLLFPFVAIRAVGQEKQ
FT                   SGALKLALQSPVRVPTLVATKVLAVGLVWLIVLLPAASAVAAWRLLGGHLYGPEVAGLL
FT                   FGHALYGLAVTAIAFFAAAVTESIATGAIVTLAFTIGSWVLDFAASGQVGWLAKLAPLS
FT                   LTATLREFEHGLFASAGALRTLTFSLALLALSVVWLPPGTRLRAKLAISIAMLFAAALL
FT                   VAGAGETRWYVELSEDQRNSFDPEDEAALRKIMAPLAITLYLSPDDSRAREMESDVLAK
FT                   LRRAVPRLTIRYASVKAGPFGASGDDRYGVIVYEYAGKHEESRSNSPREILPILYGLAD
FT                   VTVKPGAVTIYPGYPLVAEPAAAAWWFYGALPGLILYGWWRTRGAAPAPRRSGQSQPRE
FT                   KQS"
FT                   /protein_id="YP_001110248.1"
FT   misc_feature    173244..>173771
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Bcep1808_7485"
FT   gene            174464..175207
FT                   /db_xref="GeneID:4947878"
FT                   /locus_tag="Bcep1808_7486"
FT   CDS_pept        174464..175207
FT                   /locus_tag="Bcep1808_7486"
FT                   /gene_family="HOG000262923" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1124 hypothetical protein"
FT                   /db_xref="GI:134288085"
FT                   /db_xref="GeneID:4947878"
FT                   /translation="MKLHAIALACTLGMVVAPAVTAEDQVPAQSVSIDLAAETVGAEPV
FT                   NFIAAVGNWRIGADGNRKVLTVDGSKWQRGQPSAGLADKARALYGERYAEFLDNVTAYA
FT                   YFPIAVVKRIDDFRDGEISLRFKGIAGRIDQGAGIVFNLKPNGDYLVLRANCLENNLVL
FT                   FKYVHGVRSPVKWIRNTPTDTGRWHDLKLEVNGVSVKGYLDGKLYLEDTLAAPISGRIG
FT                   VWSKADSVMYFDDFRMITATRRPVS"
FT                   /protein_id="YP_001110249.1"
FT   sig_peptide     174464..174532
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7486"
FT                   /product="hypothetical protein"
FT   gene            175421..176476
FT                   /db_xref="GeneID:4947879"
FT                   /locus_tag="Bcep1808_7487"
FT   CDS_pept        175421..176476
FT                   /locus_tag="Bcep1808_7487"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p1B250 hypothetical protein"
FT                   /db_xref="GI:134288086"
FT                   /db_xref="GeneID:4947879"
FT                   /translation="MSMKKLAASGAIKKVDKFRAPIGMIHVREDNIRRADAQENIEHVR
FT                   SIYKALGEQFKTDLELCTEEGPRKGSMQLKKGHSLCVHDIVVAVDENDHISSIDGNSST
FT                   RALKMHAEEGIYIDDRFLVDVVTRNVESRQQVIVMMIRSGMAKNPSPLEFGLAFKELRD
FT                   GVDGGDKWSIKEIAEEFDRSEVSVRTLLKLADADPRIHALIDAGTVSSSVALDAVLKHG
FT                   DDAYSVLSADQQEVLATQGRSRVTQGAVKGRALPGKLVTSAIESIEALNERLDHRTRVE
FT                   LAKLEKLDPAQIKGKKIELDADLVLALVNAGGQIKDQRDRQAELAREKQAAAGQTTIEQ
FT                   DGSSDEERAAA"
FT                   /protein_id="YP_001110250.1"
FT   gene            176687..177211
FT                   /db_xref="GeneID:4947880"
FT                   /locus_tag="Bcep1808_7488"
FT   CDS_pept        176687..177211
FT                   /locus_tag="Bcep1808_7488"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288087"
FT                   /db_xref="GeneID:4947880"
FT                   /translation="MIRGHLDSAGPAVESTPKVGKPLTDRMLETLVELARGTRVESEEF
FT                   FAWPRWTFQSSINMRTSLGCPTRVMLKGLHERGLLEVRKGKTWLIQINDAGRQALIAHD
FT                   LVKKSKKASPFKRYSISYSITQLGSMRTAAQPVTARTEKEAFAKLTKSLKARNSHYEYT
FT                   DFKTEWVSANG"
FT                   /protein_id="YP_001110251.1"
FT   gene            177204..177575
FT                   /db_xref="GeneID:4947881"
FT                   /locus_tag="Bcep1808_7489"
FT   CDS_pept        177204..177575
FT                   /locus_tag="Bcep1808_7489"
FT                   /gene_family="HOG000263358" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:p1B214 hypothetical protein"
FT                   /db_xref="GI:134288088"
FT                   /db_xref="GeneID:4947881"
FT                   /translation="MADNILRELLRNEPNPVEKLASEQQQLKIHSGWFGELEQRTAHFL
FT                   KTGKRIVALECGHYVLSKSLHRAACPRCGEMIRSGYDYDGFRRLGMPDEFHWPEDPLLV
FT                   VNEGERRDGHDTITRRPVI"
FT                   /protein_id="YP_001110252.1"
FT   gene            177619..177954
FT                   /db_xref="GeneID:4947882"
FT                   /locus_tag="Bcep1808_7490"
FT   CDS_pept        177619..177954
FT                   /locus_tag="Bcep1808_7490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288089"
FT                   /db_xref="GeneID:4947882"
FT                   /translation="MRDNAGIASLTEGPMTKVIREPVDGWLILMNDEVGKRAAPGCLFR
FT                   FGRTASDGMHPLVEMLQPGWAAGTRYFVPFRDEAGVREFLLGLGFTEMPRVIPGESTPY
FT                   WNLDGKS"
FT                   /protein_id="YP_001110253.1"
FT   gene            complement(177961..178509)
FT                   /db_xref="GeneID:4947883"
FT                   /locus_tag="Bcep1808_7491"
FT   CDS_pept        complement(177961..178509)
FT                   /locus_tag="Bcep1808_7491"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288090"
FT                   /db_xref="GeneID:4947883"
FT                   /translation="MKMGTVWEYRYEYTDLDDGEVKLYPFWLTPAEAGRCHTLLENDFG
FT                   RRLQHTRRERIGPPAWREAYKVEPKGIKPLPEFDSPMHAELVALYRRERDPDVRRVILE
FT                   VVRARRVMGEIEDLYRAIRNEYKDALVAMNVLRCLLQKERWRVGGDFGSGSAVESKRRA
FT                   AVGADREGGGPDDTAKGDE"
FT                   /protein_id="YP_001110254.1"
FT   gene            178906..179379
FT                   /db_xref="GeneID:4947884"
FT                   /locus_tag="Bcep1808_7492"
FT   CDS_pept        178906..179379
FT                   /locus_tag="Bcep1808_7492"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288091"
FT                   /db_xref="GeneID:4947884"
FT                   /translation="MQMKVISASEAHLLLRAAFANGKHGGRCAQWAPPADGGRDWVLIN
FT                   LPLDWVAPNAAAERYDSTVDVDRARTYAASVGQFAPVHLLYGARLQRRNVLTAAVMDGG
FT                   HRVSAARMRGDTRILALLEQRHMEQLLEARAALLQDPMAVPRATEPAIDSCTA"
FT                   /protein_id="YP_001110255.1"
FT   gene            179399..179800
FT                   /db_xref="GeneID:4947885"
FT                   /locus_tag="Bcep1808_7493"
FT   CDS_pept        179399..179800
FT                   /locus_tag="Bcep1808_7493"
FT                   /gene_family="HOG000263359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppu:PP_3911 hypothetical protein"
FT                   /db_xref="GI:134288092"
FT                   /db_xref="GeneID:4947885"
FT                   /translation="MSFEYIRNYYGVPAERGRAVICSGKAGVIVGAHEQYIRVVLNDDK
FT                   SECERIYHPTDAVVYGELVDVPALREWRCLAPWRDEWEWEAWFTVTASTRSKARYKAFQ
FT                   HLSDVCDMDGKALIGIRVRAAIPHRRAKR"
FT                   /protein_id="YP_001110256.1"
FT   gene            179927..181477
FT                   /db_xref="GeneID:4947886"
FT                   /locus_tag="Bcep1808_7494"
FT   CDS_pept        179927..181477
FT                   /locus_tag="Bcep1808_7494"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288093"
FT                   /db_xref="GeneID:4947886"
FT                   /translation="MSENNLSPAAAHTTASADRQTAADAGPLERPFSVVVGELAAVRPM
FT                   VEAFIQARGGNVSGAAYAEMLSFAATIYRESVMQPAPSSADERAADEPIRIHKLWSSGG
FT                   CTGINDYLMTDYSIRTLKVSETGRDKVFPPNDGSYDVISPDNPYARTLTALKSRAAASP
FT                   AADDVGNWLWSELMEYCRERGIAPATAGRLFQLVPRARDKFAPQPAQADAPAAIGRIET
FT                   FSGKHGMTWLVEPSSLPESALVYAGNADAPTEEREPMNDVLFGNGESLEMAADALDRIG
FT                   QDSAAAGVRAVAYELRMLAHKMRCASDAAGEPIGAHDLSTSAGGRSYVAEFFAKRLRRH
FT                   DFGRYINELLAADFACTLAQYLRDKDAALQPPTQTEVPAEIHPPQAGGNKEKLPALART
FT                   REGHNLYSLGYNRGLKKGRGQIKPSDAWEGLTEEQIDTLKLAIGYIGSSERADRGDHVA
FT                   RLRDLLALHPGQPEPRAEVTDDDIISACDAHGITLPVEALEAATALVNHFTARAGGAR"
FT                   /protein_id="YP_001110257.1"
FT   gene            181474..182922
FT                   /db_xref="GeneID:4947887"
FT                   /locus_tag="Bcep1808_7495"
FT   CDS_pept        181474..182922
FT                   /locus_tag="Bcep1808_7495"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_4971 hypothetical protein"
FT                   /db_xref="GI:134288094"
FT                   /db_xref="GeneID:4947887"
FT                   /translation="MTTDVSHAVALTDGQLCAVQFATEALRAIAERREQADDVIRPLND
FT                   IRTASRRAAAALKRFEPVANALLAASSVEQPAVAPWRGACDHTTANIACRICREEHGDD
FT                   YDSRDAPASADVARAGAASINEFNGDTNTLIRSIMTLLEMDAAGALGAHGVGDHARNLL
FT                   GAAAARLAAVPPYEPGPKQPSRLVAQSAAPAEARAATCEAIDGAIAFGYQNTNVPPSDD
FT                   HWLAKYWHMGQKLAQLDALPASARYPIAWVRFRSDGGFEGPIMDSDERMCDTRRKSGAW
FT                   SPLFLGPAQATEPVAYRLLRRNIVSGEWVSDSRGWVDGAPSVDLLAETAARSSEWRVQV
FT                   AFAGPMPAALATFQQRVQPWMLACFGAEISTDVPERNHRFFEEAGELVQSRGMTREEAH
FT                   ALVDYTWSRPVGEPTQEVGGVMVTLAALCLANGLDMHAAGERELARVNEPSTIERIRAK
FT                   QATKPRHSPLPGVAARIGFHGSNA"
FT                   /protein_id="YP_001110258.1"
FT   gene            182919..183902
FT                   /db_xref="GeneID:4947888"
FT                   /locus_tag="Bcep1808_7496"
FT   CDS_pept        182919..183902
FT                   /locus_tag="Bcep1808_7496"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288095"
FT                   /db_xref="GeneID:4947888"
FT                   /translation="MTTSDQSLVDALVKRIKSMFVSNPQGEIGPSDEPDSQYRFGYNTA
FT                   LEDVLAALGEHQVEPASATQWRCFHCGEVFDERDAAALHFGTTERQVPACTIDVAEYRA
FT                   MEQRMSRYNEEDTDLHREIYTLQARHQSALRREEEKGYARGLADGAAHVQPDLDPAPDG
FT                   WVLVPKDRAAPTPDYDECARQATLASGLPSLRHAPWMSTFIREINRWCQHRYSNTIGGL
FT                   AGLVGGWNQIGGTLYRADHEGGGNRDEIRISVAEGSRDERVLAARAAELREQLNRIGPV
FT                   EPMTELVAELEWCIAEGSGGLRTRAALLQARTALQGCSFVPTKMPR"
FT                   /protein_id="YP_001110259.1"
FT   gene            184006..184311
FT                   /db_xref="GeneID:4947889"
FT                   /locus_tag="Bcep1808_7497"
FT   CDS_pept        184006..184311
FT                   /locus_tag="Bcep1808_7497"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288096"
FT                   /db_xref="GeneID:4947889"
FT                   /translation="MMTQQAGNYTVLEAGFGGVRPTPHAVMEAFLSKCYPGSRRDGPSE
FT                   EAQEGGYALQQAFTTVHGERMLAFLNPAASGGWRVAAKARVVAATVRSAPWDLTNV"
FT                   /protein_id="YP_001110260.1"
FT   gene            184304..185611
FT                   /db_xref="GeneID:4947890"
FT                   /locus_tag="Bcep1808_7498"
FT   CDS_pept        184304..185611
FT                   /locus_tag="Bcep1808_7498"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288097"
FT                   /db_xref="GeneID:4947890"
FT                   /translation="MSSRSFLYALQKTGVYLNGRSWIEEQLLDVQGWQRLFVEMVVADH
FT                   ARLLLRPATYGVEKWSDALNKIVAVLREYAFDDADIDRVIGAIHADSEIALVEIEIVRI
FT                   KGASDPNLPSHLFPGCGSDYVLFQLEVSDSELVISPNAVADAIVDLEMDAGLNEFDPDT
FT                   RTGSYYIVDGASEFAAGTRFLLGLNLSDPVTLLTDYVLRDYPRFDERDLAMPEVAVTQG
FT                   TSHEIAETPVVGERHATVDQSPRVSVEKLSGERTILIRESNAFALLRWPDYRLVRRLSV
FT                   RKALDHGEAGFNIWLDRSTTELPGAGDLVASCRSHSEALGLLAAIEAAILAESDPSETL
FT                   HGSAEANAQGTVAAPDRAASPHWAVVVLLGCAAVCGAIVAMPILFGAGDAVAKRLFPDP
FT                   RPAQALHSFPPALQGPGFLAPPLQPLPTVPRGRVNG"
FT                   /protein_id="YP_001110261.1"
FT   gene            185642..186730
FT                   /db_xref="GeneID:4947891"
FT                   /locus_tag="Bcep1808_7499"
FT   CDS_pept        185642..186730
FT                   /locus_tag="Bcep1808_7499"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ade:Adeh_0129 methyltransferase type 11"
FT                   /db_xref="GI:134288098"
FT                   /db_xref="GeneID:4947891"
FT                   /translation="MKRKEETAILAEEAFWTILANGKPPTVDLINARLLELGHGKRDRN
FT                   VVNGVAKECWDKVAGRVKDSFALPGIPAETVGLFVKLREDLLAVARAELNAERAEVEST
FT                   ARAAIEAAQQEAIAARLERDEALAARRETAAAFEAVAAERDGLRNELLAARQSNEAERE
FT                   RSIRAEKALEVLSARMEAESLRFVAEREAAEVDRKRQLLEIDGLRVELRATKEAEKDAQ
FT                   AKLSDTVARERELTARAAELVEQLGAANGAERVLKAHVGDMSRDVERLRAELASAVERA
FT                   VRATDQIERLEGDARALRAALEGRAAITEEQLNAALIQAWLNGATSAPKTSRGDDPTAS
FT                   LTPRATRYATSAMQMLGKTTNK"
FT                   /protein_id="YP_001110262.1"
FT   gene            187014..187310
FT                   /db_xref="GeneID:4947892"
FT                   /locus_tag="Bcep1808_7500"
FT   CDS_pept        187014..187310
FT                   /locus_tag="Bcep1808_7500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288099"
FT                   /db_xref="GeneID:4947892"
FT                   /translation="MMNTLTRLNLYPGAFASVGVTSEDIPEIVDCVLASSPDYVTVEGF
FT                   DQDTAAAIADRLSCMGISVHVAGSGERQWRTPLTIFNGLLDRIRSTPPRGDRG"
FT                   /protein_id="YP_001110263.1"
FT   gene            187307..187828
FT                   /db_xref="GeneID:4947893"
FT                   /locus_tag="Bcep1808_7501"
FT   CDS_pept        187307..187828
FT                   /locus_tag="Bcep1808_7501"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288100"
FT                   /db_xref="GeneID:4947893"
FT                   /translation="MIRLPGLVLDAALSERRWFALSSIEARRALFCLELVIHATSASLA
FT                   LCAALLLHRDGALWSVALLTAVAVALECGLGLPIGQFLRIERTRDRARVAYLNLAKQET
FT                   DRSDLWPDLAVAHALEMRDAATALIMISRWQGADFDDAKAELARRSRYLSEETVADPDE
FT                   AAVQADRPIF"
FT                   /protein_id="YP_001110264.1"
FT   gene            187938..188156
FT                   /db_xref="GeneID:4947894"
FT                   /locus_tag="Bcep1808_7502"
FT   CDS_pept        187938..188156
FT                   /locus_tag="Bcep1808_7502"
FT                   /gene_family="HOG000263188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_6383 hypothetical protein"
FT                   /db_xref="GI:134288101"
FT                   /db_xref="GeneID:4947894"
FT                   /translation="MRKAGKSLQDGKYRAVCREKNALAAAINGHSLIYPEADVELKDGT
FT                   AIFRKDGKIVWRCNAAYAELHFSLEPQ"
FT                   /protein_id="YP_001110265.1"
FT   gene            complement(188254..189597)
FT                   /db_xref="GeneID:4947895"
FT                   /locus_tag="Bcep1808_7503"
FT   CDS_pept        complement(188254..189597)
FT                   /locus_tag="Bcep1808_7503"
FT                   /gene_family="HOG000249894" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pst:PSPTO_4301 hypothetical protein"
FT                   /db_xref="GI:134288102"
FT                   /db_xref="GeneID:4947895"
FT                   /translation="MTIADSKPILTPMQALARYQEDLSLRLDDNRMGIVPGVIGTVFFA
FT                   RGSQPEVREAILECFDLFDEMFGEHLRGGKDSDLGKFTKRTAAGVQKIRRAIIDTPSYT
FT                   ELSVVRSSAIDQDTAGEYGIKVLTGTSLPAEYVSPTGRLRVPKGKESGLSYLKFNVPMS
FT                   LMASDEGIAQYETFLRYLCSRLSVRGGYGGLSPILPYSGHRYMPQEWALASRFSGLEID
FT                   STAHLIRDRYDPVSYEGESKDDMTAVYDYLHPGAKVGRWGFIKGVNWYTILGELYVERL
FT                   GGEGAIRSALDRADIRIERVGECLLIRAGSFPRLGAPEEGLPEPYVFVNTVLRQLRDPD
FT                   SDGLHTYIPDLPSADKGNAKGWYARFDLPGAQAIPAPPTVVPTTARHEHSRNSVRGGQP
FT                   CPESGWWDTPAKPGSRRYFSAGEIMPTFDGNQWGKTIWRWSPVQDSSE"
FT                   /protein_id="YP_001110266.1"
FT   misc_feature    complement(188500..189174)
FT                   /note="Protein of unknown function (DUF3396); Region:
FT                   DUF3396; pfam11876"
FT                   /db_xref="CDD:152312"
FT                   /locus_tag="Bcep1808_7503"
FT   gene            complement(189625..190893)
FT                   /db_xref="GeneID:4947896"
FT                   /locus_tag="Bcep1808_7504"
FT   CDS_pept        complement(189625..190893)
FT                   /locus_tag="Bcep1808_7504"
FT                   /gene_family="HOG000249895" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu0825 hypothetical protein"
FT                   /db_xref="GI:134288103"
FT                   /db_xref="GeneID:4947896"
FT                   /translation="MGSTLQPAGSTCTIVNEDPAYADLPPVTKGYLQEKVEIGLKMPRI
FT                   VYIRLPDGRTTVNLLKQVAMTLAIRYDERKADYYWPYKAEVSFDMTPYIATGKIAAPIP
FT                   FLAADKTLGPGRRHSLNPFPRRPDGSLGVIRRPDVIIVRNMGNRWPGRGNVDLDGAPHV
FT                   DNMLRLVEVKFPGDTWGEGQEAAYQGIAGDFLKRMTVIDVTDCNRELEKVRERALKNVP
FT                   APETEKELKRTRVPVRTVTPIAEPAWYEDWWNWAARHGEEIGNEVGDAVAPIWDAAKHG
FT                   YEYISSETSAFLHQHAPWIFTAGQWVSDKAHSAWVWVDEKGNEIYRYTTAQLKAGWDEI
FT                   VRQTDLTWEVLKQIDWAQVGATILKGIAAIVIVVAAVAIVIILAEALVAILAALCAIIA
FT                   AASAEALAALAIALGVSAVATAG"
FT                   /protein_id="YP_001110267.1"
FT   misc_feature    complement(190279..190656)
FT                   /note="VRR-NUC domain; Region: VRR_NUC; pfam08774"
FT                   /db_xref="CDD:149740"
FT                   /locus_tag="Bcep1808_7504"
FT   gene            complement(190916..193756)
FT                   /db_xref="GeneID:4947897"
FT                   /locus_tag="Bcep1808_7505"
FT   CDS_pept        complement(190916..193756)
FT                   /locus_tag="Bcep1808_7505"
FT                   /gene_family="HOG000148858" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rhs element Vgr protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG:
FT                   bch:Bcen2424_6904 rhs element Vgr protein"
FT                   /db_xref="GI:134288104"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="GeneID:4947897"
FT                   /translation="MDMRPRPPEDAQSASIFEAIHRGLMQQGRLLKLDTPLGANTLIPI
FT                   RAQGWAKIGRDYRWTLEAASTRDDLALLSLMHQPVTLWIQESTADAGAEYRPIQGFVNR
FT                   AALLGMDGGLAVYQIEFASALYFLGYSRDDRFWLEKTAADIVSDVLNRYPQLQGRFRFD
FT                   LSKQARVRSYCRQAETDLNFVSRILEDEGWYYYWAQSGADDKPEATLVIVDRVMSLPES
FT                   RSIEYYQAHANAENDGFSQWASLQVLQSLQYTSHAFDYTRPRSDFKANSALLETTYQND
FT                   RGRSCVTESIPFAPLTVFEQTSYGYSSTDDGESRARVRSEVWDSQANRSRGVGGVRWID
FT                   AGARFTLEHHPRYSGPAKDREFVAIEVSWLIENNVPIGRHIDSLPLSLRPILENAKSAY
FT                   GSRFACEGHEVDGSVGYFVVDVEVQRANVQYRSPLEHSKPVLRVEHARVNAPKGEEAWA
FT                   DKLNRVRVRFAWDRQSAQDAVNTSPLLLSMQSDTGSGYGAVHVPRANEWVAIDHFGGDC
FT                   DRPFIIGRLPGGETQPPWNTTVLFSGFQSRGFGNTGAFNAFVHDDATNQGAIRLTSYSG
FT                   GEGSSYSLLHQGYLIAQEGNTRGRYLGMGYLLHADHFGAIRANRGLYIGTHHVSYNGEQ
FT                   LDVTEARKQLANASSMMQSLSDLSTQHKVPPLSEGQAALQRFSSATQNDVTPNTSGGRT
FT                   AGGGTGSANGFKDPVLLLGSPAGIAASTPDSIHLAADMQMNVASGKSTHLAVGESLIAA
FT                   AAKSASLFAGDDLRVTAAKGALAIEAHGKGIDLIAQALVRILSAGDSIEIASSKEILIT
FT                   SGGASIRLKDGNIELHAPGKIDVKGSQHEFSGPASTTYQLPQFKPGYQARYILRNQTDG
FT                   SPMIRHAYEMKLPSGRTLTGHTNDLGETVTAYSPTAQDVSLRALEQEKVETKPWHFAGG
FT                   GQPQIFADYMDEADSA"
FT                   /protein_id="YP_001110268.1"
FT   misc_feature    complement(192059..193702)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: VgrG; COG3501"
FT                   /db_xref="CDD:33304"
FT                   /locus_tag="Bcep1808_7505"
FT   misc_feature    complement(192146..192391)
FT                   /note="Phage-related baseplate assembly protein; Region:
FT                   Phage_base_V; cl11432"
FT                   /db_xref="CDD:164221"
FT                   /locus_tag="Bcep1808_7505"
FT   misc_feature    complement(191216..191644)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2345); Region: DUF2345; cl01733"
FT                   /db_xref="CDD:154559"
FT                   /locus_tag="Bcep1808_7505"
FT   gene            194143..195111
FT                   /db_xref="GeneID:4947898"
FT                   /locus_tag="Bcep1808_7506"
FT   CDS_pept        194143..195111
FT                   /locus_tag="Bcep1808_7506"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: spu:588022 similar to ankyrin 2,3/unc44"
FT                   /db_xref="GI:134288105"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="GeneID:4947898"
FT                   /translation="MNAQKDFFDALAAGDSATARDLLRRKRVGVNARQGHGPHRGRTAL
FT                   MAAIAHDDLDLVAALIESGADVDACGTEHHSTALMLAAEEGKVRALHALLGHGAKMDVP
FT                   DIYGRTAAHYAVLKHPEQALHLYKAGASFDLPDEDGMTARALFETTAQVRSLERTMREL
FT                   EALVSSPGSTELVTPVAGKDDVFAAAYFGHVHCEKSDGEFLQSLGLATGEYDHDVGRFA
FT                   VSVPGPLSVDVTQYLTSFKYDFELLPVDAALICSDPNKLDSKDRRALRAYLTYELATTD
FT                   DSERIADLAARKEALVAAASITASALESPATIDVSIANNEP"
FT                   /protein_id="YP_001110269.1"
FT   misc_feature    194263..194571
FT                   /note="ankyrin repeats;  ankyrin repeats mediate
FT                   protein-protein interactions in very diverse families of
FT                   proteins. The number of ANK repeats in a protein can range
FT                   from 2 to over 20 (ankyrins, for example). ANK repeats may
FT                   occur in combinations with other...; Region: ANK; cd00204"
FT                   /db_xref="CDD:29261"
FT                   /locus_tag="Bcep1808_7506"
FT   gene            195157..196281
FT                   /db_xref="GeneID:4947899"
FT                   /locus_tag="Bcep1808_7507"
FT   CDS_pept        195157..196281
FT                   /locus_tag="Bcep1808_7507"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288106"
FT                   /db_xref="GeneID:4947899"
FT                   /translation="MRKPPDRPVQITAEDVLSTMAQLGRDATVSEAEALASNINSAGLP
FT                   DGVARDIALREMLAGKSESDLQALSAQDHPRLAFARVREILASHGEAAAEHQVGHYSSL
FT                   STLAETVRSSKCWSEGEIFSCALDETRFVIMKQVAPASCEMVTVSHMGFHDVLTAYRYD
FT                   QQELVDALNGYIAPAAAEIGHVGAAARDAAKPEFLFDLQLDASIRFRAQSETIAREELR
FT                   RHLDCANANLGEILGQTIVCEVSLNGTPALAEVDGVEPDNATRPVLFQSDPRPIVSLDP
FT                   NRPLYDDAGREHQLISASRTQVVTTILGVYGVWDRATGECLMTNAEGTRLSNEAPSPEW
FT                   VAARRQAAGEVLASMHADAAIKRARGDDSASMEI"
FT                   /protein_id="YP_001110270.1"
FT   gene            196296..196859
FT                   /db_xref="GeneID:4947900"
FT                   /locus_tag="Bcep1808_7508"
FT   CDS_pept        196296..196859
FT                   /locus_tag="Bcep1808_7508"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288107"
FT                   /db_xref="GeneID:4947900"
FT                   /translation="MKTPHVTDPLIGTDAWTTSISVQGKTAVYPCSITAVGDWKFDRAG
FT                   TPWRALTVFVPGFNAGSNIVVSADTVFVDEECTRSVDVGAAPAPRTSSAIAAPCDEHDV
FT                   GAGNLPFAIGQKFAFEPGQRVICNGYPGAVRGMYTEGMVEVRLDAGLVCVPASYPDCYP
FT                   SDGLNPATPSSRDRLESPAPAPDM"
FT                   /protein_id="YP_001110271.1"
FT   gene            196940..197239
FT                   /db_xref="GeneID:4947901"
FT                   /locus_tag="Bcep1808_7509"
FT   CDS_pept        196940..197239
FT                   /locus_tag="Bcep1808_7509"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2476 hypothetical protein"
FT                   /db_xref="GI:134288108"
FT                   /db_xref="GeneID:4947901"
FT                   /translation="MNARELENSLLVRCVEVARDPSAVAGDAREANVFRLAGMVVRSEF
FT                   PVAYSRLLASSQRYFDRHAGELLEPGEVVRKGWIVSLPRLHDMLENRLRMNHAR"
FT                   /protein_id="YP_001110272.1"
FT   gene            197236..197853
FT                   /db_xref="GeneID:4947902"
FT                   /locus_tag="Bcep1808_7510"
FT   CDS_pept        197236..197853
FT                   /locus_tag="Bcep1808_7510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppu:PP_2983 hypothetical protein"
FT                   /db_xref="GI:134288109"
FT                   /db_xref="GeneID:4947902"
FT                   /translation="MNLDPTFKLETALAKGLRELLELLEQSLDLKQPLQVYLAGGMAVH
FT                   LYTGSRVTSDIDAEFAGRVILPSDLAVVVRLEDGSEQVVYLDTNYNPTFALMHEDYQED
FT                   SRRLNLGLGQIRVNVLSPVDLAVSKIARLADNDREDIRELVRLGLTNADEIEKRANEAI
FT                   GGYVGGMEMLKMNLRDAVALARDAETASRPSSGSPEDPSPQP"
FT                   /protein_id="YP_001110273.1"
FT   gene            complement(197901..198290)
FT                   /db_xref="GeneID:4947903"
FT                   /locus_tag="Bcep1808_7511"
FT   CDS_pept        complement(197901..198290)
FT                   /locus_tag="Bcep1808_7511"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288110"
FT                   /db_xref="GeneID:4947903"
FT                   /translation="MLCNPRALATRLHGGRSFPVESDNREPSRSAADGAVFVLRSGGNV
FT                   LKKAGVSQGSARCTVDDPLCPSLYDGCGCLCDSHLDGTTLDQYRRRAVNAERMLLTLVR
FT                   SVRSGQVSDELLRSAARVAMEHEEK"
FT                   /protein_id="YP_001110274.1"
FT   gene            complement(198280..198711)
FT                   /db_xref="GeneID:4947904"
FT                   /locus_tag="Bcep1808_7512"
FT   CDS_pept        complement(198280..198711)
FT                   /locus_tag="Bcep1808_7512"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288111"
FT                   /db_xref="GeneID:4947904"
FT                   /translation="MSFNYDGLEFRTQLVARWAAFFDLAQWTWHTNAAPIGDWTPDFLV
FT                   SFPCGHSECPNEHRLLVSVLPVDNIDSVVGHPALQHRYSVEDHTGRSRADAGAVFGASP
FT                   LVSKWEMAHGAGGGVSTVPEWVTNHHELWVMAGGFVNAL"
FT                   /protein_id="YP_001110275.1"
FT   gene            complement(198745..199203)
FT                   /db_xref="GeneID:4947905"
FT                   /locus_tag="Bcep1808_7513"
FT   CDS_pept        complement(198745..199203)
FT                   /locus_tag="Bcep1808_7513"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288112"
FT                   /db_xref="GeneID:4947905"
FT                   /translation="MLKHWGNDARSNEVCLDDAGPWLVFWRPTISRNETDWGALSHTCN
FT                   GFSVDKLKGYALELNPTRGHQLMTAVANEEFCRTCTADRMDYGVEAEHKEAYRSWLAKN
FT                   GLAPGDMAQLKQAVYPLRLDRETLNIFGLDNTDIPAGAQLLVLGINCD"
FT                   /protein_id="YP_001110276.1"
FT   gene            complement(199336..199638)
FT                   /db_xref="GeneID:4947906"
FT                   /locus_tag="Bcep1808_7514"
FT   CDS_pept        complement(199336..199638)
FT                   /locus_tag="Bcep1808_7514"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288113"
FT                   /db_xref="GeneID:4947906"
FT                   /translation="MLENAAKSIGEKLVWSSDEDIAPRIASSNETFNPQADDAMAFRLQ
FT                   VGNNIRLDFMDNGQFATAKLGDIYELEKVENHDKRAAGRAAIVKVAAERGKSIID"
FT                   /protein_id="YP_001110277.1"
FT   gene            199752..200009
FT                   /db_xref="GeneID:4947907"
FT                   /locus_tag="Bcep1808_7515"
FT   CDS_pept        199752..200009
FT                   /locus_tag="Bcep1808_7515"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288114"
FT                   /db_xref="GeneID:4947907"
FT                   /translation="MTAFAIVFFACSRTLSGQVRRLALSGAARYAFHVDKAIGNACPAL
FT                   TTSSASACVIPAASISARSDAPLSETSLMASIYGVQVHQA"
FT                   /protein_id="YP_001110278.1"
FT   gene            complement(200069..200308)
FT                   /db_xref="GeneID:4947908"
FT                   /locus_tag="Bcep1808_7516"
FT   CDS_pept        complement(200069..200308)
FT                   /locus_tag="Bcep1808_7516"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288115"
FT                   /db_xref="GeneID:4947908"
FT                   /translation="MTIPSIEQVESLNGKIVAMLSEDEQAVLDFYRLQGRKYGVTISVV
FT                   NEANPEGLARATSREQADQLLKRSSSRVSVIVSQ"
FT                   /protein_id="YP_001110279.1"
FT   gene            complement(200354..200770)
FT                   /db_xref="GeneID:4947909"
FT                   /locus_tag="Bcep1808_7517"
FT   CDS_pept        complement(200354..200770)
FT                   /locus_tag="Bcep1808_7517"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288116"
FT                   /db_xref="GeneID:4947909"
FT                   /translation="MSIEMQRANGVKHWGETVAMVVCCVGAALLLHYLLLQYPRERRER
FT                   LWQKNGLNACSQASHHMADRIAGATGIKNKVFLVAIHMTDDNGSYACKADVKFTIDGHE
FT                   ESEIWSMEGSRKRPCVLTSAPFRGNDWATGSIIQ"
FT                   /protein_id="YP_001110280.1"
FT   gene            complement(200800..201618)
FT                   /db_xref="GeneID:4947910"
FT                   /locus_tag="Bcep1808_7518"
FT   CDS_pept        complement(200800..201618)
FT                   /locus_tag="Bcep1808_7518"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288117"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="GeneID:4947910"
FT                   /translation="MTTSHDTIYMLYAGDGRFLSGPYVGQPSLNIDSLADQFRAERYTQ
FT                   AEGAGDDYCWISEDDFPKWLVQRGLLAPLETVQADAVVDTSGDNRYVPKHWPTCPSCGQ
FT                   GKGDKEMGRVLHELNRADWHRKCTECGHTWDHHDRAYYFDQPMLEDDGRCVESGCVPYA
FT                   LSQAGAIPIDQVLEVCRECGWIEGNGIESDSGLEAARRLGLELIPCRDGRVAGTLTLRK
FT                   LFDRLSPSKNYIVAVRGHWLAFVRGENRDQSETHLRSEAIECWEVRQAVN"
FT                   /protein_id="YP_001110281.1"
FT   gene            complement(201831..202013)
FT                   /db_xref="GeneID:4947911"
FT                   /locus_tag="Bcep1808_7519"
FT   CDS_pept        complement(201831..202013)
FT                   /locus_tag="Bcep1808_7519"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288118"
FT                   /db_xref="GeneID:4947911"
FT                   /translation="MLATKWVVDALRANGAPGWVFNVADEDFDTEAEAMRWIETYRPYL
FT                   GANRIETRAVERIAA"
FT                   /protein_id="YP_001110282.1"
FT   gene            complement(202521..203177)
FT                   /db_xref="GeneID:4947912"
FT                   /locus_tag="Bcep1808_7520"
FT   CDS_pept        complement(202521..203177)
FT                   /locus_tag="Bcep1808_7520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   xfa:XF2027 hypothetical protein"
FT                   /db_xref="GI:134288119"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:4947912"
FT                   /translation="MKVSPIKLHKQAGKTPLPPIPKKLIDDWQNVVDTQLNVPGGTMLT
FT                   RLEAVYGYLDRYAEFVSTFSVCSKGCSHCCSIDVSVSRLEAEYIMRKGGPALDQQGKGQ
FT                   TTGHKDACTFLAADGSCSIYETRPFNCRTFFTLDDPKYCATPEVDHQVYGAASIGYGVS
FT                   VYAVIAMWIGDWQKQHNMPYRDIRDWFPRPSPEAIATVPKRSLIDRLFGRRRSEG"
FT                   /protein_id="YP_001110283.1"
FT   gene            complement(203178..203639)
FT                   /db_xref="GeneID:4947913"
FT                   /locus_tag="Bcep1808_7521"
FT   CDS_pept        complement(203178..203639)
FT                   /locus_tag="Bcep1808_7521"
FT                   /gene_family="HOG000263361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288120"
FT                   /db_xref="GeneID:4947913"
FT                   /translation="MDKKNDRRRPNPARALLERHSLGSAGFCVLILLALTGLPTLDLQL
FT                   TVALWCACLALPIFLSVYLAKEEILILRNRTEPKLEAALYAAILVAHTGLLLLGTAIAC
FT                   LASHHSPLLGVIVWFALATIYWLNSALERTVSGSQNPAPARQHDVREED"
FT                   /protein_id="YP_001110284.1"
FT   gene            complement(203642..204109)
FT                   /db_xref="GeneID:4947914"
FT                   /locus_tag="Bcep1808_7522"
FT   CDS_pept        complement(203642..204109)
FT                   /locus_tag="Bcep1808_7522"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288121"
FT                   /db_xref="GeneID:4947914"
FT                   /translation="MSGTVGRKIKMTKIIRGRPISRAGVKKFVSSPANWLNVAVTSLLL
FT                   KLVWDIEAEAIVALTPSWFVPVGLAIAAAGIIVSALTIEPKVGEVLSLAMLVFLPGVLY
FT                   VSMKASGSGAPASAQAVVAIVLLVGSWGVAIATWIDCAMRRLDRPVANREI"
FT                   /protein_id="YP_001110285.1"
FT   gene            complement(204136..204699)
FT                   /db_xref="GeneID:4947915"
FT                   /locus_tag="Bcep1808_7523"
FT   CDS_pept        complement(204136..204699)
FT                   /locus_tag="Bcep1808_7523"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288122"
FT                   /db_xref="GeneID:4947915"
FT                   /translation="MKRVFVLSLLCVAKVAIAQSTDLPSIAAAAHPVNPDLISAACTQA
FT                   VMREQTPVKRIDIRKLSIAKGMTDSTATCLIGAAIREGSGVASQSGIVTMNDVQYSVRV
FT                   DLRTGNTVLARVDTEQAAKAARDALAAMFIELRPIALSTDAASYSANVAGQKCKIEVAK
FT                   EKSTEPQQWLTKKIECAGGTAGRK"
FT                   /protein_id="YP_001110286.1"
FT   sig_peptide     complement(204643..204699)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.947 at
FT                   residue 19"
FT                   /locus_tag="Bcep1808_7523"
FT                   /product="hypothetical protein"
FT   gene            204929..205315
FT                   /db_xref="GeneID:4947916"
FT                   /locus_tag="Bcep1808_7524"
FT   CDS_pept        204929..205315
FT                   /locus_tag="Bcep1808_7524"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_B2568 hypothetical protein"
FT                   /db_xref="GI:134288123"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="GeneID:4947916"
FT                   /translation="MPAEILDPLFIRYHLALDFLRAGSTDASHVVTLAEVLIVSCALSD
FT                   LGSGDLSPEGVAAIEGALLECHENGTRTGSWVLSGEGYGVLCALLELHESQLRAAPLHL
FT                   VMKANKELLRRQCSAPHCAIGKAA"
FT                   /protein_id="YP_001110287.1"
FT   gene            complement(205325..205891)
FT                   /db_xref="GeneID:4947917"
FT                   /locus_tag="Bcep1808_7525"
FT   CDS_pept        complement(205325..205891)
FT                   /locus_tag="Bcep1808_7525"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288124"
FT                   /db_xref="GeneID:4947917"
FT                   /translation="MNAMSRITARAAFLLVAASLAGAAPAVCAHAVRVHGHTDRSLSRQ
FT                   DAFRSPVPDGTLDGAVDFTDVHFVPAKGRSGYLVPIPPRGDFDSVRINVRASHAGTNLG
FT                   VVRGGIVYWRRGRPVVAFSGMEGSGGQIIPVRGYFDVAALVPSPAPQRSFKAGENLLLV
FT                   RGAEIRLPLVIDHTEIPPSDAEDDD"
FT                   /protein_id="YP_001110288.1"
FT   sig_peptide     complement(205802..205891)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.676 at
FT                   residue 30"
FT                   /locus_tag="Bcep1808_7525"
FT                   /product="hypothetical protein"
FT   gene            complement(205908..206492)
FT                   /db_xref="GeneID:4947918"
FT                   /locus_tag="Bcep1808_7526"
FT   CDS_pept        complement(205908..206492)
FT                   /locus_tag="Bcep1808_7526"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288125"
FT                   /db_xref="GeneID:4947918"
FT                   /translation="MNHQRLVRATAVALTMGLSVVGPALAQSVRDSGITSPHEKTAGNT
FT                   VGVSASTAPSPKNAFYAVTMRRGKSVTQTSVSAIIGAAATAGFRTSAPDATCTFKSALG
FT                   TSTLQIAQGDDVSLTIVPAEEKDGAVATIIRATTSQAPQTPSKIIAGCPLFAGETKSEG
FT                   WLDASTLRVGQEMNARFGDTQISVRLTSLAD"
FT                   /protein_id="YP_001110289.1"
FT   sig_peptide     complement(206412..206492)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT                   /locus_tag="Bcep1808_7526"
FT                   /product="hypothetical protein"
FT   gene            complement(206548..207195)
FT                   /db_xref="GeneID:4947919"
FT                   /locus_tag="Bcep1808_7527"
FT   CDS_pept        complement(206548..207195)
FT                   /locus_tag="Bcep1808_7527"
FT                   /gene_family="HOG000193152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4468 hypothetical protein"
FT                   /db_xref="GI:134288126"
FT                   /db_xref="GeneID:4947919"
FT                   /translation="MKLRIVAAALAVGLVATGARAGDLYLQGGTQGVGIGYAQPLSSWA
FT                   GLHADINGFGLSHNFSAGDLDYDARLHLFNAGTYLDLFPFSSSSFRLTAGVLFNDDYID
FT                   GHAVSQNGSYKINGSSYYAPNASVSARVKYPTAMPYIGLGFGHKPVTKRGLGFTADVGV
FT                   AYGRPRVDYNVSPDLVAAAGAANVAAEEQKLRDKVDRYRFYPIVQLGLSYTF"
FT                   /protein_id="YP_001110290.1"
FT   sig_peptide     complement(207130..207195)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT                   /locus_tag="Bcep1808_7527"
FT                   /product="hypothetical protein"
FT   gene            complement(207398..208693)
FT                   /db_xref="GeneID:4947920"
FT                   /locus_tag="Bcep1808_7528"
FT   CDS_pept        complement(207398..208693)
FT                   /locus_tag="Bcep1808_7528"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288127"
FT                   /db_xref="GeneID:4947920"
FT                   /translation="MPLDYVALRSQIQERIKVLSPNAAQLTQDDLRQYFIERLTKRSAA
FT                   SEADAARSARADRIGLGVVSVASLGAVGSLIAAGPIAAPAVGAVAIGAAGYATARAIAN
FT                   TVRGLRDRDQRYRTGALLQASLDEQRREYERDQSGGFFKRLYRDVADRFKRHGATIEQL
FT                   NNRIDHLQVPRGETYASAVQQEIDRVMTPEITDFVNRTALDRHSASARLLARLSTIADL
FT                   SAPGGELRRVDTGRSARGRAALAAMGIGSGERGVLSPAADLSAQQLLGVPRSALPAASP
FT                   ASITYYGYIRTSEPDREFLASFGLELGPFNAEGGCFNVKASPAAFEQIAALNGAIGTIE
FT                   MYPLSDAIKAPDAVTAKVDLDKLSETELSAYGAFVVHATVTDAPPRDAVERSRRASLVA
FT                   AGHAVADEWERRRSVELVASADGRPLTSGLEM"
FT                   /protein_id="YP_001110291.1"
FT   gene            complement(208704..209006)
FT                   /db_xref="GeneID:4947921"
FT                   /locus_tag="Bcep1808_7529"
FT   CDS_pept        complement(208704..209006)
FT                   /locus_tag="Bcep1808_7529"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288128"
FT                   /db_xref="GeneID:4947921"
FT                   /translation="MQEGIDLENHPVVRELDAERDRLQQAGDVIVNDLKARGSALPKDQ
FT                   HDAMKEVLGAVVEYTDTLNLARAGIFASTVHPDDPQLDRLIARSNAVSTSILAAA"
FT                   /protein_id="YP_001110292.1"
FT   gene            complement(209548..209832)
FT                   /db_xref="GeneID:4947922"
FT                   /locus_tag="Bcep1808_7530"
FT   CDS_pept        complement(209548..209832)
FT                   /locus_tag="Bcep1808_7530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288129"
FT                   /db_xref="GeneID:4947922"
FT                   /translation="MNGGGLLDFSGWCFWALPALGLWPAQIFADRKQERKVGFRCPACS
FT                   ADFSNARDTFKEHLKKCECGRALVLAILEDDDARNALGVAHDSMKRVTR"
FT                   /protein_id="YP_001110293.1"
FT   gene            209905..210282
FT                   /db_xref="GeneID:4947923"
FT                   /locus_tag="Bcep1808_7531"
FT   CDS_pept        209905..210282
FT                   /locus_tag="Bcep1808_7531"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288130"
FT                   /db_xref="GeneID:4947923"
FT                   /translation="MPPRLRRRSALFLKNLSYLCLAFFVRVLHRRSQTPGCFLASETRD
FT                   KAHLIGTHIGLPLHRGIATALHAEILTVLLDHNASIAICDRLTRTGQGPIVYRHKADHL
FT                   HQVPDLEIVEHHLILLSKNSG"
FT                   /protein_id="YP_001110294.1"
FT   gene            complement(210465..210842)
FT                   /db_xref="GeneID:4947924"
FT                   /locus_tag="Bcep1808_7532"
FT   CDS_pept        complement(210465..210842)
FT                   /locus_tag="Bcep1808_7532"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288131"
FT                   /db_xref="GeneID:4947924"
FT                   /translation="MKLALQRLGVATALATALTGARAASYVVDVQFPDDTTATPVTLDV
FT                   EDFGEPQTAKSPSGVFVAVAARHGLQGKMLESTVNVIDNAGTEQASSTGIATQYLLLDH
FT                   PLALRSPAGAAVVLTLKQIHE"
FT                   /protein_id="YP_001110295.1"
FT   sig_peptide     complement(210771..210842)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.948 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_7532"
FT                   /product="hypothetical protein"
FT   gene            complement(210856..211179)
FT                   /db_xref="GeneID:4947925"
FT                   /locus_tag="Bcep1808_7533"
FT   CDS_pept        complement(210856..211179)
FT                   /locus_tag="Bcep1808_7533"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288132"
FT                   /db_xref="GeneID:4947925"
FT                   /translation="MGPLRRATENDMANTTVEMMAAKNSEACEVDLYDVLKERVEAGEP
FT                   IYISGQRNAAIESAISGLAKEAGKPVRVVQMVETDTTSFQNASSDFVEAVRTNSNAGIT
FT                   LKN"
FT                   /protein_id="YP_001110296.1"
FT   gene            complement(211365..211628)
FT                   /db_xref="GeneID:4947926"
FT                   /locus_tag="Bcep1808_7534"
FT   CDS_pept        complement(211365..211628)
FT                   /locus_tag="Bcep1808_7534"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288133"
FT                   /db_xref="GeneID:4947926"
FT                   /translation="MTTTSAMGFSVGARVRVVPEVKVRYFEWSEQAKRGGWTGTIKSLC
FT                   GKTFADHVYVDFDLQPRQRHQRTREFIAIRDLALVGLTERGG"
FT                   /protein_id="YP_001110297.1"
FT   gene            complement(211704..211931)
FT                   /db_xref="GeneID:4947927"
FT                   /locus_tag="Bcep1808_7535"
FT   CDS_pept        complement(211704..211931)
FT                   /locus_tag="Bcep1808_7535"
FT                   /gene_family="HOG000229101" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_5379 hypothetical protein"
FT                   /db_xref="GI:134288134"
FT                   /db_xref="GeneID:4947927"
FT                   /translation="MASKVQATPLTQQEFLREAMTTLGMTRAEFAKRISVPIKTLDKWL
FT                   APNDTSDFRNMPDVVWAYVREILEWDKKNA"
FT                   /protein_id="YP_001110298.1"
FT   misc_feature    complement(<211725..211898)
FT                   /note="aspartate carbamoyltransferase; Provisional; Region:
FT                   PRK11891"
FT                   /db_xref="CDD:171326"
FT                   /locus_tag="Bcep1808_7535"
FT   gene            complement(212171..212893)
FT                   /db_xref="GeneID:4947928"
FT                   /locus_tag="Bcep1808_7536"
FT   CDS_pept        complement(212171..212893)
FT                   /locus_tag="Bcep1808_7536"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   reh:H16_A3257 type IV pilus prepilin leader peptidase 1"
FT                   /db_xref="GI:134288135"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="GeneID:4947928"
FT                   /translation="MLLQSNLLAVLLVAGVACGWMLNRVAVAAPRALAHAWQIPVELIF
FT                   CSSGPQSAVRQRIRALAVQLVAGVLAVMIAWRVGLSVRALSVAMFCGWITLLALIDLDT
FT                   QLLPDLLTLPFMGCGFACAIAGVFVPVSAALVGAVTGWAILMAAHWAARLRGRSQDAIG
FT                   QGDAKLLAAVGAWLGWNAVVDTLLVACLTCLLVVPVARWMKVMKAGSVFSFGPYLAVGG
FT                   IVSILAWPYGVVDFGFRP"
FT                   /protein_id="YP_001110299.1"
FT   sig_peptide     complement(212807..212893)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.890 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_7536"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(212213..>212551)
FT                   /note="Type II secretory pathway, prepilin signal peptidase
FT                   PulO and related peptidases [Cell motility and secretion /
FT                   Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion];
FT                   Region: PulO; COG1989"
FT                   /db_xref="CDD:32172"
FT                   /locus_tag="Bcep1808_7536"
FT   gene            complement(212893..213180)
FT                   /db_xref="GeneID:4947929"
FT                   /locus_tag="Bcep1808_7537"
FT   CDS_pept        complement(212893..213180)
FT                   /locus_tag="Bcep1808_7537"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288136"
FT                   /db_xref="GeneID:4947929"
FT                   /translation="MSLKSRPIVQVVHIESPPRAVMRSSFVAPVSPRIGDLGAVVDVVD
FT                   DGRGGVGYVVESVVEEGEHRGSTRWVALFSVRELCASSDLGQVLCRTAEA"
FT                   /protein_id="YP_001110300.1"
FT   gene            complement(213218..214567)
FT                   /db_xref="GeneID:4947930"
FT                   /locus_tag="Bcep1808_7538"
FT   CDS_pept        complement(213218..214567)
FT                   /locus_tag="Bcep1808_7538"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase central domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: sto:ST1711 hypothetical cell division control
FT                   protein"
FT                   /db_xref="GI:134288137"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="GeneID:4947930"
FT                   /translation="MSKPINPSPQARVPMWQQAINFHKAEYPDDFGLIVKDEHYYPRLA
FT                   ELLLDRRKKKVHSYLDIEPISSSLMVSNSRPTVVKTKAGNRLMFGDASGAFRVRLSKDH
FT                   VIHILRSRLNSKVAIEYAIGTRAAMLELHNLVNAGMRKFRRVLPKSGVWDIGIFDKQVY
FT                   YTKVDTTVLKEAERFTVHPKFAEIEADFLQFFEEIELYTRYGQSGMRKVLMAGPPGTGK
FT                   TTIAQALAAKHSKNIACVQVDGKYLASACTEAAKYKRPTIIIAEEVDHFYHADAEVLSF
FT                   LDGMRTPKNPAGTYVIFSTNYPKRIDPRILKRPGRIDKIVPVAAFRSKAAAQCARMYLP
FT                   EGVSIDDKTLGYLLDRTTPAEIKEIMIIALGIARARKSAFDSEAIRFAREHLTGVLKET
FT                   LEICADDMDARDSDHRRLGSQPDYMSYLHDDPPEASDSEDAPDAVPAAAA"
FT                   /protein_id="YP_001110301.1"
FT   misc_feature    complement(213599..213940)
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Bcep1808_7538"
FT   misc_feature    complement(213596..213934)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7538"
FT   misc_feature    complement(213899..213922)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7538"
FT   misc_feature    complement(order(213665..213667,213770..213772,
FT                   213896..213919))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7538"
FT   misc_feature    complement(213767..213784)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7538"
FT   misc_feature    complement(213620..213622)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_7538"
FT   gene            complement(214599..216398)
FT                   /db_xref="GeneID:4947931"
FT                   /locus_tag="Bcep1808_7539"
FT   CDS_pept        complement(214599..216398)
FT                   /locus_tag="Bcep1808_7539"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SNF2-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rfr:Rfer_4467
FT                   SNF2-related"
FT                   /db_xref="GI:134288138"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:4947931"
FT                   /translation="MKNDLPPYLILPEHNTEPLGVLEKVKGPHGPLWQITGDPQMVTMA
FT                   KRLFPASEGRGAGIAKFPVNQRLFGELVWFLHRYPLDIVSKDEFLADYERSCAFVLKRQ
FT                   EILAHPIVRYPDVLFTGELRQFQQEGLDWILTNKRTLLADDMGLGKTVTASAVIATDPA
FT                   WPVLVTPPPHLVKHWEAFLARFLDVQDNSAGPLFSDGKLVVHVIRGTNRKKEPLPPAHI
FT                   YICHYLLLRHWREELAAAGLKKVIFDEAQELRHAGTEKYSAASELASIAEIVLALSGTP
FT                   IYGRGGEMWNVMNVVDYHCLGDWDTFTREWCAGYGSDVVKDPELLNATLRRDGLMLRRR
FT                   KEEVAAQLPAKERIVESVDSDQGIFAKFVTEAVRLAKSAKASPDRFERGRLQMQAIELT
FT                   RRATGVAKAPAVAAFVRGMLEAGEPTVVFAHHHDVVDYLQAELADFRPVLITGRQTEDQ
FT                   KWIAKESFIKGESLLCIVALRAATGIDGLQSRARVAVFAELDWSPAIHKQAEDRLHRDG
FT                   QQNPVLCYYLVSDAGVDPDMLENLGAKAQQFIGLMGDTPETATARELSESKARKHMQNV
FT                   LAKLVGGAGDAIVAADIDALVAG"
FT                   /protein_id="YP_001110302.1"
FT   misc_feature    complement(215556..215987)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7539"
FT   misc_feature    complement(215946..215960)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7539"
FT   misc_feature    complement(215646..215657)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Bcep1808_7539"
FT   misc_feature    complement(214824..215144)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7539"
FT   misc_feature    complement(order(214968..214976,215043..215048,
FT                   215100..215111))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7539"
FT   misc_feature    complement(order(214854..214856,214863..214865,
FT                   214875..214877,214944..214946))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Bcep1808_7539"
FT   gene            complement(216395..216778)
FT                   /db_xref="GeneID:4947932"
FT                   /locus_tag="Bcep1808_7540"
FT   CDS_pept        complement(216395..216778)
FT                   /locus_tag="Bcep1808_7540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288139"
FT                   /db_xref="GeneID:4947932"
FT                   /translation="MGEAPNFTAESVIRALRELRIGLAGQDEAYLSEQIADQLRALDLP
FT                   ARTEYRFGPHCRADVWVDGVVVEVKKRRPPRAALLSQIERYAAQPSCREIVVVLEKSVQ
FT                   LGAMIGGKRVHVVSLNSLWGVAL"
FT                   /protein_id="YP_001110303.1"
FT   gene            217141..217383
FT                   /db_xref="GeneID:4947933"
FT                   /locus_tag="Bcep1808_7541"
FT   CDS_pept        217141..217383
FT                   /locus_tag="Bcep1808_7541"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288140"
FT                   /db_xref="GeneID:4947933"
FT                   /translation="MLRVVSGWLLSSASALFILYLVLHLLAVARLWSTRELPDQWPANL
FT                   AIAVAIGAIGAAGLKYGISLTRKPVRIRTGQHQSR"
FT                   /protein_id="YP_001110304.1"
FT   sig_peptide     217141..217224
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.680) with cleavage site probability 0.301 at
FT                   residue 28"
FT                   /locus_tag="Bcep1808_7541"
FT                   /product="hypothetical protein"
FT   gene            217391..218707
FT                   /db_xref="GeneID:4947934"
FT                   /locus_tag="Bcep1808_7542"
FT   CDS_pept        217391..218707
FT                   /locus_tag="Bcep1808_7542"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: maq:Maqu_4217 hypothetical protein"
FT                   /db_xref="GI:134288141"
FT                   /db_xref="GeneID:4947934"
FT                   /translation="MDKEHAVNTSDVYAFKAVIAADRLALLRENLAKLNKRAAKHGVEP
FT                   FTIELGRYGNQFVEDRSEGFAANIRTVEVTLTGRRISLGDYRVMASIDHRNQAFQTFGD
FT                   FQIPGRYLDCDAECDHCKTKRDRAKTFLLADKSGDLIHIGSSCVESFTGYAPEFALGAT
FT                   SVWDQFSDMKEQLEGGDDGIRDCKMEAASPMRPFLAIVSRMIRRDGWVSSSLATANRES
FT                   GLQPAFSTSHSALDELKKLIERVGHEATVEPNVDQIDFEIASNALSHARASYADVPDRE
FT                   TVEAFDANMWSVSSHDTFINRHAGFAAFIVRKYRTEVLEANLANQFSGESQYVGTVKKR
FT                   EEFEFTLDKKIPLEGAYGTNTLCLMHDQQGNQLRWMASGLTDMEAGKSYRAKATVKKHE
FT                   EYKGIKQTILSRVSVTEELGNEQRIEAGAAEPQAIECSM"
FT                   /protein_id="YP_001110305.1"
FT   misc_feature    <218507..>218671
FT                   /note="replication factor A; Reviewed; Region: PRK07217"
FT                   /db_xref="CDD:168864"
FT                   /locus_tag="Bcep1808_7542"
FT   gene            218762..219151
FT                   /db_xref="GeneID:4947935"
FT                   /locus_tag="Bcep1808_7543"
FT   CDS_pept        218762..219151
FT                   /locus_tag="Bcep1808_7543"
FT                   /gene_family="HOG000222273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_6821 conserved hypothetical
FT                   lipoprotein"
FT                   /db_xref="GI:134288142"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947935"
FT                   /translation="MKKTTVTAVLAAVIALAGCASAGNQTLRSANPSEIEQHVVKGKST
FT                   KSDVEAYLGAAESVSFTDSGLEIWQYTYAKQTSKAINFIPVVGILAGGADVDKKVLTIL
FT                   FNDKGVVMKSTYAASKGEIRTGLAN"
FT                   /protein_id="YP_001110306.1"
FT   sig_peptide     218762..218830
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_7543"
FT                   /product="hypothetical protein"
FT   gene            219171..219410
FT                   /db_xref="GeneID:4947936"
FT                   /locus_tag="Bcep1808_7544"
FT   CDS_pept        219171..219410
FT                   /locus_tag="Bcep1808_7544"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288143"
FT                   /db_xref="GeneID:4947936"
FT                   /translation="MRSSPTPTNGEPIVPYYVQLTPDVLIALSALSATEHTAKLDAECR
FT                   DFVVLGGTHSPSGQSLDLSAQETAFNFGTQTSLL"
FT                   /protein_id="YP_001110307.1"
FT   gene            219459..219794
FT                   /db_xref="GeneID:4947937"
FT                   /locus_tag="Bcep1808_7545"
FT   CDS_pept        219459..219794
FT                   /locus_tag="Bcep1808_7545"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288144"
FT                   /db_xref="GeneID:4947937"
FT                   /translation="MFTISTPRDRLERSLPFMSAASAEACELVLAGKLTGLNGSLRDAL
FT                   ARTVGELADQLVTNGNISISNLLRLVALEATAAHPPEIPGGEQNRSNFARTLFEHLYGL
FT                   LTVCRPH"
FT                   /protein_id="YP_001110308.1"
FT   gene            219820..220515
FT                   /db_xref="GeneID:4947938"
FT                   /locus_tag="Bcep1808_7546"
FT   CDS_pept        219820..220515
FT                   /locus_tag="Bcep1808_7546"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288145"
FT                   /db_xref="GeneID:4947938"
FT                   /translation="MSPISNALIASVDASVKQQTLVALAPLLTYLVGYFVRRFSKTGTA
FT                   QKFNVAAAFALLFVGASPVAFGLASMLRLAVQMQTVQTVWETGSLLHDYAIVCKYDPSK
FT                   RRTGELEAAEKHLRQKDVLWKMANVSNPGRPLSATEPIPCDVTAVPDLREIQASMPLLV
FT                   RRSEYVTICAYTSSMLALVFVWLMIHPIQLRKRVRDGREGDAARVAPNSIDVEPSTAGS
FT                   DAVSSGAKW"
FT                   /protein_id="YP_001110309.1"
FT   gene            220601..220864
FT                   /db_xref="GeneID:4947939"
FT                   /locus_tag="Bcep1808_7547"
FT   CDS_pept        220601..220864
FT                   /locus_tag="Bcep1808_7547"
FT                   /gene_family="HOG000263362" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288146"
FT                   /db_xref="GeneID:4947939"
FT                   /translation="MPQIAAFVESLADAFGREYIEDLVRRGQQGEPTFFASENGIEVGT
FT                   RSPNPVTVWRCDLKALRDRHGCGGCDGSCIGTQQRCKRQNSV"
FT                   /protein_id="YP_001110310.1"
FT   gene            complement(221341..221598)
FT                   /db_xref="GeneID:4947940"
FT                   /locus_tag="Bcep1808_7548"
FT   CDS_pept        complement(221341..221598)
FT                   /locus_tag="Bcep1808_7548"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288147"
FT                   /db_xref="GeneID:4947940"
FT                   /translation="MAQIEGRLFKIDYLTRYWEVFSSGLGFFDGPAVRYALTLLVLLAQ
FT                   SDIVAVWYGADDYHDGAHIKRVTQEIAHRMIDEYIARKCT"
FT                   /protein_id="YP_001110311.1"
FT   gene            221692..222678
FT                   /db_xref="GeneID:4947941"
FT                   /locus_tag="Bcep1808_7549"
FT   CDS_pept        221692..222678
FT                   /locus_tag="Bcep1808_7549"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rso:RSp1179 TIS1021-transposase protein"
FT                   /db_xref="GI:134288148"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:4947941"
FT                   /translation="MKRQISFAEAECTGKKRVTRRQRFLTEMNSVVPWARLLAALEPYY
FT                   PKGTRGRPPIGLERMLRIYFLQQWYGLSDEGLEDALYDSIAMRAFAGIDLAVENVPDAT
FT                   TLLKFRRLLLEHDLTRRLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAEKQRDP
FT                   EMHQTRKGNEWHFGMKAHVGVDADSGLVHSVVGTAANESDVSQAHALLHGHEAHAFGDA
FT                   GYTGVEKREEMQGATVKWHVAIKRGKIKTMREGALKDLLIAAERTKAQIRARVEHPFHV
FT                   IKNLFGHRKVRYKGLAKNTAQLFSLFGLANLVLAKKSLLASHGSSPS"
FT                   /protein_id="YP_001110312.1"
FT   misc_feature    221842..222069
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bcep1808_7549"
FT   misc_feature    221878..222657
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bcep1808_7549"
FT   gene            complement(222842..223828)
FT                   /db_xref="GeneID:4947942"
FT                   /locus_tag="Bcep1808_7550"
FT   CDS_pept        complement(222842..223828)
FT                   /locus_tag="Bcep1808_7550"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rso:RSp1179 TIS1021-transposase protein"
FT                   /db_xref="GI:134288149"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:4947942"
FT                   /translation="MKRQISFAEAECTGKKRVTRRQRFLTEMNSVVPWARLLAALEPYY
FT                   PKGTRGRPPIGLERMLRIYFLQQWYGLSDEGLEDALYDSIAMRAFAGIDLAVENVPDAT
FT                   TLLKFRRLLLEHDLTRRLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAEKQRDP
FT                   EMHQTRKGNEWHFGMKAHVGVDADSGLVHSVVGTAANESDVSQAHALLHGHEAHAFGDA
FT                   GYTGVEKREEMQGATVKWHVAIKRGKIKTMREGALKDLLIAAERTKAQIRARVEHPFHV
FT                   IKNLFGHRKVRYKGLAKNTAQLFSLFGLANLVLAKKSLLASHGSSPS"
FT                   /protein_id="YP_001110313.1"
FT   misc_feature    complement(223451..223678)
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bcep1808_7550"
FT   misc_feature    complement(222863..223642)
FT                   /note="Transposase and inactivated derivatives, IS5 family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG3039"
FT                   /db_xref="CDD:32853"
FT                   /locus_tag="Bcep1808_7550"
FT   gene            complement(223996..224268)
FT                   /db_xref="GeneID:4947943"
FT                   /locus_tag="Bcep1808_7551"
FT   CDS_pept        complement(223996..224268)
FT                   /locus_tag="Bcep1808_7551"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288150"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="GeneID:4947943"
FT                   /translation="MAVGATIFVLFREPPPASRVGQLDGLIEHCTGARRAERTDEYERL
FT                   VVVDEADEYVDVGSDGMLIYYADPRVAAPREALINNVFVSIGLSN"
FT                   /protein_id="YP_001110314.1"
FT   gene            complement(224730..226409)
FT                   /db_xref="GeneID:4947944"
FT                   /locus_tag="Bcep1808_7552"
FT   CDS_pept        complement(224730..226409)
FT                   /locus_tag="Bcep1808_7552"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288151"
FT                   /db_xref="GeneID:4947944"
FT                   /translation="MKHDVIIPAGTRCVRVDGGGTTPAWEVDDLSFIHDKSSMLYNDAV
FT                   RYRIEVEESHLASIAPVDRRAGPAPEDIVRVVDGVERTPETAVREQYKDLIFTLQDAWG
FT                   HIHGSRNEDLKTRAQAILRECGDYADTPLVISTDLNVRIYRVLVGSKDLILGKASFASQ
FT                   SLRNKLSGVLDVHSLLTLGRKMPKAWFNIAHRTLMDYDYGTGVRWAEMSEIPWKPSTVA
FT                   NGWTTEVRVEFLQDVEHGFPATESQWLNFNVRFDPNANTLSEAFAMDDKGEIWGKPVRN
FT                   LSEQQVAENLREYLQKPELVDGWITPDAVALKDGSVKYTQYFRTPNGGLLLRSALDPDE
FT                   SESPDGLVRRFEAGERFIPEVMKLPVSTRETLNAAKLDRNLLEARLFEGEWSHLFGPGR
FT                   AETQCRIVVDVANDKLVSAQAFDGQKWVDLSSAEREDVAESLFDGNDVSASPRDWNLSP
FT                   IESLPQWAVFRGAPDILQVATAMDRVSWARRSMSTEPCWWNNPDINGVVNDGVRAGYLH
FT                   RPSTTQVEWSDAGCKALRAAYAKIGRNRAQVESDAESASPSL"
FT                   /protein_id="YP_001110315.1"
SQ   Sequence 226679 BP; 45398 A; 69159 C; 66437 G; 45685 T; 0 other;
     TCTTAGTGAT TTGCCACATA ATTCGCAAAA ACTATATTGC AATTTCCAAT TTCCCATCGT        60
     TATTGAACAA TATTTTTATA TTTTTTTACA CCATTTTGAC ACTGGCGTCG GCCGCCAGAT       120
     TGTGCGTCAC CGCGTACCGA ATCAACTCTG CCGTCGTGCG CATCTGGAGC TTTTCGAGCA       180
     AACGCGCGCG ATACGTGCTG ACGGTCTTAA TGCTGACCGA CAAGTCGCCC GCAATGTCGG       240
     TGAGCCGCTT CCCGGCACCG AACAAACAGA GGGTCTCGTA CTCCCGATTT GAGAGCTCAT       300
     AGTGGGGCAG GCGCGCGCCG TCCTCCATGA CCTGCTGGAC CAGCGCGTTG ACCGCATCGC       360
     CGTGCACAAA ACGCCTGCCT CTCATGACGG ACTCGATTGC TTCGGCAATA TCAGCCCGCG       420
     TAGCCCCTTC GCCTATGACG CCGAGCACAC CGCTGCGAAG TGCTCTGACG GTCCGATCGG       480
     CGCCGCGTCG AAGATCGAAC GCAAGGACTC GCAGGTCCGG GGTGCGCAAT CGTGCTTTCG       540
     ATATCACCTC GAAGACGACC GATTCATCAA AATCGAGATC GACGATCAGC AGCGCACATC       600
     GACTAGCCCG ACGAAGCCGT TCACGCAGTT CCTTCGTCGT TGAAACACCC ACACATTCGA       660
     TCGTGAAGCC GACACTCTGC AGAATCGTTT CGATTCCGGC CTGTCGCAAT TCATCAGCCA       720
     TCGCGACAAG CACGTGGCGA CCCGGCTCCG TCACGCTGCC AGAATGCATC GCTCACCCAC       780
     GCGGGTCAGT TCGCGGAACA CCTGTGACTC CCACGTCAGG ACATTCACGT GCGCGAGCCT       840
     CCTGATCAGC TCATGCCACG TCACATCGCA GTCGTCGAGA ATCGCGCCAA ACAACGCCGG       900
     ATACACTCTC CCGGCCAGCG ACAACGCCCC AGCCAGCTCA ATTTTCTCGA CGAGCGGCAT       960
     TGACGCAAAA TCGTACGCGC GGAGATCGAA GAACACAGCC CGTGGTGCTT CCAAGTCCGC      1020
     CTGCAGGTGC TCCGACGCAC GATGGACGTC GCCGCGCTCC AGCGCGAGGT ACCGGGACAA      1080
     GATGCAGCGC CACATTCCGC CGAGCATTTT GACCATCACG TCACGCTCGC GATACTGCAC      1140
     CCATACCCAG CCGCGAGGGG CAACGGCTGC GGAAGTCAAC AGACCGATAT GGCGCTCCAG      1200
     CGGGTAGCCT GCGTCCATCC AGTATGCGTT CGTATGCGCG TTGATCCGCG CCTGCTCCGC      1260
     AAGGAGCTCG TGTAGTTCGC TTTGCGTGAT CACCTGTATC TCCCGCGCGA TTTCGCTCAA      1320
     CCAATCGAGA CGATTGCAAT CAGAGGCGGA CGCAGACCGA CAACGCGGCC CGCGTTCCGA      1380
     AGAACGTACC GCCTAAAACG CGGCCTCGCC TTCCTGAATG CCCGCACCGC CCGCGTCTTG      1440
     GCGCGACTTG CCGTCCGCAT CCTGCGACGG TGCGCCCAGA TCCTGCCAGC GCGAGACACG      1500
     GATCCGCACA CCGTATTGCG TCACACCCGG TTCCTTCTCG TAGGAATCGT TGCGCGGCTG      1560
     GCCCACAACA TACACCCGGC GGCCCTTCTT CATGCGTTCC GCGAAGTGCT CGGCGCCCTC      1620
     CCCCCACAGC TCGTAATTGA ATCCTTCCAC ACGGCTCCTT TCTTCCTGAG TCGCCTTGTC      1680
     CTTCCAGACC TCGTTCGTCA GCACACGAAA GTTGACGACC TTCTGATCGC CATTCTTCCG      1740
     AAACGAGGGG TCTGCGGCCA AATAGCCGAT CTGACGAAAC TCCAGTTCAC CGTACGTTGC      1800
     CATGACTACC TCCATATGGG ACACGATGTC CCGGTTAGAA ACAGACTGCT CTATCTTGAA      1860
     ATTTCGACGC AGACACGCGG AAACCCCACC ACTACGCTGC CTTGCGCCAA CCAGCAGCAA      1920
     ACTCGGCCAT CGCAAGTCGC TCAGCTTCCT CAGGATCAAG GATCTCGGCC GCGATCGATT      1980
     GCTTGTTCCG ATGCATCTCC ACAAGGTCCA TGTCGATCGT GTTCTCGACC AACGGAATCA      2040
     ACACAATCAC GAGGCGAAGT TGCCCGTTGC GGAACGCGCG ATCCTCGGCT TGCGCGGCGA      2100
     GCCCCGGGGT CCACGGCAAC GACACGAGAA ACACATAGTT CGCGGCCGTC AGGTTGTGTC      2160
     CGACACCGCC CGCTGCCGTG GTCGTAATGA AGACTCGCTT CAACGGGTCC GACTGAAACT      2220
     CGTCGATCGC CCGCTGTCGG CGCGTCGGCG ATGACATGTC CCCCGTCAAC ACCGAGTAGC      2280
     CGATCCCTAC CTCGTCCAAG GCTTGCTTGA ACAGCGCCAC GTTCTCTTTG AATTCGCAGA      2340
     ACAGGAGTAC CTTGTCGTCG CCGTTCAAGT CCTTGATCAT CTCGACGATC GGGCGCACCT      2400
     TGTACGACTC GAGCTCACGG CGCAGCATTG TGATCTTGGG CAACGTGAGG ATCCCCATGT      2460
     CACCGTTAAT ACGGTCGTAA CGCGCACGTT CCTCGGCTGT GATTTCGATA TAGCGGGCTT      2520
     GACGCTGCTT ACCCTTGAGA TGCTTGAGAA CGAGGTCCTT CGTTCGACGT AGCTTCCATT      2580
     CCGAGATCCG CTCGCTGAGC GCGACGCGAA ACGCCGGGTC GCCGGCAAAC TGCTCCTCAA      2640
     ACGCCTTCAG GTCGATATTG CCGATCGGGT GTCCCGACAG GCGCAACAGC GTGTGAATCT      2700
     CACACTCGCG ATTCAGGATA GGGGTGCCAG TCAGAATTGC CCGGTACGGT ACCTTTGCCG      2760
     CGACATCGAA TGCGAGGCGC GTGCGCTGCG CCGTCGGCTC TTTCAGAAGG TGCGCTTCGT      2820
     CCAGCACCAT TACGGCAAAG CGATCCGCGA AGGGCACGAC CTCATCCAAC CGGTCGTAGT      2880
     TGATGACGAT CCAGCGCTTC GACGGGTCAT ACTTGCCGAC AGCGATACTC GCCTCTCCCG      2940
     GCACCGCCAG CGCGATCTCG CGCGACCAGT TGATAAGCAG ACTTGCCGGG CACGCGATAA      3000
     GGACCTGAGC ACGGGGCACA AGGCTGCTGA GAATGTCGGC CGCGCAGACC GCTTGCCGGG      3060
     ACTTCCCCAG CCCCATGTCA TCGGCGAGCA GCGCGGACGT GTTTCGTACG AGGTGGAAAA      3120
     CGCCTTCCTT CTGGAAGTCG TAGAGCTGAT AGAGCGCGAT TCTCGACCGG ATCTCGTCAT      3180
     CGCTCAGTGA CGTCGGCGCC AACGGCGACG TGACGGCAAG GTAGACCTCA TTGTCATGGT      3240
     CGGTCTCGGC GGCCGCCGGG AAATCGGGCA TGTCGCTCGC CAAGACCTTG ATCGTCGCAC      3300
     CCTGATTGCC ACGCGGCACG AATGCATCGT CAACGATGCT GAACACGCCT TGTGCGAGAT      3360
     CGACCTGATC GTCTCGGAGC CGGAGCTCGC TGATCAGGTT ATCGCGCACT ACGATCTGAC      3420
     TCGCATGTGC GATCTTCCAC GCCTTCATGG GCCCGAGATA CCGACCGCCC ATTTGCTGCG      3480
     CGATGGCAAC AACCGCCGGA TGGTAAGTGC TGACAATGAC AGCTCCACCG GATTCGAGCT      3540
     GGTAAACGGT CGCCTTGAGG TCTCGCGTGA ATGCGTCGTA CTGCGGGTTC GTCCGCGCGT      3600
     CTGTCAGCTT TTCGAAGAAC GATTCGACGG TCTCAATGAC CGCACCATTG CCGGCGGCAA      3660
     CGAGCGCCCC GACCAACGCC TCACCATGGT CATAAAGCGA CTGGCGGCTG AACCGCCAAT      3720
     AGCGGTAGTA CTGGTGGTCA CTTGCGTTGA CAAAGCGTCC GGCATACGGC TCCTGCTTGA      3780
     TGATGACGTT CGCGCCCTTG AAGTGCGACA AAAGCACGCC GAACTGATGC CCGTCGAAAA      3840
     CAACCTTTTC GACGAGCGGA CGCGGCGCCA CCGACGCACC CACCTTGGCG CGGCGGGCAA      3900
     CGTCGCTATC CCATCGCAGC GCGGACAGCT TCAAGCTCAT CGATCAGCGC ACCTTCGAGA      3960
     ACATGCGTGC CCGCAAAGCA GCCACACGCG ATCCTATGCG GACTGCGACC GAACGCCCAC      4020
     GGTCAACGAT GCTGTCTCGC GGGCGCTCCA CGGGGAGTTC GACCCTCAAA CGTTTCGCCA      4080
     TCAGCTCCAG CATCAACGAT TGCTGATCGC ATTTGCGTTG CAGCGCACGC ACGCCCAAGA      4140
     ACCAGCGCAG GGCAAATCGT GTGATCACCA CGATGACAAC GAGATAGACC ACACTCGCAA      4200
     GGACATCGCC AAACGGCGGA GGTTGAACCT GCATCACCAT CTCCTCGATT TCAGTTCGGG      4260
     TTCTTCGCGC TCGGCGACTG ACGCTGCGCC TCGGCGCGCA TCTCTGCCTC GCGGGCCTTC      4320
     AACCACAGTT CTCTCACGAG CTTCGCGCAG TCTTCAGCCG ACTTGATCTC AGGTGTCTGT      4380
     TGGGCAATAC CTTCCATCAT CACCGCCGCC TGCACGCTCT CGGGCTCTTC AGGATCTTGA      4440
     AGTACGCGGA CGCTGGAAGC AGAGCGCTCG ATTCCGGGGA ACAGCGGCAA CTCGTCCCCA      4500
     TAGAACGCCA CAAGATCGTG ACCATTCACT ACCTCGAGCA CCTTCTGCAC GACCGCGTCC      4560
     GAGGTCGGCG CACCGACGAT CTTGGCCAGC TGTTCATCGC CGATGCCATG CTGGTCACGC      4620
     AAATATTCCA CGGCGACCTG AGGCTTGCAG ATCTGCTGAT AAACGACCTC TCCCTTCTCC      4680
     GAGAGAATCG CCACGTCGAT CAGGTCATTC CGCTCGGGGC TCTTCACGAC CAACGCACCG      4740
     AGCAACAGCG TCTGCTTGGC GATCGCCACC GCCTTCGGGT CCACGGTCGG CTTTTCCTCT      4800
     GCGTCTCGCA GCTGCTCGTT GATCTGCTCG ATTTCGTCTT CGGTGAATTT GTAGCTGTCG      4860
     ACACCTTCGA CAAGCCCCTT GATCGCAGCC TCAATCGCCG GACGGTCAAT CGCGCGCTTT      4920
     GCCTTCACTT CATGGAGGTA GTGCGCGTAA ATGCCCGCCA CTTCCGTGAA TGCCGTGATG      4980
     CGCCCTACGT TGTCGACAGT CAGCCACAGG CGTCGGTCCG CGACTCGAAG CCAGCGAAAT      5040
     TCGTTGGCCG GCATGACGCC CAATCGACGC GCGTCACCGA GCATCGCGTA GATCAGCGTA      5100
     TAGACGTACG CATGGCGTTT GAAGTACGGC CGCACCGTCG TGTGATTCCA GTACTTCCGC      5160
     AAGACCGCGA GCGGCTCGTC CATGTTCAGC TTGATACGGT CCGTTTCCGG ATCGTACGAG      5220
     TCCCCCGCGT CGGCCCAATA TTGGGCGACC AGTCGATCCG TCGTTGCCAA CGCTTCCTTG      5280
     TAATCGAGCT CCGACATCTT CGGGTCGAGC GCCGCAATGC GCGGAATCAG GGCGGCGATG      5340
     ATCGCTGCCT CCCATTTCGT GAGGTCCTTC GGGGTTCTCC ACAAACGCCC CAGCTGCCGC      5400
     CGAAAGATTT CCGCCGAACG ATCACGGTTA ACCTTGAATT CGTTCCCCTT GTCGACACGG      5460
     TCAAGCAGCC GGTGTTTGAT GGCGAAGTAC TTTTCCGTGT CCGCCATGCG ATATTTGCCT      5520
     GAGTTGATGG GCCGCGCTGT GAGGTCGAGT TTGCGGAACA GCTTGAGGTG CGGGTAATGC      5580
     TTCGCCTGCT CATCGGTGAA CGTGTGAAGC GTGTAGTCCT GCGTCTTCCC GAAGTGCTTG      5640
     TGATTGGTAG GGTTCGTTGT GAACGATCTA CGCATGACCC AATAGGCGAG CGGACTATTG      5700
     ATCGCGAGAA GCGTAAAAGC GTTCGCGATC AAGCTGGACT TGCTCAGATG GCCCCACTCG      5760
     ATGAAAGGGG CGTCGGAATG CAGGAAAAAG TGAAACCAGC TCGTGAAAAT TCCGCCGACC      5820
     AGTCCGCTCG TCGCAAGCAG GACGCCCACC ATGACCATAG GCCCCATGTA CGGCTTGAAT      5880
     GCCCGGGACC AACCGAAGAT GTAGGCGATC AACATCACAG CCACGCCTAC AAGACTTCCC      5940
     CACACACTGG CCGTAAATCG CGTCACGACG TACTCGCCGA CGAAGTACGC GCCAGCGATC      6000
     ACGGCCCACT TCACGTAAGG CCGCCACTCC TTCTTGAACC GACACACAAC TGCGAGCGAC      6060
     AGCAGGCACG CTCCGGTTAC CGCGCCCCAT ACGCTGCGGC TCAGAACGAA GATCGAGAAC      6120
     TGCCCGACTC GAATCGCCGC GTACGCTCCC GCGATGTACT CATGCGCTGT GTACCAGAAT      6180
     GCATAGATGA GCACGCCCAC CAGCAGCGCC AGCACGACAT ACCACTGAGG ATCGATGGAT      6240
     TCATCCGCCG GGGACTTTTG ACCTTTTGCG CTCATGCCTT CTATCTGAAT AGTGCAGCGG      6300
     CTTCCTCCGC CCGCGCGCGT TGCGCGAGCT CGCCACTGAT TGTCTGAACA AGCGCGCCGA      6360
     CCTCGCGCGC AAGCGCGTCG CCAACAAGCA TGTTTGCCCG TTTCCGGCTG CTCTGAATAG      6420
     CTTCGACCAC GACCGCACGC AAGGCGGGAT CAACGATGCG CTCGGCAGCT TCGACCCGCG      6480
     CTCGATGATC GATCGCCGCG CAAGCGAACC AGCCTGACAC CAGCTCCGAA AAGTCATCGA      6540
     GCAGCTGGTA TGGGATTTCG GCGCCCGCGT CGCGGTCGAG TGCCAGCAAC AGCGCGTAGC      6600
     GCCGGTAGAA CGCTACGCGG TTGCTTGCCG GCAAAAGGCC GACATCACTT TGTGTCTGAA      6660
     CGCGAATATG CGTCGCGGCA TCTGCCCGTC GATTGGGCCT CGCATCCGCC ACCTCGGGGA      6720
     CAGAAAGCGC CATCTGCGCG ATACGCTCAA GCTCGCTCTG CAGAGCGGCA CGAAAGATCG      6780
     GTGCATGACC GATCACCGCG AGCGTCTCAA TGCCGTCACG AGCAAACGCG GCACGGTGCT      6840
     CCGCAATTTC GAGATCTCGA CCACGCAGCA GCATCTCGAT CAGCTTGCGC GACAGCGGCG      6900
     TCGCTTCGCA CTCGACGAAT GCGCGCCACG AGTCGATACC GTGTTCCCGC ACGAAGCTAT      6960
     CCGGATCGTG GTCTCCGGGC AGTGTGAGAA ACGATGCCGT CTTCCCGTCC GGAGTGATGC      7020
     CGATCGCGAC TCGGGCAGCG CGGTCTGCAG CAGCACGCCC CGCCTTGTCG CCGTCGAAGC      7080
     AGAACACCAC GTGGTCAGCC ATTCTGTAAA GCCGGCGAAG TTGCTCTTCG GTCAAGCTCG      7140
     TGCCGAGCGA CGCCACCGCG CGCGCATCGC CGTGCTGGTG GAGCATCACG ACGTCCATAT      7200
     AGCCTTCGAC CACAACAGCT AAGCGCCCCT GTCGGATCGA CTGCTTTGCG AAGTTGAGAC      7260
     CGTAGAGTTC TTCGCCCTTC CGGAACACCT CAGTCTCCGG AGAGTTCAGA TACTTGGGCT      7320
     GGCGGTCGTC GAGCACCCGA CCACCGAAGC CGATCAGCTC ACTACGCTCG TTCCAGATCG      7380
     GGAACATTAG TCGACGGCGA AAACGTTCGT GATACACGCC GGTTTCGTCG TCTACCGCCA      7440
     CCAGCCCCGC ACACTCGAGT ACATCGATCG CGACCCCATC CCAGTCGTGT ATGTGCCCGT      7500
     CATCCGCATA ACCAAGCCCA AACTGCACGA CGGTTGCCTT CGTCAAGCCG CGGCCCTTCA      7560
     TGTAGCCGAT TGCGCCCGGA CAGTTGCGCA GATTTCTGAA ATAGGTCCTC TGCGCGCGTT      7620
     GCAAAGCATC GCCAATGCGC GCAGTTCGCG CTTCCGCTGC GAGGGCATGC GCAGTCGGAG      7680
     CCGAGCGCTC CGGCATCGAC AATCCAGCGC GCAACGCGAG CTCCTGAACG GCACTGACGA      7740
     AATCGTATCC GGAGTACTCG GTGAGAAAGC TGAAGACATT CCCGTGGGCG CCACAGCCGA      7800
     AGCAGTGATA AAACTGTTTG ACAGGGCTCA CCGTAAAGGA CGGCGACTTT TCCGTGTGGA      7860
     ACGGACAGAG ACCGACGAAG TCCTTCCCGC CCTTCTTCAG CTTCACATGC TGGCCGACGA      7920
     CCTCGACGAG GTCCGTACGC TCTCGGACCT CGTCAAGAAA CGCATCAGCG AAACGATGGG      7980
     TGGCGCTCAT TCGCTACCTC GTCGGCTGCG TCCGCACGAC CGGCGTGTTC ATTGCGCGTC      8040
     CGGATGGCGG TAGCACGTGA GCGAATTGTT CGCAGGATCC GGTGTGAACC AGATGTGCTC      8100
     GGACGCGTAC TCCTCGCCGA GACGGCGCGA GACGGCGCCG CCAAACCGCG CATCAAGCGC      8160
     ACGCACTGCA TCGCCCACCG GACGATTGAA TTTCAGCGTA ATGGCGACAA TCGTCGGCTT      8220
     GATCGAGAAG TATGCAGCCT GACCAATGCC GGTCAGCTTG ATCTCCGAGT TCAGCAGTCG      8280
     CATCGGCCGT TTCAGCGGAT ACATGGCGCT CGCAGTGAGA AACCCCTTTC CGTCGGCCGC      8340
     CCGTTCCGAC TGCCCGATCG GGGGAAGTTG AGGCACCAGA ATCATTCGGA CGGAAGTCGA      8400
     GAGCTCCGGC GGCGCAATCC GCTGCCCCGG TGAGAGAAAG CGCACTCCAC GCGACACCAA      8460
     CTCCGAGCGC TGCAGTGCGA TCGACGGATC GCACTGGACG AACCCCGACG CGAGCGTCAG      8520
     CGCTGCATCC GACGCCTGCG CCGAGTCGGG TGCCATGGTC GTATTGAGCG GCACGGTGTC      8580
     AGGCGGTGCC GCGAAGGCGC CGCTACCCGC TAAAGCTAAC GAAGTCGGGA CAGCAAGACA      8640
     CCGCACCATA CGCAATAGAA TCTTTCTCAT GGTTTTCTGC ACATCTTGCA GGCAGATCAA      8700
     GTATCGATAT CTCGCATGGT ACCAATTTCC TACATTTTTT TGCATCCTTT CGAGACAAAA      8760
     AAATTGGCAC CTGCATATTT CACGGTTGGT GGCGTGTGAG CTGCAGCTGC GGATGTCGAG      8820
     TGCTTCAGAT GGACTGGAGA TGCCCCCAGA GATCGTCGAA CCGAAACGGA AACTCGTGCA      8880
     AAGCGTCATA CGCATCCGTT GCGAGTAGCT CCTCGGCCGC CAGCCACGCG GGTAGGACAC      8940
     CTTCTGCGCC GTGACTACCA TCGACTCTAG GCGCGGCGAA CCATCGATGC CCGTTCGTCG      9000
     TGGGCTTCCG ATAGAAGACA AGAACGATCC GATCCAGCAG TGTTGCCTCG CCTCTCTTGC      9060
     CCTCGGTCTG GGCCATCGCC TTTTCGCTGA CGTAGCCTTC CTCAATGTCC CCCGAGGCCC      9120
     AGCCCACGCG AACCTTCACA TAAGGCGTGA AGCTGAAGGC ACCGCGCAGC TCAGATGGCG      9180
     CAGTGTGGTT CCACCAGTCA GTCAGATAGT CGACCGCAGC GTAACGCGGA TGAACACATG      9240
     CCCCCCGGAG GCCTTCGTCC AGTGCGTGAC CCTCGACCGG TCTACGTGGT ACGGCTGCCA      9300
     ATCGAACTGC CTCTATGAAG ACATGGGCTG GCAACGCAAG CCGCCCCGCA TCTTCGTTCG      9360
     AGCTAAAGAG TCCCATATCG AATATCGCTT TCCGTACTAT TCCGATAGAT CGACAAAGCG      9420
     CTCCGGCCAC TTAAGCACCA GCACGTAACG CACGAGGAAG TAGATCCCGG CTACAGATGC      9480
     CGCCAACGCA GCCAAGCTGA ACCCTGCGGC CACACACCTC TGAAAAACTG CCGTCAGGGA      9540
     CCCGACTCCG GGCGAAGAAG GCTCATCCGG CAATATCGCC ACCGCACATC CGCAGAACAC      9600
     CGCGCTTGAA ATCATCGATA CGATGATCCC GAAGACGGCC CGCTTCTGTG CAGCGATGAC      9660
     TGGATCAACC GAGCGCACGT CGCTTGCCAC GATGCAGAAG AGGATGACCC CCGCCAGCCA      9720
     ATCACCGAGT TTTCGCATCA TGAATTCCGT TGCCTCACGC TCAAGGCCAA TTGCCTTGCA      9780
     ATTTGCGGTG CGCTTCCGGC TTGTTCTGCC GCTTGCCGGA CCACCAGACC CATAGCGCAA      9840
     ATGATGCAAC GGGTGACGGC GGTCAGCTCG CGCACCGGAC GTCCGCATTG CCCGTGATGA      9900
     CGACATTCGT CAGCGCACAC TTTTTGCCGG CCCCGGACGG AAGCAACCGA TAGCCTTGCT      9960
     TGCTCTCGGC AACGCTTTGA GGAATTTCGA TACTCAGATC CCCTTTGCCC ACCTTCGTCC     10020
     ACGCGTATCC TTCAAGACTT TCGGCACCGT TAGCGGACAA GCTTCGCGGC ACCACCGGCT     10080
     TGCCGCAAAT CTCGGAAATC GCGAGATCGA GTTCACCTGT TACCTCGCGC GACGCCCGGG     10140
     CAACATAGCC CACACACATC GTTCCATTCG CCCGCATAGT AGTCGGAAGA CGCACTTCGA     10200
     CGCCGCCAAC GGTTGCAGTC CGGATCCAGA CCAGATCGTC AGCCGCAACT GCGGCTTGGA     10260
     CGCTGGCCGC GAGAACAACG GCACCGAGCG CCACTCTGAT TAAATTCCTC ACCAACGTTC     10320
     TCCAGATGAC TGCTTCCGGC AGCAACGGGG CGCCTCGGCG CCGGTTCCAT CAAAGCGACA     10380
     CGGCGAGTCG TGTCGCGCTC AAAATTCGCA TCAGGACTCG AACTCAAACC CGATCTTGAA     10440
     GTCCGGCTTC CGCACCAGAT AGGCCGAAAA CTTCTTTCCG CCCGACGAGG TGAACCCGTT     10500
     CAGCAGCGAA GTACGTCCCG GGTCCAACAA CGCTTTGACG ACTTCCGGGG TGAGACGCTT     10560
     TTTCGCGATC GTCCCCCAGA TGACGAAATC GCACTCGCCT CCGGCGGGCC GGTTCTTCTC     10620
     GCAGAAATAG TTGTCGCCTC GCTGAACCAT CTGGGATCCG CATTTCGGGC AGGCGCCGAT     10680
     CGTCGCACTG GTCTCGCCTG TTCCAGCGGC CGCACCGCGC GCAGGAAGCT CGAACTCCAG     10740
     CTTATCGAGT GCTTCCGAAA ATTTTAAAAT CGCAGTGAAT TTGTTTCCCG TTCGCGGAGA     10800
     CACGAATCCT TCGAGTACAC CCGACTTACG ATCTCGCATC AGCACTTCAG CTTCGGCCTC     10860
     AGTCAACCGA CGCTTCAATA TCACCCGCGA TATGCGGAGA CCGCAATTAC ACGCGTACGC     10920
     GGCGGGCTGA CACATCACGG CTCCGTTGCA CTTCGGGCAT GGCGTCGTCA GCGTAGCGGT     10980
     AGCGGCTGCA TCGGTCGCAA GCGCCTTGGC CCGGATCCGT TCAATGATTC GCTTCGTTTC     11040
     CGCCACGATC TCGGCCATGA AATCGCCTCG ACGATACTTT CCCGCTTCCA TCAACTTCAG     11100
     CTTGCGTTCC CATTCGCCAG TCAGTTCCGG TGAGGTCAGC GCCTCGACGC CGTTTTCGCG     11160
     CAGGAACCGT ACCTGCTTGA ACGCCTTCTC CGTCGGCACG AGCTCGCGCC CTTCACGGAG     11220
     CACATATGGG CGTTTCTTGG CGTCCGCAAA CAGCAATCCT TCGATGATCC CCGCACGAGT     11280
     TGCCGACGTG CCAATCCCAC GCCCGGCAAG CGCCTCGCGT AACGCCTCGT CCTCGACGAA     11340
     CTTGCCCGAG TGCTCCATCG CAGCCAGAAG CGTCGCTTCC GTATAGCGCG CAGGAGCTTT     11400
     CGTCTCGCAC GCCTTCACGT CGACGTCGCG AGCCAACGGC CGCTCACCCG GCTGAACGGC     11460
     ACACATGTCG GCATCTTCCT CGCCTTCTTC TCGCCCATAC ACTGCCATCC AGCCAGCTCG     11520
     CGTCGTAACA CTACCGCTCG ATTTGAACAC CTCACCCGCG ACGGTCGTCA GTCGAACTGT     11580
     CTTTTGAAAC TCCGCATCGG GGTAGAACGC TGCAATGAAG CGCCGCACAA CGAGGTCGTA     11640
     GATCTTCCGC TCGGCATCGG AAAGTGCTGC CGCTGGCGTC AGGGTCGGAA TGATCGCGAA     11700
     GTGGTCGCTG ATCTTGCTGT TATCGAAGAT CCGCTTTTTG AAGATCACGT AACCATTGTT     11760
     AAGCGCTTCC GCAGCGAACT TGGCCGACGA GGAGCTGCTC AATGCCTGCA TAACTCCCTT     11820
     GGCCGTCTCG ACGTAGTCCT CCGGAAGCGC TTTCGCATCA GTTCGCGGAT AGGTCAGGAC     11880
     CTTGTGCTTT TCATAGAGCG CCTGAGCAAG GTCGAGGGTC TGTTTGGCCG AGAATCCAAA     11940
     CTTCGCATTG GCCTCGCGCT GTAGCGCCGT GAGATCGAAA AGCAAAGGCG GGGGCTTCGC     12000
     GACCGGCTTC GTTTCATCGA CAACGCTAGT CGATTCAGCG CCACGGCACC TCTGCGCAAT     12060
     CTCTGACGCA CGGCTCGCGC TCCAGAGCCG TTCAGCCCGC GCATCCTCGT TGCTATCGTC     12120
     TTTGACGAAT TGCGGATCGA TCCATACGCC CGAATATGCC CCAGCCTGAG CGCCGAATTT     12180
     CGCGTGAACT TCCCAGTAAT CCTTGGACAC AAACGTCCGG ATCTTGTCTT CTCGGTCGAC     12240
     GATAATCGCA AGCGTTGGTC CCTGCACGCG GCCTGTCGAA TGCTTGTCCA GATCCCCGGT     12300
     CTCTCGTGTG TAAAGACCTG TCAGCGCGCA GGTCGGATTC ACCCCCATCA GCCAATCCGC     12360
     CTCGGAGCGA CAGCGTGCAG CCTCAAACAG CGTCTGCATG TCTTGCGCGC TGCGCAGGTT     12420
     CTTCATGCCA GTGCGAATGG CTTCCGGCGT CATCGACTGA AGCCAAAGCC GTTCAAACGG     12480
     CTTTCTACTC TTAGCGGCTG CATAGATGTA CCTGAAGATG AGCTCCCCTT CACGTCCCGC     12540
     ATCGCACGCG TTGATCAGTC CGTCTACGTC CGGGCGCCCG ATTAGTTTGA TCAGGAGCTG     12600
     AAGCTGCCCT AAGGTCTTCT GGACCGGCTT CAGAACAAAC GGATCAGGGA TCATCGGCAG     12660
     GCGTGTGATG TCGTAGGTAT TCTGCTCGTC CGATACGCCG ATCTCAACAA GATGGCCAAT     12720
     TCCACATGAG ATAACGAAGT CGTCGCGCTC ATACCACTTC CTGTCGCCCG CCCGCTTCTC     12780
     CTCGAATCCA CCCAGCGCCC GCGCGATATC AGCGGCAACG GAGAACTTCT CCGCAACGAT     12840
     CAGCTTCTTA CCCATTTCAG ATCACCTCAG GCTTCTTCAG TATTTCAGTT CAGCGTCGTC     12900
     GCCTTCATCG CGCGGCGCGG GTCGTTTGCG CTCGAACAGT TTCCCGATCA TCGGCAGCGC     12960
     AGTCAGCCGC GCGCGACCGC GACGCGTCCA ATGCGCCCAG TAGGCATGCG CCTTCTTGAT     13020
     CGGATAACTT CGACGCTCCA ACATCTGGTC GTTAATGCCC TGCAGCACAC CGCCCTTCAT     13080
     TTCGAAATGC TCGTGCGTCA GTGAATACAT GACCATCGTC GATTCCATCC AGCCATCCGG     13140
     CGTAATCGCA ACCCCGATTC CACCCTGCGT GGTCATGATC GACTGGATAA AATTCAATCG     13200
     ATAAGCGACG ATCTGTTCGC CGTCATCCGT CGAGCCCTTG ACGATATAGA CGTGTCCGTC     13260
     CCGCACGGAC ACATAGCGGG CGTCGAAGAA CGGGTAGTCG CTCACCTCAA ATCCGATCAG     13320
     CACCTGCGAC GGAGCGAAAG TCGAGATCGC GAGCTCCAGT TGTGATGAAG GGCGCACGCG     13380
     GAGGTCGGGC CGCTGCAGCT CCTCGCCAAT CCGTTTTCGG ATATGGTCAA AGACGCGGTT     13440
     CCTGTCGTTC GGCGTACTCG CCTTCTTTCG ATGAACACGA GCCGCCATCG TTATCGACCT     13500
     CTCATGTGCT CACTGCCCGC GTCGGCGCTG GACGCCTCGA ACGCCTCCCA TGCGCGGTTG     13560
     AACACGACGA AGAAGCACGC GAACAGCGCC AACGCAATGC CGCCGGCAAC GAAGTGATTC     13620
     GTGTCGCCAC GGAACATTGC ATAGAAGCCA AGGCCTGCAA GAAAGGTTGC GAGTACAACG     13680
     AGCAGAATCG CACGCCGCTT ATGCGTTTTC ATTCAAGATC CTCCGTATGC GGATTCGTAC     13740
     GAGTAAGCGC CTTTCGGCAT CGACGAGAAA CGTTGGTATT CGAGTTGACA GTGTGCCGGT     13800
     ACCATCCCGA GTCCCGCGTC ACGCCCCTTG CCGATAATGA GTTCGGCCAT TCCCTTATGC     13860
     GGTGAATCGG GGTTGTAAAC TTCGTCGCGG TAGATAAACA GGATCACGTC AGCGTCCGCC     13920
     TCAATGGCGC CGGACTCGCG CAGGTCCGAC ATCACGGGTC TCTTGTCAGC TCGCTTCTCG     13980
     AGCTCGCGAT TTAGCTGCGA CAGCGCGATA ACGGGAACGT CGAATTCGGT TGCAATCTTC     14040
     TTGAGCCCAC GCGAGATCGC ACCGATGTCG TTCGTTCGGT TTGCACCGGC GGAGGGTCCG     14100
     TCGGCATCCA TCAGCTGCAG GTAATCGACG ATGACATATC GGAGCTTTCG CTTCGTTCGC     14160
     TGGATCAGCA TCCGGAGCTT TGCCCGAAGT GACGCCGGCG TAAGGTAGGA CTCTTGACTG     14220
     ATGTGGATGT TGGAGCGGCC GTAGCGCACG AATGCGCCGT TGAGATTGGT CCAATCGCTC     14280
     GTATCGAACT CGCCACGAAC CAGACGACGA TACTCAACGT TAGCGATGTT GGAGAGGATC     14340
     CGCATAGTCA GTTGGACCTG CCCCATTTCC AACGAAAATA TCGCGCCCAT CGGGCTCAGA     14400
     TCCGGCGACG GGTCCGGATT CATCACCAGC TCATCGAGCG AGAGCTCGTC GACCGAGAGA     14460
     ATCGAGGCGT GAGCCGCAAT ATTGAGTGCT TTCGCGGTCT TGCCCATGCT GGGCCGCCCC     14520
     GCCAAGATGA TCAGCTGTCC GCCGTGTAGC CCACCAAGCC GATCGTCGAG GTCATCGATT     14580
     CCGGTTTTGA TCCCGAGTAC TTCGCCGCTC TCGATCTTTT CCCACCGCGC GACAACCGCA     14640
     CTCAGGCCAT CGCTGGCCGA CTTCAGCAGT GTGTCGTCCG TCTGTCGGTC TGCAAACTTC     14700
     AGCGAGATCG CATCGATCCG CTGCAGCACA TCGGCGGACC GGACGTCTCC CCCGACGCGT     14760
     GGGATTTCCT TCTGGACGAG TTGCAGCTCG GCATGAATCG CGCGGGCGCG CGCTTTCTCC     14820
     ACAATCGCAT CCGCGTAGCT CTCGATGTTT TCGATCGAGT ACGACACCAC GATGGCTTGC     14880
     TCGACCAGTT CGCGCGCCCG GTCGGAGAAA GACTCTTTCG ACTTCAAATG AGTGACAAGC     14940
     GTCGCCTGAT CCGCCTTGGC CCCACGGTCA ACGATCTCGC CGAACGACTC AAAGACAAGT     15000
     CGGTAGGCGG GAACGAAGAA ATCCTCCGCT CGCAAGCGCA GCGAGAGCGT GTCGAACGCA     15060
     GCCGCGCCGT GCTCTCCAAA CAATGCGGCG ACTGCGCACT CCTCCGCCTC AACGGCGGCG     15120
     ACCTCAGCGT CTTCCCTTCT ACGTTCCACG GCCTCATTCC TGCGACGATT TGTTTCGGAT     15180
     TGTAGCATTA GGATTCAAGC AAATACCTTT TTTTGCTTCC TATCGGAAAG TGATTCATGA     15240
     TTTTCCACCA AAACGACACA CAATGATGGA GACCGCACTC CACGAGATCG TATTCACCGC     15300
     GTCGAGCGGG CGCCATCGCT CCCGCCTGTC TCATTTATAT ATTTTTTTGC ATCGTTTGAC     15360
     GACTGGTATG CAAATTAACG CGACAATCGT CTATACTTTT GCGCGTTCTG TATCCACGGC     15420
     CGATAGACGA TGCTCCCGAT CCCAACTTGC CCCACCGGCG CCACGCCCTA CCTGCAGATC     15480
     GCCACCGAAG AAGTCATCAC CGCGCTCGCT CAACTGGGCG AGGACCCAAC AGTCACCAAC     15540
     GCGGAATCGA TTCGCGCCCG CCTCGATGTC CCGACAATCC TCGTAGCGAG CGACAGGGCC     15600
     GCCGCTATTC GAGACTCGAT CCGCACGGTC TCGCGCGATC GCGCACCGAC ACCACCGCCC     15660
     GCGCAGGAGG GGAATCCCGA CCTCGGCAGC ACCCTTACCT TCGAGGACAA TCGAACCGGA     15720
     GAGACACCGT GGCGGCTCGA TACGCACTCC GATACCATTG CCCGCCTGAC GGCTGCAGAC     15780
     GGCACCACCC TCGCAACGGT CTGGTGCAAT CGCAGCGACA CCTGCCTGCA GATCGAGTAC     15840
     TCGGAGGTAC GGCCTGACGC TCGGCGACAA GGCGTATATC GCCGGCTGCT CGAGCGGATC     15900
     TCGACGCACT ACAATGTCTA CTCCGACGAG GCCCACAACA ACGCTGCGAA ATCGGCCTAT     15960
     CACGCCCTCG GCGCTCTCGA GACGCGCAGC GGCCGAATGC TGCTCCGAAA GCAGCCTGCC     16020
     GCCTCGCTCG AGATCAGCAC CCCGAACGCT GAGCTCTGAC GCCGTGAACG GAATCGAATT     16080
     TCGGGATTTA CGAAACCGAT CCCGACAGAC GCGACGCCGA TCCCCCCCGT ACCGCGCTGC     16140
     GCCATCAGGC GCGGCGCAAC AAAGCGAAGC ACGACAAAGA GCTTTTCGCC GTTCGCGGAA     16200
     TCAGAATCGG TGCGCGACCG CGCACCGGCA TTTCACGGCC GCGTTAGCTA CGATTTATGC     16260
     GAAGCCATGG GGTTGAAGGC GCGCCTCCGG CGCGCAGCTT TGCGAACAAA GAAAAAGAGA     16320
     CAAATAGCCT TGAAGGGGTT ATCGAAATCG ATCTACCCAG CGATGCCTCA ATGCGCAGCT     16380
     CGGTGCCGCA GACGCCTCTC GCCGGTGCCT TGAGATCGCG GCTCGGCGGA AGGACACGCC     16440
     CCCCCCGCTG CCTCGCACCT CGCCAGTCAC GATGCCGTGA GCAGTTCGGC TTTAACGGAA     16500
     GCATTGCCTG AGGGGTAATC GATGCCGACA GGCGCAGATT TTCAAAAAAA GGAAAATGAA     16560
     CAAAGAGTCG TTCCGGGGTT AGCGGAATCG GCCTTTCTTT GTTGTTCACG ACGCCGTAAA     16620
     CTTCAACCAC GTAGGCGCCA CAATCGAACG CCTCACTCGA CACCATCATG ACCAAGATCC     16680
     CGCAATCGAG CTCCACCACG TACTCAGCAG AAGCAGTGAT CGAAGTCTTG GCCCGCCACG     16740
     GGAAGGACCC GACCGCCAGT CAGATCGAGG AGATCCGATC GCGCCTCAAT TGGGATGTCC     16800
     AAGCGCCTGC CAGCGACAAC ATAGATGAGG CGGTTATGGA TGCCGCACGG TATGTACTGG     16860
     AAGATCCCCC GAAATTGGTG CTCAGGCGTG GTGCGAAGCC CAGCGAGGCC CTTCGAGAAA     16920
     TCAAGATGCG GTTCGACCAG AACCCGTTCA ATCCTCGGCA ACGGATCGTG ACCGATGACG     16980
     GCAAGCAACT GGCTCTGCTC GAAGTGTCAG CGTCACCAAA CGGCGGCCTG CACATATCCG     17040
     ACATCATGGC CGTGGAGTCC GGGAAAGGCT ACGGCGCCCG CGCACTGGCA ATCGTTCTCA     17100
     AAATTGCCGA CGAGCACCAC GAGGAAATCA CGCTGACGGC TAAGGCATAC TCTTCAAAGC     17160
     GACGCGCCCT CGACACTCCC GACCTGCGGG ATTGGTATGC CCGCCATGGA TTCGTTGTCG     17220
     AAGGGGGCGA TGAGATCGAT GGGTTCGATA TGGTCCGAGC GCCGCGACCG AAGTTGACGC     17280
     TCTCGCGAAA GCCGGATGAC AAGGACCCAC AACCCTAAGA AGGGCACGGG ATCAAACACA     17340
     CCGGGGGTAG TGATGCCGTC AACTGGCGGC GCCCCGGCGC GGTCTTGGCA AAAAATGAAA     17400
     AATCGAAAAA GAGCCTTTCT CGGTTTTCAC GATACCGAAG TCCTACGACG CCAAAGCCAG     17460
     CCTCATCCAA GGAGCCGGAC AGTAGGCCCG CATAGGAACG CGATTGCCCG ATTTCCATGA     17520
     GACCGCGCAT CGGCTTGAGC GGCGGAGAAG TCACAAAGAG AAGAAAACGG TTCGCGCTGT     17580
     TTGCGGCCCC GCTAAGGAGA CCTCAGGCAA CCACGGAGAG GAACCACACC CTCCTCATCG     17640
     GCTCAGCGCG GCGCGCCACA CTGTTCTGGT GGGATGCCGT CAGCAATCGC AGGCGCCTTC     17700
     AATCCGTCTG CCCGATGGAC AGTAGCCTAT CGAGTACATC GCGCCAGCCT TTTCGTCGGG     17760
     CCCGAGGCAC CGCATGGACA CCTAGAGCGT CACCGCGCAT CACTGCCAAT ACATGTGCGT     17820
     TCGGACTAAG CACGCTACCG TCACCGTCCC AGCTCTCCAT CGGTATCTGA AGCTGCTCCG     17880
     ACAGCGCTAC TGCGACTGCT GACGATCGGG AGATGCCGTA ATCGCAATGG ACGTACAGCG     17940
     TGAAGCTCTC CTTCTCGGCC AACCAGCGAC TGACGAACTC GAGCAGCACG CGCTTGTGAT     18000
     GGCCGCCGAA TAGCTCCCGG AACTGCGCCG GACGCGTGGC GTCATGAAAC GTGAGCGGCA     18060
     GCACTGCGGC CCACCCCGAT TGCAACGCCA CGCTCCAATA TGGATCGGTG ATCGACACGA     18120
     CCACGCCGAG CGGATCCGCC TTCTGACCAA GTATCGATGC CTTCGACTCG ATACGGATCG     18180
     CATCGATCAC GACGGACCAC TCTCGACCGG GTCGGTGATA GTCCGCAACG ACGTACGCTT     18240
     CTGAATATCA GGATCATCAA GCATGCGAAG AAGCTCCGGC CGATGTGTTT CGAAGTACCG     18300
     GTCGATAGCG GCACCGATGA CCCTCCGCTC AATACCGCGC GGGTAGCCCC AGTGCTCCGG     18360
     CTTCACGCAA TCGTCGCGAC CATACACGAG ATAGTCGCTA CGCCGCCCAC GTTCGCTCGC     18420
     AACCGAATCT TGCACCCATG TCTCGAACAT GCGCGCGGAG AGTTCTGTGT CGGTCGACCA     18480
     GTACGGCTTG CTACGGTAGT CGTCGTAGAA CAGCGCGTCG CGAAAGTAGA CTGAGTCCTT     18540
     CAGATACTTC CCGGGCACAT ATCCGTCGCG CACATCGGTG AGCTTTTTCA GGAGCCGTTC     18600
     CTGTACCGAG ATGGTATGGC TTGCGCGCGT GACGATCGTG CTCGATCGTT GCCGCCAATC     18660
     CGGAGATCCG AATGCCGCAT CCATTGCGTC AGCGATGCGC TCGACGAATT GATCCCCGTC     18720
     ATTGATTCGC TGTAGCCGTA GCCCCTCAAA CCCCTCAACG TCCGTGCGAT GCTTCTCGAG     18780
     TTCGGAAAGC GCCTGCTCCT TGAATGCGCC ATCCCGACGC TCTTCCGGCA GCAGCCGATC     18840
     CAGCGACGAG ATCCAGTCCC GCAGCCGGCC GTCAACGAAC TCGTCGATCG GCACCCGCTC     18900
     CTTGTGCACC TCGACGCTCG CGTGCTGCAC AAGCACTTCA GGCAGCGACA TCGGTACGCT     18960
     TTTCGCCTTC GTGAGCAAAC CTGCGAGATC GGACACCGAG CGAGGTATCT TCGCGAGGCG     19020
     CTCTACACGC GTAGCCTGCG CCCGAACTGC CAGCTCAGTT GCAAAGTGGC TCGCCGACAG     19080
     TCCGGACGCC CGCGCAAGCC AGTCATCGAA CGCATGCCAC CACTCGTGTG CGAGAAACCC     19140
     CGCTCCGCTC AAGCGCGTGA GGTTCATCAC CCTGCGCCCC GGCTCATAAT GCGCGGACGC     19200
     CGCCTGCTTT CCTCCGCTTC CCCGTGAACC GAACGCGATG GCGAGCTCGC CCCCGAGGCC     19260
     CATCGCTCGC GCGGGCAAAC CCATCACCTC GGCCAGATCC ATGAACGCGT CGTACGCGTG     19320
     GTTCAGCACC GTCTGCCGCT CGCCTTGGGG CAGCCATTTA CCGTATTCCA CCCCGCGAAA     19380
     CCCAAACGCC AACATAAACG CGCCCTCATC CACATCCGCA CCCTCCCGGT GATCCGGGCC     19440
     AATGCGTCGA ATGTCATCGA GATGCGGAAT GATCGGCTCG ACACGCTCCT TCTTTCGCTG     19500
     AACACCCTCT TCGTCAGAGG AAGTACGGCG CCCCTTGATC GCCCAGTTCC ACCCACCTTC     19560
     GGTCGACACC CGTGCGGCAT CCAACATGCG AACGAGGGTG TAGCTCGCAC GCACCTGCGA     19620
     TGTCGCTTCG TCGTAAATCA CGTTCGGCAA CGCATCGGTG AATTTCTGAC CCGCCCCGTC     19680
     GAAGAACCAG TGCGCCGAGT CCCAGAAGTA ATACTTGGCC TCCCCGCAGT ACAACTGCCG     19740
     GCGATCAATT CCGTCGTCCT TGATCGGCCT GAGCTCGACC GGCAGATCCG CAGCCTGCCG     19800
     GATCTCGAAG CAGGCCCGGT GGAGATCGCC TTCCGTCTTT ACGGTCGCGA GCCGATCGCG     19860
     CACGAGCTCG ACTGCACGGA TGAAGCTGTC GCAGCGCTCG ACGGTCAAGG GCTCCGCTGC     19920
     TCGGCGCTCG AGCAGGATCC GTTTTCGATT CCGGCCGCCG CGACAAGGAG TCGCGGGCAG     19980
     GGCGTGACGA AATTCACGTA TGACAAAAGC AACCTGCGGC TCAACACCGC GATCGCGCAT     20040
     TTCCGCCATG TCGAGCTTGG GCCAAACGTT GTCCTTCGTG ACAATGTCGA TGCGCTCACG     20100
     TGGCGACAGC GACGAGACCT CGGAGCGCTG CAAAGCGCGC TGCGCATAGT CCTTTCGGGC     20160
     CCCACCGATC TTCTCGCCCG CGTCCTCTCG CCTACCCTGC ACCTGACTCG CGGGCAGCAC     20220
     GGCCTGCATG ACGCGTTGCA TTCCGGCCCG GAAGCTGGCC TCAGCTGTCA GCTCGTCGTG     20280
     ACGGCGCTGC GCAGCGTTGT ACAGGTTGGT ACGGAAATCG TCGACAAACG AGAGGAACCC     20340
     GGCCGGGAAG TGTTCACCAA ACCGTGCCGC GCGCTGACCG CCATAAGCGG CAAGCGCCTC     20400
     CACCGTAAAG AAGCCCTGAT GCGGCATGAC CGGCGCGAGC GCTGCCTTCA TGTCGGAAAA     20460
     AACCTGCTCG AACCGCGCCT TCACGTCTGC CGTGACAGGC AGTGACGACC ACTGCGCCGG     20520
     GTTCAGCAAG CCGTCTGCTC GCAACCCCTC ATACGCTTGA ATCACCCGCC GGACATGCGT     20580
     CAAGAATTCC CGGTTCCGCT GAACGTTCGA CGTCAGACTG GCATCGAGCT CAGGGAACTC     20640
     AACCGAGTTG AATTCGAGGT ATCGCGCGTC GTTCAGCACA AGCGGCCGCG CATCATCGGA     20700
     GGCGAAACCG AACGGAATGC CGTATGGCAC CTCCACACGC TCGATACCAT CAAGTCCACC     20760
     GCCGTTCGCC GCCTCTGCTG CTTCCCGTGT CGCGTAGCCG ATGAATGCGC TTCGCATCGA     20820
     TGGCGCACGA AGGGGCATGC CGTCGATTCC GATAGTCTGC CGGCGCACGG CACGCTCGAC     20880
     GTCGCCCGCC GGATGAAAAG CGAGCACTTC TGCGAGCGCA CCGTCAAACG TGATGCCTCG     20940
     CGCATCTGCC GGCGGAAGGT CGCGGTACTC GAGCAGCTCG TGCAGGGAAT AGCTCGATTT     21000
     CGCGAGCTGC GCCGTCAGCG CACGAGTGGG AGCGGTCGTG AAAAACACCC CGGCCTCTGC     21060
     ACCGTCAAGC CTCTGCTGCT GGCTGACGAA CGAATCCACC AGCTCTTCGT CGGCGAACAG     21120
     GAAATCGAAG TGCTTCACCT CCGATACCGC GATCCGCTGA AAATCGGTAT CTCTCAGAGC     21180
     CGGTATGAAA CCCCGGAGAC GCTCCCGGTT GAACGGAATG GTCGGCGAAT AGAAAAATAG     21240
     AGCCTCGCGC GCCTGCAATT GCGCAGCTTC CGCCGCCTCG ACAGTAAGCC CCCTGCTCAC     21300
     CGCCATGCTG TATGCGCGCG CCTGATTGAC CTGAGTCTCG TTGGCACACA ACGAGAATCC     21360
     GGCTTGTCGA AGGACGGTGT TCAGATCGCC TCGAACGCCG CTGCGGTCTC GAAACAGCTC     21420
     GCGATCGTGG ATGCTGAACT TCAACAGATT CCGTCCTATT GACGGATTGA ATGCCACACT     21480
     CAATGCCGAT CCGTAGGCCC TCAGATCCGG CCAGAGAATC GAGTCGTTGC TCGACGTTGC     21540
     CATGCTGCTT AACCCCGTGT TTGTCTTTAT TGGCGTTCTA CATCACACGA AGACGCGTTC     21600
     CCATTGTCCT CGTATCAACG GCACGTAGAG CGCAAGGGCG TCCACAGCTC CGAGCTCATC     21660
     GATGGTTTGG CCCATGTGAG CTCCGGCAAT AAAGCGTCCC TCGCGCGTTA TCGTCACTGC     21720
     CAGATAGATC TGGTCTTTGC GACGATCCTT GAGTTGCAAA TTGAGGCAAT CAGAGCTGTC     21780
     CAGCCGCTCG CTTGGCACCA GCACGAGCAC CAGCCCTTCA TCACTGCCCA TCGCTAAAAC     21840
     AACCCCGTCC AGTTCCCCCA AAGAAAATGG AAGGGGCCAT TGGTTAACGA CAACGCCCCA     21900
     GAAAACTCCA CCCCTGCTTA GCGAATTTAT TGTGTCGTAC ATGTCTATCC GGAAATTTCC     21960
     GGCGCTGAAT CAGCTGGGGC CTTGCCCGTC AGTCGCGCTA CAAGCGCTTC GAGCAAGGCG     22020
     ATCATTGCGC GTGCCATCTC CCGCACGCGC TCACCGAGGG TGGCCGTGTA TTCGCCCTCG     22080
     TTCGTACCGA AACCCGGGAG ATCGCTGGTC TGCGTCTCGA CTCCCTTCAT AGCCTCCGTC     22140
     ACACGCGACC GAACCGTTTC ATCGCTGTTG GCGAACTTCT CGCGCACGTC CTTCAGGTGC     22200
     TTTTCGAACA CGTCCGACTC ACGGCGATAC GCCGCCACGG CCGCCGGGTT GTCCCGCCAA     22260
     AGGGCCGTCA TCTGCTCACG CAGCGGCGCC AGATCTGCGT CGTGCCGCAT CTGCACGATG     22320
     ACTTCCGACG GCGAAACCCC GCGCTTGTTG GCCTCCTTCG TCACACCGTC CTCCCACACG     22380
     ACGAAGCCGT CGACGCCACG CAAACCGTCT GCGGCCGCAA GGACCGCATT CGCCGATTTC     22440
     TCGATCTGAT CGCACTTCCA CGTGCTGATC TTCTCGAGCC GCGCCAGTGC AGCAAGCGGA     22500
     ACCCCAGCGC TCAGTGCCGC GCTGGCCTGC GCCCCAGCCG CACGCTCGGC AGCCGGTTGT     22560
     GTGCTGAAAC GCTGCCGCAA ATGGCGATGC GCGGAAGTCA TCGCGAGAAA AGGCGCAGCA     22620
     ACGACGCCAG CAATGCCCTG CCCCACGACG TCGCCCACCG TCTGAGCAGC AGCCGGCACG     22680
     GCTGCCGCGC CGACGGCTGC CGTGCGCGTC GGAGCAGCGG CCAGCTCATG CTGCGCTTGA     22740
     GCCGGTGCGG AGTCGGCGGC CGGCTTCTCG TGCAGCTCGG ACGCCGGGGT CGGACCCGAC     22800
     AGCCCGCTCA GCAAATCCTG CAGGTCAGCG TCGGTCGCAA ACCTGTCGGC TGGCGCACTC     22860
     TTCATGATCG ACTGCGCAGC ACCGGATGGC TTCAGGCTGA CATCGCTCTT GTCGAGCTTC     22920
     CCCGACGCCA ACCGCGCCAG TGACGAAAGA CCCTTTTCTT TGCGTGAGCG GACCGCTTTT     22980
     TGGGCGCCTG CCTCGTCGAC CTTCGGATCC GTGGCGAGCT TCGGCTCCTG ATCTTCTGGC     23040
     AGATCGTCAG GTGCGGGGTT GCCACCCTCG CCGACCCATG CATCCTCCGC CTTGGCAACG     23100
     TCGGCAGCGG CCACGGGCTC GATCGCCTCA TCAGCCGCAG ACCCCGTGGC GGGCGCATCA     23160
     TCGGGCCGCG CTGCGCCTCC CGAAAGCTCT CGCATCGGCT TGCCGCGCGA ACTCGCCTCC     23220
     AGCTCGTCTT CGCTGAGCGA CAACAGACGC TCAGCGTCTT CGTCACCGGC TGGAGCTTGG     23280
     GAGAGTGCCC CGAACTTAAT AGTCATGTTG TGCTCCCTTC GAAAACTCAT TAATTGGCAA     23340
     TTTTGCGGTC AGCCATAGCA TTGGTTACGC GGCTATAAGC GGCCTGAACC TTCGGTGTCA     23400
     GGTATCGATT CGTCTTATAA GCCACCACCA TCGACTGCAT TGCCTCAATT CTCGCACGAC     23460
     GTTCCGATAT TTTTCGCTGC ATCCACAATC TTGCGGAGAA CATGCGCGAG ATCTCCGCGA     23520
     TCAGACCCCT TTCGCTCAAA TCTGTCAGCC GGACCTCCCA TTCCGTATCC AACGCACGCC     23580
     GCAACATCTC CGCGTCGACA ATCTGCGACT CGCTCATACC ATCGTAGGTC TGGTACGGCG     23640
     GGACATCGGG GAACCCGTAG CGCTCACGAT CCGTAACCGT GGGTTGCGTT TGCCGCGCCT     23700
     CGTAGATCTG ATCCGCCGAT GTCGGCACGG TTTCGCTAGC TGCCGCCCCG CCTTCTGCTA     23760
     TCGGCGTAGG TGCCTGCCCG CCGGTACCTT GAGTCACCTG CCCCGCCCCC GGCGCGAAGG     23820
     GGTAGGTCTT GCACATGTAC TCGAGCGCGT TGCGCAGGTA ATGGCTGCGG GTCTTGTTCG     23880
     TGCCGTCGTT CGTCTCCCGC AGCTTTGTGC CGCCGTAGCC CGTCACGTAC TCAAGGTGCA     23940
     GGTGAATCGG AAGATCGTAC CGATCCATGT GATTTCCCGT CCCCCCCGCA ACACCCACGA     24000
     CATCACCCAC TGCTACCTGA GTGGTGCCCA GCGGAGAGCC GCTGCTCTCA CGAAAGCCGA     24060
     CCGCACCACC AGACTTCAGT TTCGGCTCGA CAGAAGCCAA GTGGTTATAC GTGACGATGT     24120
     CGCCATTGGC GCGTCGAAGT GCGACACGAT TCCCGTAGCC ACTACCCCAG AACCCCGCGC     24180
     CGATGATCGT CCCGTTGTCC ACCGCTTTGA GCTGCGCGCC TTGACTCGGG TTGCTGGGAT     24240
     TGCGGGCTTG AAAATCGACG CCCCAGTGGA CGCGCGGGCT CGAATACTGC GCGAGCAGCC     24300
     GCGTCTTCCC GAAAGTACTC GTCACCATGT TCGTCGGGAT GTTCACCGGG TCAGCCAGAC     24360
     ACTGAGCCCC AGCATGCGCC GACATAATGG TCAGCACCAT CCCGATCGAT ACGGACAGCC     24420
     GTACGTTCAT TGAACCACCT TCGGCCGTGC CGCTGCATTT TGCAGCGCGA CGTCACCCGT     24480
     CGGCATGTCG CTCGCGTGGA GCGCGAGACG TGCGGCGGCG ATTGCTTCCT CACGCTCTCC     24540
     TGACTGATAG TTCAGGTACG TGAGATACAG GTCAGTAGAC AGCATTTTCG CGAACACCAC     24600
     GAGCAGTCCT CGCTGGCTTT GCGATGCCAA GGTCTGGGCC CACGCGTCGT AGTTCGCACC     24660
     CCCGGCGTAG GTATCGATCT TCGACGACAC CGCATCGAGC ACGCTCTGCG TGTCGGACCC     24720
     GGATCCCCCT CGTGCAGCCG TGTACGACTG AATGGTCTTA AGCGAAGCCT GAGCGACCGA     24780
     CGCAACTGCA TCCTTGCTTC GCTTCTGCTC CATGTAAGCC TGCCCTGCAG GCAACGCGGC     24840
     CGTGCTCTTG TTCAGTGCGA TGTCGGGCGT GCCGAACATG TTGTTCAGGA GCGCTGATTT     24900
     TGCGTTGTCG AGACCGGACC CGGCCTGCAC TGACGTGAAG AAGTTGGCGC CGTCCACATC     24960
     CTTGCCTGCG AGCTGGCCCG GCGCTGCGCA CAGACCTGCA CGCGCCTCGT CGGCCGTGCA     25020
     ATAGGTCGAC TTCGCCAACT GCATCCGTTG CGCAACCACT GTCGACGGAT CGGCAACAAA     25080
     TCTCCCGGGT GCCGAGTCAA TTTCGCGCAC CACCTTTTCC TGCATGTCGG TCGCCGCCTC     25140
     GCCCAGCGCC GTCGCGATAT TCTTCGAGCG CTGTCCCTCA CCGCACGGGT CAAAGCCCTG     25200
     CCCTGTCTCG GGACTGTAGT CGGCGATCGC CTGCATCACC GCCTTGCGAT TCGAGATCTC     25260
     GACGGCCAAG TTCGCGCTGG CCTGCTTCGC ACTCAGGTTC ATCTGCGAAG ACTTGTTCGA     25320
     CGATGCGCTG ATCTGGGCGT TGAGCACCCT GATCGAACCC ATGATGCGTT CGAGGTTGAG     25380
     TGCCCGCGCG ACCGAAATAC CTTGCGCCAT GCCTTGAATT GCAACCGCGA TCGACGATTG     25440
     GGCGGCGGTC AATCCAGCCT GCCAAGCCGA ATCCATCACC GCCGGACAAC CCGATGCGAC     25500
     GGAGAATCCG GTGACCGACA GAAGGACCGT GCACACCACT GCTTTCTTGA ACGTCCGGCT     25560
     CATTGAACCA CCTTTGCGGA GGACTGGGCC GCCAATGCAC GCTCAGCGGC TGCCGCAGTC     25620
     TTAGTTCCGT TGATCCGATC GTTTTCGAGC GCCAGCTCGG CTGCAGCATT CGCCTCGCGA     25680
     CGCAGCGATT GACGGAATTC TCGCTCGCGG ACTTTCAACG TCAGGCCCTC GAGTTTCACG     25740
     AGGTCCACAA TGATCCCGCG CTCCGCCTGT GACGCCTGAT CCTGCGCCCA TTTTTGAGCA     25800
     GCAGGTGAAC CGAAGTACTG GCCAACACGC TCGGCCATGA ACGTATCGAA GCCCTCCGCA     25860
     TCCGCTTGAA TGGATTTGAG CGAATACGCC GGGAACGCGA GGTACGCATC CTTTTCTTTC     25920
     TTCTGCATCA CGTATGCCGC GCCTGCTGGA GTGTTCCCCA TCCCCGCCGG CATCGGCGCG     25980
     TCCGGCAAAC CGATGATGCC GTTGATGGTT GCGTTCTTCG CCGCCACCAT ATTTGCACTC     26040
     GTGTCCGTGC TGAAGATCAA CGATGCGTTC GAATCACCGC CCGGAATGGC GCCCACGCTC     26100
     GAGCAAATTC CCGCATCGAC ATCCGATTGC GTACAGAACA GCGAGCGGTG TAATTGCTCA     26160
     CGCTGCGCCA ACACGGCCGC CGTGCCGCCG TACTTCCCGC CACCGGCCTG CACTTCGCTC     26220
     TGAACCCGGG CGGGCACACT CGCGTTGACC TTCGCCTCGG CGGCCGCCAT CTGCTTTGTA     26280
     GCCGTCAACT GCACGCAAGG GTTGTAGCCC TGCGACGTGT AATCCTCGAT CGTTTTGTCG     26340
     ACCATTTCCT TGTTGGCCAG ATCGGTAGCG ACTGATGCCG CCGCCTGCTC CGCCTGCAAC     26400
     ACCGCGTTGT CATGCTGATC GCCCGACATC TCGACCTGTT TCGTCGCAAC CTTCAGCGCA     26460
     CCAGTTATCG TGTTCGTCTG GACCGTATCC AGCGCGACGA TCTGCGCCGT GTTTGCGGTG     26520
     ATCTGCGCGA CAATTGCCCC GGCCATCGCA CTGGCCGCGC TGGTCACAAG CGCTTCAGTG     26580
     CCACCGCACG ACGCCCACGC AACGCCTGCC CCGATGACCA TCAATGCCCC GGCAGCACCC     26640
     GCCTTCTTCG CCCCGCTCGC AATTCTTCGT TTCGCCTTCA TCATTATTCG CCCGCCGTTG     26700
     CGCTCTTCTG GGTCTCATGC GCCTCGCTGA AGCGCATAAA CGAGAATCGC GCCATTGACA     26760
     TCAGCGCCTC CTGATCGCGC CGCGCCGCGA GGGCCGCGAC GCAGGCCGGA GTCGAACACT     26820
     TTCCGGACTG CGGAACCGGC TTGACGGGCG CGATGCGCTT CGTGAAGTCG GTCATCGCCT     26880
     CCGTCTGGTC CCATCCGTAG GTCTTGCCGG GTTGGAGGTG CAGCGAAAAG TCCTGATCGC     26940
     CACCCTGCAT TCCGTTCGCG TTCAGGCTGC AATAGCCCAG TTGCGCTTCG GACACCGTGC     27000
     AGTAGTTCGA GGCATGCCGC GCCGAACGTA ATGCGACCGA CGCAGCGAAC GGGAATTGCG     27060
     TAACCTGTTT GGTTGCACCG AGCGCACCAG CGATGCCCCC TGCGCTGGCC GAACCGCTTT     27120
     CCGACTGCGT ATAGATTCGC GCCAGCGCAC TGGCCGCGTT GCTCGCAGCA GAGTCACTGA     27180
     TTCCACCCAT CTGCGTAGCC ATGCTCACCT GATAGCAACC GTCGATCAGT TGCCCTTTCT     27240
     CGCCGTACTT GTCGACCGTT TGACGAACCT GATCGCGGAT ATACAGGTCA ATCGCACTGG     27300
     ACGACAGCGC CTGCTGCGCC TGCAGAGCCA GATTGTTCGC TTGCGCACCG CTCAGGCTGA     27360
     TCTGCGCGGT CAATACGCCA AGAGCTGACG TGGATCGCTG GAACTCGTAC AGCCACTGCA     27420
     CCAGCTGCGC GTGCGCCGCG AGCGGCACGA CGAGCAGCGC GATACCGAGA CGCCACTTCA     27480
     TCTTAGTTGC CCCCGAAGAT CTTCGAGCCA AGCGACGAGG GAGCCGACAA CGCGGAATTC     27540
     GCAGCCGACG TAACCGGAGC AGTCACTGCG GAGGCCGCTG CCTGCGCAGT GCTTTGGGCC     27600
     GTAGACGTGA ACTGGGAAGC GGTCGACCCG ACACTGTTGT TCAGCGCAGC CGTCACACCG     27660
     CTCAATGGAT CAATCGTCGT AGGGGTTCCC GGCGGAGCGG AGTAGCTCGT GCCATATGTG     27720
     GTCAGCGCAA CGCCGACGCT CTTGCCGATC TGCTGATCGA GATATCCGGT GATCATCCCG     27780
     GATCCGTTGT TGAGAATTCC CGCTGCATAG TTGTACTTTC CGATCAGGTC CGAAAGCGAG     27840
     TTTCTCGCTG CCGTGCATGC CGCATTCACC CCCATCTGCA ATGCCTGCTG CGCCAGCGAC     27900
     GTCAGGATGC CCATGGGATC GGGAATCAGC TTGGACAGAT CGATGTTCGA CAGTGCACCG     27960
     ATACAGCTGG ACACCCCACC CACCGTGAAG TACTTCGCCG GATCCGGTTG AGTCATCCCG     28020
     ATCATAGTGA TACGGTTGCT CAGCGCCGAT TGCGCGGCAG CCGACACCGC ACAATTCGTC     28080
     GACGACGTGT TCGCGTCCGT CGAGGATTGC TGCGCCATCA CGGCAATGCC CGTCGCAAGT     28140
     GCCGCCCCGG CACCCATGAG TAGCACACCC TTGCCGACCG ATTGAACGCG GGTGGAAATA     28200
     GCGAGCTGGC GCAGCTTCAT TGAATGCCCG TGAGAGTAGT AACGACGAAG TCAACGTTTG     28260
     CCTTGCTGAA CCAACGGTCA AGCAGCCGCG TCTTGTTCAG CGCGCGGATG CGCTTCAACG     28320
     CGAGATCCGC GTTCACATCG TTGAATTCGT TGAGCCGGCA GTAGTCGACC AGCTGCATGA     28380
     AAAACTCGTC CTGATAGCCC TGCAGGTACT CGACCGTGTA CATGGCTTGC TCGATGGTCA     28440
     GCCAAGACAG AATCTGCAGG AACGCCGGGT TGTCTGCTGG AATCTTGTTG CGGAAGTTCG     28500
     CGACGATGTC GTCGAGCCGC TGCAGACGCA TCGTGACGTC GTCAGCAAGC TCTTCATCTT     28560
     TTTCAGCGAG CCGGTTGAGG ACCCAGTGCT CCACCTTGCC GAGGAAACCC ATCTGGTAAA     28620
     GGGTCATACC GGTCTGATCC TTCGCGTTCA AGTGCGCCGC GACGTGATCG GGGTCCGACA     28680
     CACGAAACAG TCTTTCGGGA GCGCCGTGGC CACTGGCGCC CGCCCCATTC GGATTCTCAG     28740
     CCACGTTTTC CTCGCGTTTT TGCAGATTTC ATTGTATTTT AGTCCAATAG GGACTAATAA     28800
     AAAACATTTT CTTTTTTGGA ACCTGCATGC AAGTGCTGTC TTGGCAACAT AAGCGGCACA     28860
     GGTTGGTGCT CGCTCTGGCG AAGCTGGACA CGCAAATCGC GTCCCGCGCG GAGATACTCG     28920
     AGCGCACGTG GGTGGAGAAG TACCGTTTGA CGCCGCACGA AACCGGTCAA ACGCCCCCCG     28980
     TCACCATCGC GAAAAGCGCA CCTCCTGCCG CCAACATCGC GGCCGCCCCC ACCCCAGCGG     29040
     CCGAACCGGC TACGCCCCCG AAACCTGCGG TGCCCGACTA CATGCTGTAG CGATCAGGCA     29100
     CCGAGTCGCG TCAGACTGGC GCGACTTCAC CCACGCACGT GCGGCCATCC AGTTCGCGAA     29160
     CACGAGCAAG CTCCTCGCGG TCGCGCGTGT AGAACGACAG GCCATGACGG TCCATGAGGT     29220
     AGAGCACCAC GTCACGCACA CTTTCCTGCG GAATGGTCGC TATCATCTTG CCGCCGGCAG     29280
     ACCGGAACGT CAGGGCGAAC CGGCACTCCG ATTCCTTCCC GGCGATCGGG GTCAGCGCTT     29340
     CGTCGAGGAA GATGTAACCA CCCCACTTCT TGGTACCCGG AGCGACGAGC TCAAGCCGCC     29400
     CAACGCTGTT CTTCCGAATC AGCACCCCAG CGTCCTCATT CCAATCGCCA CTGGCGTCCG     29460
     TCGTCACCGG GCGATATTCT GCGAACCGGG CAACCAACCC CGGATCCCGA ATCCGCTCCG     29520
     GAATCTTGGC CAACTCCACT TCTGACACGT TGGCATACAC GAGAATGCCG TGTTGCCGGG     29580
     CACCCGCCTC GTCGGTATAG ACGATCTTTC TTCCGATGCG TTGCCGCAGA TTCAGCGAGG     29640
     TGGCTTCGAA CAGGTTGCCG TCGAGCACGC GCGCACGACG CGTGACGATC CCGTTCTCGG     29700
     CCGCATCAAA TGCATCGCGG GCCTCTTCGT GTTCGGCAAA TGGCGCCCAG TCGAGGTCGA     29760
     GTCCACCAGC AAACAACGAG CTTGCCGTTT CGAGCCGGAC CTCATCGCTG CCCGGACGCA     29820
     TCGTATAAAA GGCATACTCG CTCAAGCGGA GGTATCCCTC GAGCTTGTTC GGCACGGCAA     29880
     CCCGGACGAT CACTGTCGGA ATCAGTACGC CTTCAAGGTC CGCCTGATGG TAAACGGCAC     29940
     CGGGACGCAA ATACTGAAGG TTCTGATCAA GCCAAACGAG CTTTGCAGCG GCATTCTTCG     30000
     CTTCGTTCGG CTCTTTGTCG ATCAGCGCTT CTTCAACGCT CTCGAAGCGC TTGGGCGTAT     30060
     GCCGCTTCAG GATTTCATGA CGCTGTTCAC GCAGATATGC ACCGATCACA GCGACATTGG     30120
     GGACTCCTTC GGCGCACGCG GCCGCGATCC TTCCGTCGAC CTCCGTTGCC TTGAACGCCT     30180
     TCAGTTCCTC TTCATATTCA AGCTGACTCA GATACACGGG CGCATTGAGC TGCGACTTCT     30240
     GATTCGTCGA TGCGTTCGAA GCCCCCATGA ACACGCGTCG ATCCACACGA CGCGCGCGCC     30300
     ACTCGTGGCA TTGCACCTCC AGCGGATTTC GGCCCTCAGC CTTGAGCTTG TCGACTTTTT     30360
     CATGAAACCG CGCCTGCAAG TCGGCATAGA GGGATCGCTG CTCTTCGACG CGCAGCAAGC     30420
     AGATCCGGCC GGTGAGGACT TTGATGTAGT ACAACGGCGG CTTCTGATAC GAATCGCTGT     30480
     CATCCTTCAT CGCAATATCG AGCCGGTCGG CAAGATCGAA GTTCTCCTGC AGCAACTCCT     30540
     CCGCAACCAT ATCTCCCACC ACGTTCAGCA GATCCGGCAC CTCGCGGATA ATCTCCTTGC     30600
     TATCGCGGTT AGCTACCGTG CTTGCCGTCA ATGACCGGTT TTTCGTATTG AACATCATCG     30660
     CCTGCCGGTC ATCCGCCGGA AGCCCCGTCA CCGGCACCTT GTAACGTGGA CGCTCAATCT     30720
     GCCCCGTTCG ATTGTGCCGA CCATCCATCT GGCGCTCCGC CGTGATGTCC TGCTGCATCT     30780
     CGCCCTTGAT CATCACGCGC GGCCGCACAT CGGCGCCGAC CGCCGGACTA GCCTGCAGCG     30840
     AGATGCCGGT GCTCCCTGCG CCGGTCAACA CGATCGCGTC GAGGTCGCCG TTGTTGAACT     30900
     CGCGCACCAC GCGGTTGACC CGCGTCTTGT CGGTCCTCCC CGGCATCGCC TCAATGGTCA     30960
     CCTTGCCATT GGGAAGCGTT CGTGATCGCA GATTGCGCCC GGAGATTTCC CCCAGCGTAT     31020
     AGCCGCGCGC CTCGAGCGCC TCTCGAAGAT AGTCGATCGG CGCCAGCGGC AAATCATCAG     31080
     GTAGTGCGTC GATCAGCGAC GCGATTCGCT CAGCGGCCTC CTCGATCGCT TTGCTGGACG     31140
     CGCGAGTCTT CTTCACCTCA CCGTACCGCT CGACAGTGGT GATCCACATC AGCCGCTCCA     31200
     GCGTCTTGTG CAGATAGTCC CGGAAGTTAA TGGGCTTCTC GAGCGTCACC CCGCCGAAAT     31260
     CCTTCCGCAC TCGATCCTCG GAGTCATCGT ACGCAGCACT GTTCTCAGTA AGATAGTCCG     31320
     CCAACATCGA TTCACCCGTA CGCTGCAGCG CGATGATCGG CTTCTCGTTT GCCTCGATCG     31380
     CCTCGATCGT CAGATCGACA ATCTCGCGCG CCTTCATGGC GAGCAACATC TGACAGACAA     31440
     GCGCGTGCAT GCGCGACGCG AAATTGACGC TGGTGGCGGC CATGCGTTGC CCAGCGCGCT     31500
     GCTCTTCGGG GATCTTCTCG AGCTGCTTCT CGAATTCGCG ATTCAGCTTT CCGACCACCT     31560
     TTCTGACGTC GCCCGAGATG AAGTTCATCG CGCTCAAGAT CTCCGAAAGC TGATCGGCCA     31620
     CCTCCTCGTT TCGCTTCACA TACCGCGAGA CCACGAACTC TTTTTCAATA CCCGTGTTGT     31680
     CGAGCTCTCG CGAGATCAAA CATCCCTGCG CCGCGATTTC GTAGTTCAGC GCCTCCTGTA     31740
     ACGAAATGGG GTCGCTCAGA ACGGCGTCGA GCAGCTCGTC GGGATTCACC CCGGCCGGCA     31800
     GGATTCGACG GTACAAGGAA AGATTCTTTG CCCCCTTGAT CGGCGTACCG GACGAGTAGA     31860
     CGATATTGCC GCCCGTCAAC TCCAACCCGT TGATCATCGC TGCGAGATTT TCGCTCGTGT     31920
     TGCTTGCGCC CGCGCCCTTG TGCGACTCGT CGAGAATGAG CGAGATCGGA TACGAAGCAC     31980
     ACAGCGCGCG CATGTAGCGC GACGTGAGGT GCTTTTCATG CTGCCGCGAC AACTGCGAGT     32040
     AGGTGAGCAT GATCAAGTCC GTGCCCTCCG GCAGACGGCC CTCCTCCGCG TGCGCGCGAT     32100
     ACTCGGGACG CTTCATCGAC CTGACGACGA TATTGCCATC GGCGTCGACG GTCTTGGATT     32160
     CGTTGTTGAC GATCAGCGGC GCCTGAAACA GGTGCCGGCT GTCGATCGAA GCAATATCCC     32220
     GCTCCAGAAA ATCCGAGAAC AGGTTGTCCG TCACCGTGAC GAACATCGGC ACGCGCCCGT     32280
     GCAGACGCTC CCGGCGCGCG AAGCCTGCGA GCACTCGACC TTTGCCCACG CCCATCTGAT     32340
     CCGCCAGCAG GAACCCGAGA TTACGGCTCG TCGCGGAGCA GATCATGGCG AGTGCGTCGA     32400
     TCTGTTCCGG AGAGAAGTAC TTCGGCAGAT CGTTCACCGC GTATTCGAGC TCTCGCGCGA     32460
     CATACTCGTC GATATCGCCA CTCTCACTTT TGATTTGTGC CAGCGCCTCG AAAACGGGTC     32520
     CCGACAGATT CGCGGGGATC ATCGTTGACG CTTCGCCGCT GTTGGAGAAT GCGATATAGC     32580
     GCTGCTGGAA CTCGGATTCC TGACGCACAT CCTCGCGCTC GGACTCGCTC ACCTGAGGCG     32640
     CCGGCACCTC GCCCTGTTGG ATACCGTCAT TGACACCGGC AGGTCCGGCG GACGCCTCCG     32700
     CAACTGGGGC CGGAGTATCG ATAGGCGTCC CAGCATCCGT CGACAGCGTC GCGCTGGCAC     32760
     GCTTGCTCTG CACGGCTGGA GCACGGACCG AGATCAGTTC TTCCGCCCAT GCACGAAGCC     32820
     CCTCGTACGA GCGGATTACC GGGAGCGATT TCGGCTCTGC CGTTTGTTCC GGTTCCGCCT     32880
     TGCGATCGCC AATTACGTAC AGCCGGAGCG GATAGCCAGC CCCTTGCTTC TTGTAGAGCT     32940
     CTCCACTGAC GTCGACAACA CCGTCGATCT CGTAGTGGTC GTACAGATAC GCCAACAAGT     33000
     GTTTCGAGGC GCCGATGATC TCACCCGCCT TCATCACGTT GTCCGCGCCC GTAATGAACA     33060
     CGGCACGCCC CTGATCCTTC CGGGCATGCA GAGACTTCAG CAGGAGAAAG TGATCAAGGC     33120
     GCTGAACGCT CATCGAGCGT ACCGCGCTAT TTTTCGGCAG TTCGACCGTC TCGCGTTGGT     33180
     CCATCGACCC AAACGGCGGA TTCGCGATCA CAAAATCGAA TCCTTCGCTG CATGCAAACT     33240
     GTCGACGGAA GTCAATCTCC GTTGCGTCGC CGAGCACCAC CTGATCCGCA AAATCCTGAG     33300
     CTGCCTCCAC TCTCGCGGGA TCGATCTCGA CACCGCATAC GGTAGCCGTC AATCCACTCG     33360
     CGCGCTGCGC AGCAATCAGC GAAACAAGGC TTCCGTTCCC GATCGTCGGA TCGAGGTAGG     33420
     TTGCCCCCTG CAGCTCCGAT CCACACGTGA GCAGCGCCTG TGCAAGCGTG CTCATCGGAA     33480
     TCGGCGTCGA GTACTGTTGA TTCGCAATCG AATTCGGTGT GCGCTCGCGC AGCTCCGGCA     33540
     TGCCGTGATA GATGCGGTCC GCGATGTCGT AGGCCGCGAG AGGGGCGGCA CCACGAGCAA     33600
     GCCCTGCCGC CACAACCTCG CGCGCGAAGA GCGCTCCGAT CTCTACTTCG ATTGCCTCTT     33660
     GGTACTCACG CGGGGCGAAG CCGCCATCGT TCGAGATCTT GATCAAGTTC TCGACGTTCT     33720
     CCCGCCGGAG CTTGTCGCTT CTCAGCGTAA TTCGCTGAAC GAAGCCCTGC ACGACTTTGC     33780
     GCAGTTGGTC CCGCGTGTGG GCATGAAGAA AGTCTTCGGG CGCCCCCTGC GCCTCGGCGA     33840
     TCAGGCGCGA CTCACCATTC ACGCGCCGAA CGACATGTCG GCCGAGAGCC GTCTCGAAGA     33900
     CCACTTCGCC CCGGTGGTTA AGGCCGAGCG CGCGCTGTTG CGCGAACGCC GCCTTCGCGT     33960
     TCAGCTGCGT CTTTTCACGA AACTGCCGCT GAAAAATCCC GGTGATGACT TCGCGGGCCC     34020
     CGCGCACGAA GCGGACGTTT TCATGCCCGA AGGCTTCATG GAGCATTTCC CGCGATACCG     34080
     CCGTGTCATC ACGAACGTAT ATGCCGGCCG CCTTGACCCC AGTCATCGGG CGGAAGCCAA     34140
     GCTTTCGAAT TGCCGCATCA TGGGCGCCGC CCATGTCGAC CATGGCGAGC GGCAACGATT     34200
     TCGAAGGGTC GCTGGGATGC TGCCAAGAAC CCATATACAC GCCGATCGTC GAGAGATCGA     34260
     CCCACGTCAC TTCAGTGCCC TTCACGGCCA TACCGCGCTC CGTCCCAATC GATTGCCAAT     34320
     GCATCGATTA TCGGTGCGCG GTTTGAACGC AATCAAACAC AAAATAGCCA ATTTTGGCGT     34380
     TTTTCATGCA GAATTATCTA TTTCGGACAC TTTTTAATTT TTGTTTTTGA TTCCGACAAT     34440
     AGGCGGCATG CGGCAACAGT TGTAGGGCGC CAGAGTATGT GCGACTGGCG CCATAGTTGC     34500
     GCTACTGGGT GACAGAGCTC GCACGACTGA CCTGCGAGTC TTACATGACG CGGGTCTAAA     34560
     GTGTGCCCGA ACTTCGCCAG CGCAACTCCG TCGGCGCGGC GGTAGGTCAG TCGCATCATC     34620
     TTGGGCTCCG TCAGGCGCCG AGTGAATTGC GACTGGTGCC GCACTTTTGG GAATACATGA     34680
     CGGACTTACC GCGACTGACT GGTTCGGGAC TTTTCTCAGG ATTCTGCACG GCGCCTCCGA     34740
     GTCAGAGCGG CGTGAATTGC AGCAAACGCT TCGATATCCT CGTCGGTCAG GCTGCTGTCC     34800
     AGCGCTATAG CTTGCAGCAC CTCATGCTTA CGCATTGAGA TTTCGGCTGG CAGTCGAAAG     34860
     ATGCGCTGAG ATGTGCGAGC AGCAGCGGCT AGTTGCTGCC TGAGTTCGTC AGTAAGTTCC     34920
     AGCGCTACCG ACAACGAGTC GAGGAATTGT TGGCCATCCG GGGTTCTCCT GCCAGTTTCC     34980
     ACCGCGCTTA CGTATGTGTC GTCCACTCCG ATACGTATCG CTAACGCTGT CTGGGTGAGA     35040
     CCCAATATTT TTCGCCTTGC TCGAATGAAG TCGCCCAGAG TACTCATGAG ATCTGTCTCA     35100
     TTGAAGTCGT CAAATAATGC GGCAATCCTA GCGGGATACT CCTCTTTTCG CAAACTTGGG     35160
     AGTTGGATTC TGTTCGATCC GCCCAGTCGC AATTACTCTG GCACCTCACG ACAGTCACGC     35220
     TTACTGGCCT ACTCCAGCTT GCCAGCAATG CGCTCTATCC CTACGCGCAG GCAAATGCCC     35280
     AGCATTTCCA ACGTCCAGCT CAAGTGCTCG TAGTTCGGAC CAAATTCCAG ATCGCCAACA     35340
     GACGATTGAT CGAACTCGTG GTCTAGCGCC GTCAAGGTAC TGTGCGCGGC ACTCCGCGAG     35400
     AATCCTCGAA ACATCGTTTC GTAGAGCTCC ACCAGTCCGG CCTCCTTCGC TGCGTCATAC     35460
     GCGGCCCACT GACGTGGTTT TTCTGCCGCC GCCGATATCA ATGCCTCAAT CCCGACTCGA     35520
     GCATCCGGCG CCACATGATT CATGATCGAA GCTACAGACA TAATCCCTCG CGCCTGCTTG     35580
     ATTCGCTCGA GCATGTCGTG CTCGATCAAG CGCTCCAGCA ACTCGGGCTT GTCGATCACA     35640
     GCTACCGCAT GGAACAGGCT CTCCACGGCG CTGCGGGCCA GCGTCAGCGC ATCAGGAATC     35700
     ATTCCCCGCT CGGCAAGGAG AATCCCACCT TGGCAAGCGC GAATGCAACG CATCCAATAC     35760
     GCGGCCGCTA CTACGGTAGA TAGTTGTTTG TCGCCGGGCG TCAACGCACC CAGCGACGCC     35820
     ATCGCCCGAT CCGACCACTG TTCGCACTCG CGAAACTCAT CTTTGAATTG CTCGCGTGCA     35880
     AGCGCCCGTT GCGTCGCCAG CGACGCCGAA AGAAACCCCT TGGCACTGAA GTCTTCCACG     35940
     TTGCTCTTCT CCATTTGCTA AGGCAGGCCG CGAAGTAGAG CGGTGATGTC TTCGACGCCC     36000
     TCAATCACGA GTACATTCGA TCGAAGGTGC ATGACGTGCC CGTTCACATG GGCTTTGTAT     36060
     GATGCAACCG TGGACACCAC ATTGTGCGGA ATTTTCGCCG CCATCATGAC GTTCCATTCG     36120
     CTGTCGAAAA CGACCCCGAC AAGGTAGTCG AAATGCGCCG CAGCGAGACT GCGGATCGGG     36180
     CTCAGTTGCG TTGAGCGATT CTGCGGTGTG ACCCGCCTAC CCTTGATCTC GTATCGAGCT     36240
     CCGCGTTCGT CCGTCGCGTC GAACCCCTTC GAGGATTTGC CGGCGAGCCG CAGAGCCAAC     36300
     TTCGATGCGA CTAACCATTC AGCGTAATCC CCGGTAGGAT TGTTCCCCGA TCGGGTGACG     36360
     CCCCGTTGCT TCAGCTCTTC AAGCACAGCG CAGTGCGCAG CGAGCAAATC GGTGATGGAC     36420
     GCTCCAGAGA GGTCAGTCTT CGTCGAGCTC ATGCGCGATG CGCGTGAATC CGCTTTCATC     36480
     ACTTCCCCTC CTCCTGACAG CGCATCCCGG GCTATGCGTC TTCGTCAAAC TCAATATTCG     36540
     CGCGAACACG CACACCGCCC GCAGCATCGA TCGACCACAG TTGGGCTTTG TGGACGTCGC     36600
     GTTGAATCGA GTACACCTGA GACGGGTCGT GCCAGCGGTA TCCGACTCGA TACGTTAGCC     36660
     CCTGATAGAT GGTCTCGTAC TCGCCGATGT TCCACTTCGC GTCGGCCTCG ATCTCCCGGA     36720
     AGCCGTACGC AGCCAAAAAG TCTTTCAGCG CCGCATCGCC CCTGATTACC AAAAACTGCT     36780
     CGTGCATCGC CATCAGATTC TCCTTTCGGC CCGATCGCGG AAAGCCGACA CTGATGGCAG     36840
     CGCCGACCAT GAAGGGGATG ATAGTACCGC TGTGGTACTA CGCCAATGGT ATTCAGCGCG     36900
     TGCTTCTCGG GATTGTCGGA TCCACCGCTC GCGAGAAGAA AAACCCGATC CAGATGCCGG     36960
     CCGCGTCCGC CACGACCTGA TACCACTCGA CGAATCCCCG GGCCGGTTGA GAAATGGATA     37020
     CAGCGACAAA AGGTTGCTGC CAAAGCTCGT ACCAGAATGC CCCCAGTTGG CAAGCAATCG     37080
     CAACGAACAA ATACAACCAC CAGCATTGAG CCATCGCCTT TGAGGACTTC ACTTGCCTCT     37140
     CATTCCTCTC CTTCTTTTTC TTCTCCCACT TGAGGACGAA CGGAGCGACC ACGAAGAACA     37200
     CCATGCCGAC CACGACAAAC GAAATAATTG CCTGCCCGAC CGCTGCGAAG TAAGTCAACG     37260
     AGTGCGCGAT CAACCAGTCC TTCGCGAGAA GCGCGGGACC AGAGACGAAA ACCGCAAGAA     37320
     CGGCTAGACC GATGATCGGT TGCCAGCCGA GCGAATAGCC CCTAGCCTCG ATCGTTGTAC     37380
     CAGCCGCGAA TACGACGATT CCAAAGAAGC CGATAGCATG TGCCATCTCG GCCCGCAACG     37440
     TCCACGAGAG GTATGCATGC GCGCTTTCCA ATGCTATCCC GATGAGCACG GCCGCCGTGC     37500
     CAAGCAAAGG CAAATAGTGC CCAACATCAA TCCTGCAATT CTTCGCTGTA CGACCGAGAG     37560
     TGTCACTCAT GCTGAATTCC GAATTTTCCA AGCTCCGTCG TTGCCATATG CGGATATTAA     37620
     GTGGCAAGCA AGGAAGCAGA CGACAACACT GTTTTGGAAA GGGGGCATCG CTTCCCGCTT     37680
     AGTTGAATTC TGTCCAGAAT CAAGCCGGTA CTACCGGGAT ATTCCAACCA ACGAAGGTCG     37740
     AACGCCCGGG GGCTTCGCGG ACCCCATGTG GCAACCGATC GTCGAAGATA AACCAGTCGC     37800
     CAGCGTACGG CCTGTGTCGC GTCCTACCTT GCTGGAACGA CAACGCGTCG TTATGAAGAA     37860
     CGATCATCAG CACCAAACCC TCGTCATCCG TGTGCAGATC GACGCCAGCA GTGACAACCC     37920
     AAAGATCGTC ACGCCCTCGA TAGCCGCCCT CAGCCCGGCG ATAGCCCAGT TGGCTCAAGT     37980
     TAGGCAACCA CGCGCTGCTG CCCCTGCTGG CCCAGCGCGG AACAGCGAGC GTCTCGACCG     38040
     GATCGCCGCT AAACTCGCTC GCCTCGGCAG CCGAGAAGAA CTCTTCAGCG ATGCTCGCGG     38100
     CGCCGCGCAC AACGTCGGCC GGCAGTTGTA CCGTTCCGAG AACTGAACCG AACGGAGGCC     38160
     TGCCATTCTG GGTTTTCAAT ACTTGCATAC CTGAACGCCC TCATACACCT CGTAGTGATC     38220
     GAGCACTTGC TCATCAAAAT GCGCGATTCC GTCCACCAAC GAGAGCAGTT CTCGATCGTA     38280
     AAGAGCATGC AGGTCTCTGC GCAGAAGGAC TCCGTCTTCG GCATTGTTGT GCCCCTCACG     38340
     CCAGTCACGT CCATGTAGGT GTGCCGCCTC CAACGCCTCC GGAATGGCAC ATCCGGTAAT     38400
     CGCACAACAG CCACCATACG CGAGGAAAAC GGCCTTTCGA AATTTGCTCT GATGCTGTCG     38460
     CACCAAGACG CTCGCAAAGC GCTCAGCTCG AACCTCGAGC GAGTCGCCTT CGATACCCTG     38520
     TCGATGCGCG TCCTCTGATG CAGGCATCGG ATCTGGCTCG GCGTCGTTCC AATACTGATA     38580
     GCACCGTTGA CGTTCAGCTT CGTCGTCCAC GATTCCGAAC TCGTCTTCGA ATCCATCTGA     38640
     ACACCGCCCT TCGGCAGATA GCAGGAGCGA TGTCAGCACC GGCTCGCCAG CGCTGACACA     38700
     CTCTCGCCCA AGCTTGCGCA TCGCGTTATA CAACTGGTAG TAGCCAAGAC CGAAGCGTTT     38760
     CATTGCGACG CCATATCTCG CGGTCGTCCG CTTCCGCGCG ATGCCAACAA GCCACTCACG     38820
     GAATGCGGGG AGCTTTTGGA CGAGAGTACT ACCCGAGACA CCCGTTTCGA GCGCAGTATC     38880
     AACTGGGAAC GAGCCTTCCC CCGCGTCGGT CCGGAACCAC CTGACGTGCT GCGAGATCCG     38940
     CCTAACCTCT ACGAGCTCCG ACAGGTCCGC GACTATAGCC CCATCGTCCC GAACATCGAG     39000
     CCCCTTGATC ACAAAAATCG CATCGTCTCG ATAGGATGCA ATCTTGCGCG GACGAGCGTT     39060
     GGTGTCCGCT GCTTCCACAA TCACAGTATA TGCAGCACAA CCGCCGGCCC ATATCGCTCG     39120
     GAGATGACCG ATTCTCTCGT CGAAGCCATA CGACTCGTCG TCATCGAATC GATCTGGATC     39180
     GAGCACGACG ACCTGCCGTG TCTTCCCAGA ATATTCATCC GCCCACGTGC GGAGAATGAT     39240
     CACGTCGTTT CGCCTTGCGC CCCAAGACCA CCGGGGATTC TTGAACGGGT ATCCCAAGTC     39300
     GCGGAAAAAC TGGGTTATTG CCTTTGCCAT GTATTGTCCT AGCGGATACC CGAAATATTT     39360
     CCTCTTCTAG CGAAGTGCCG ACAGAGTCGG CATGTTGTCG AGCTCAAGCA CTTCGACGCC     39420
     TCCATCACCA TCATGCGTCG CAATGAACTC GAACATCTCT TCGGTAACTC GCGATTTGTC     39480
     GCCGTCACCC ATGAACTTCA AGAATTCCTC GCCCAAAGAC GGCTTCGTCG CAAAAAATTC     39540
     GCGCACTCGC TCAGCCACAA CGCCATCAGG AACTGACGCG AGACCGGTCT GTTCGAAGCG     39600
     ATACGTTTCC TGAGGCGTAC CAAGGTAAAA CCGCTCGACA AAAGTCAGAT TCATCGAGAG     39660
     ATCCAGCACC GAGTCGCGAA AGATTGAGTC TTTCGCGTAG ATCCGACTGA GGTAGATCAA     39720
     TCGCGCTTCA TCGGCGGTTT GTGCGTCGAC GATATAGCCA AACGATCTCG AGATCGGTTC     39780
     ATCAGACGAG CAAACAAGAA ATTTAAGAGT CCCCATCACC ACACTACCCC CTCGCGTTGC     39840
     AGTCAACATC TTTCAATTCT TATCCACTTC CATGGCATAG GACTGGACTC CAGATAGCGG     39900
     GTTCACAAAC ATCTTCCTTG CTTCGAGCCC TCATTGCACA TAGCTGCAGT CACACGCTCC     39960
     ATCAAACCCG CGCGCATCGC AAGATGCAGA ACCGCCCGCG TATAAGCCTG CACATTCGTT     40020
     CCCGCCTCGG TGACCTGCGC CTTGATGAAC CGGTTCATGG ATTCCGGAAC CCCGATTACA     40080
     ACCTGAACAA GCTGGTCGAG CGGGTCGATG TTGCTATCAC CGGCCCGCCC ACGCTTACGT     40140
     GGCTGCGCCG CCGCTACCGC CTCGCCGACC AGCTCATCGA GATTAAGCTC GTGAGCAATG     40200
     ACGGACGTGT CCCCCTCGTA CGCCGGAACA GCGGATCGCA GGAGGGCATC GAGCGCTGCC     40260
     TTGTCGACTA GGACCTTCAT CAGACCTCCC CGGGTCTGTC ACCGCCTGCG AGGTGAGCGC     40320
     GCATGACCTC CACGACCTTC TTGTTCGACG ACTTGAGTTT TTTCACCCAC GTCTCTACGA     40380
     ACACGAGATC ACTATTCGGG TAAGTCGTTG CCCGGTAGGT CGACCGAAAC CCTGAACCGT     40440
     TAGGCGGCAA CTCAACCCTC CAAACAGTCT GGTTTTCCGA TTCGGAAAGC TTCGTTACGA     40500
     TCGGCGGTAG TTTTCGTCTT CTCATGGTTA GTCACAGATG TCAGTTGCAT GTCCACCCTT     40560
     TGCCGGCATT AGCAGGAGGC AAAGCCGCTC GAAATAATGC GTTGGGCCAG CTGGCGGGCT     40620
     CGGACCTCGT ATACAGCACG GTAGCCGCGC AGTTCTGCGT CGCTGCGAGC CAACGCCCGG     40680
     CGGACCAAGT ACAGGCAGTA AGCATCATCG CTCATGTCAT ATCCTCATTG AGTATATGTT     40740
     CATTGTATAT ACTCAATGAG TATAGTCAAG GCTTTTGTTC GAGGTGGCTA AGAATCTCCC     40800
     GGATAAACTT CCACGCCATG TCCGGCATAG CGCGATGTTC CGCCGAACTC GACGGGAGCA     40860
     ACCAGTTATC AAGCGCCCGC TTCTTTGCAC CAATGCGCTC GGCGAACTCC TCACGCGTCA     40920
     TCCCAAGCAC ATCCATGGCA TGCCGCAGAA AGTCCTGTTG TTCTTGCGGA AGATCCTTCT     40980
     TCACGCGTCC TCCAAAAATA TACTCATCGA GTATCTTAGG ACAAAGCGCG ACCAGAGTCG     41040
     ATCTCCGGCT ACTGATCGGC TGCTGCGCGC CATTCTCCAG CGCCCGAGCG ACGAAAAAAA     41100
     ACCGCTCATC CCTCATGAGG ATGCGCGGCG ATCCGGACGT ACGCCTGCTG ATTACATTTC     41160
     CGGCGACGGA GACTCGTCGC GCTGCCACGG AAAAGCACCC TCGAGCTCCT CTACAACAGA     41220
     CGGAATGGCC ATGGCGTCAC GCGGATCAAC TCGCCTCTCC AGCACACATT GAACTGCATT     41280
     CATGACATCG CCGACCCCGC CGACGGCTTT GGCCTGAAGC CGCAATACTC CATCGCTCAG     41340
     AACGTTGGCC TCGAGAAAAT CGTCAGTGTT CTGGTATCGC TTCACATAGA AACCTCCGCC     41400
     CACGTCATCC CACACCCCCG GGAGACGAGC GAGCACCGCT TCTTTGGACA TAGCCCCCGA     41460
     ATTTGCCAGC TGGGCTGAAG CAGCAAGGGC ATGTGCACGG CGAGCGTGCG GCGCCAGCAT     41520
     GGCGCTTGTT GCCGACCAGT TATCGGCCGG GAACTCTTCT GTCATGACTT CTCGAACTTC     41580
     GCTTTCGAGA TCGGGACGCG CGTTCGCTAT GAACGAAGCC AGTTCAGCCC GCGTCACGCC     41640
     ATCGACGTTC TCCTTCGCGA TGCCATCCAG CACGCGGAAG ACATCGTCTT TCCTGAGAGA     41700
     AGCAACCGAC TCTGCCGACA TCTTGATGTA CTTCTCGAGT ATCGCATCGT CGTGACGCTG     41760
     TCGATCTTGA ATCGGATAGA CGTCCCGTGC GTTTCGAGCA ACGTCGACAG CAGCCCTAAG     41820
     TGAGTCGACA TCGGCACCGT CGAGACGTCC CATGTCCTCT AGCTTAGATT GCACTTGACG     41880
     GACACGGTCG ACGCTTACAT CCTCCCCGAG TTCCGTTAGG GCGCCAGCGA TGATTTCATC     41940
     GGAAATGTAC AACTTATTCG GATTACTCAT TATTTAAACT TCCAGTTATT CGGAGAGATG     42000
     CCGCTAGATC ACCTATCCGG GTTATCTAGC GGCTGAATTG TGTTTTCTGG CGTCACATGC     42060
     CGAGGCTGGG AGACTGTTCC GGCTGCGCGA CAGGTGGTTC GCACAAGCCA GCTGCCACGA     42120
     CCGCACACCT CGCTCGTTCG GCCATCTCAT TGGCACGCCG CTGCAGGCTC TCCGACTCGA     42180
     TCCGGGCGAG TCGCGCCGCT TCCATCAGGT GATCCTTACG ATCCGTCACG CCCTCCGGAA     42240
     TGAGAAAATC CGCGTGGGAT TCCGAGGTAT GCACCCGAAG AAGGCCGCCG CGAAACTGCT     42300
     CGATATGCGG TTCGAAGTTC GCTTTATCGC GCCGCGTGCC GCTGTCGTTC GCAACCGTGT     42360
     TTTTCAGCGA GGCTTCGGAA GTCGGCGTCA TGCTACCGAG TCGAATGGCT TTCCTCATAG     42420
     CATCGGCCAC TGACAGATGC GAGAAGTCCG GGTACTCGAA ATCCGTTCCC GCGAGGTCTC     42480
     GGAGTGCCGC AGAGAACTTT TCATCGCTGT CGTACAGATT CGACACTCTG TCCACCCCGG     42540
     CATACTGCTT CAGAACGTTC CTCGCAACCT CGCGAATCCA ATCACGGTTC GCGTTCCGGG     42600
     CTTCCTCTTG GGAATCAATC GCGTCCCGCA GAACGTCCGC CGAACGCCAT GCCGTCATGT     42660
     ACTCCTTGCC GGGCTCCTCG CACCGGAGCT TAACAAGCTC GCCATCAACC TCGATCGGAT     42720
     TTGCACCGAA CCGCACCATA CGGCCGTCGT ACCCATCTGC AAGCGTCACC GTCGGTGCGT     42780
     TATCCTTCCC AGCCGTCGAT GCCTCAAGCG ACACGCTAGG AAGCCGCCTA CCTACGATTC     42840
     CGGCCGATTG CGCAACGAGT TCGGCGATCT TCATAGCCTT GAGGGCAACC GGACATCCCC     42900
     CTTGCGCCCG CTCACGAACG TAAGCGACTG CATCGTCATC AGACTCGAAT ACTTGTGCTT     42960
     CGTCATCCTT CTGAATTTCC AAGTACCCCG TGCCATCCAC GTCAAATATG TTCCATCCCT     43020
     GAACATCGGC AATCGCGCAA TCTTCACTTG TCCATGCTGG GAGGTCATTC ACAAATTCAA     43080
     TCCCGATCGC TGCGAACGCA CGGTCGTATG CCGTGAGCTC ATGCTCCCAG TACAAGCGAT     43140
     CATTAATTTC CGGCGGTTGA AGGAGCGCTC TGTCGCGTGC AATTACGAGC CCTTCGCGCC     43200
     ACGCGGAGTG ATGTGTTCTG AAATCGTCGG GGATCGAACT CGGCGAGTAA GCGGCGAAAG     43260
     CATCGTCATA CGCACGAATC TCGCGTTCCC AGTAGGTTTT ATCGTCCACA TCAGGCGGCA     43320
     CCACGCGCGC ATGATCGCGT GCGATCACCA ATGCTTCTCG CCATGACCCG AAGTGTGAAA     43380
     CAAAATCATC ATCCTGTTGT GCACCCGTTG CTGGCGTGCG TTGCTGGACA TTCGTCAGTT     43440
     GCGACATGAC CGCTCTCCTA AAATTGCGAT GGCTTTCCCA TCAATGAACC TGACTCGTAT     43500
     AGATTCCAAC GAATCGACTC GCTACATCTC GAAAGACTGG GTCGACGCGT CCGAGCACTG     43560
     CTCAACACAA TCCCGCGACG CAGACTTAGC TGACGGCGAA AACGAGATGT CCCAGTCACC     43620
     GATCCGAGTT CGATTGTCAT TGGCCACATA GGTCGTGCGG AGCGTCTGGA TGTGTTTGAT     43680
     CGCCACATCC GGCGATACGC CGCACATCGT CGCGATCAAA CGTGCTGCAT CCTTGAAGAC     43740
     CCACTTCTGG ATATTCGTCA GCTGATGCCC CTGCCAGTGG TCCGCAAGGA AGATGTGGCC     43800
     CCAGCCATTC CGATCGCTTG AAGCCGCCGC GATATCGTCG ATCGACTGCA TCGCCATAAG     43860
     ACGATCGAAT CCGTCGTCGT CGTCCTCAGC ACTGGGAACG AAAAAGAAGC GCCCCATTGC     43920
     CGAGCGCTTT GCCAAGACGA TCATGTCTCG TGTCAGGCCG GATTCGACGG GCATATCCGC     43980
     CCCCGCGCTC CATTCAATGG CGTTTCCATG TCGATCGAAA CCGATCACGT CACCGTCTCG     44040
     ATATGACGGA ATTTCGCCAC CTCCGACCAT GGCTGCCGCC CATCGCGGGA GCCGATCGAG     44100
     CTCGAACAGG TCGTATGCTT TGGGATCGAT GCTCACCTTG TGCTCAACAA ACAGTGAAGC     44160
     GGCCAACTCC GTAAACTGAT CTTCAGTTGC GTTCGCCCAC TTCCCGCGAT CTGCGACCTG     44220
     AGCTGCTGTC AATTTTTCAT TTGAGATATC GACGACAACG CGGCAATGGG CTTCCGCCCG     44280
     CCCGTCGTTG CTCCACGACC ACGCGTGCTG CCACTCACCG ACGAACCATC GGGATCTCGA     44340
     TTGCAGTCGT ATGCCGTCCG GCCCGTAAGT GTCGATCTCG ACTCTGGTTC TCGGTTCGGG     44400
     CTGAACATCA CGAAACATCG TCTGTACAGC GTCGATCTGA TTCCGAGCGT CGTCGACAGC     44460
     ACGGCGGACG GCGTCCGCCC GCTCGCCAGC CTGCAGCGAG GCAGAGTCGA TCAACCCGCG     44520
     AACTTGCTCG ACACGACTCG CCTTCGGGTC TTCTCCGAGC GCTACAAGCG CTTCGAGCAC     44580
     TTCATCGCTT GCAAGAGCGC TGTTGGTCGG ACGTACGTCC ATGGCAGGGA TCCTCCGAAA     44640
     ATTGGTGGTT TGGAAAGAAT CTTTGGTTGC CCAATTCGGC GCCGCAGCTA GACACCGCCG     44700
     CCCGTCACAA CGCACCGAAC AGCCGCCGAT GGCAGAAAAA AAGCCGCCCG GGGGAGGCGG     44760
     CTTCAAATTC CGTCCAAAGA ACGGAAGGCA CGAGACGTGA ATTACATCGA GAGGTCGACT     44820
     GCGTCGGCCG AAGCAGCCAG CTCGCCGTCG ACGTTGCTCA GTGCGTCCGG ATCGAACTGT     44880
     TCGCCGCTCG TATCGACGAG CTCGGCCGTC GCCTCGTTCG CGCGCTCGCG CGAAGCTTCG     44940
     GCCGTCGCCT TGTGGTCATT CGCGGTTGCG AGCGTGTACA GCGACTGCCG CGTCGGGAAC     45000
     AGCTCGACCG GGTTAGCCTT GACGAAGTAG CGGTATTCAC CGGCGCCGAC CTTGGTCGTG     45060
     ACGTACGTAT CGAAGTAAAA CTTGACGTTG TCACGCTGCT TGCGCGTTTC CTTGCCGTCC     45120
     TCGATCGTCG GCACGAACTG CGTGCCGCGA TACTGGTGCA GCGGATGCTT TTCGTTCTGC     45180
     GCCTGCTTCA GGAAGCTCGC CTTCGTCGCC GGACCAGCCG AGATGCGCTC GCCCGGGATA     45240
     ATCTCGGCTA CCACGGCCCC GCTGCGCACG GCATCGACGA TATTGTTCAG ATCGCCGCGC     45300
     AGTTGATCGC TTTCGACCTT GCCGAAGTCC GGATAGCCCG GCTCTTCGGA CAGGCCGAAC     45360
     ACGACCGAAC GCAGGATCAG CGCGTCACGC TCGACGTTGT CCGGGCTCAT GATGTGCTTG     45420
     AGCGTATCGT CGGCCGGCGC AATCCGATAG ACCGCCTTGT CGATGCCGAG ATCGTGGTCG     45480
     CGGATCTTCT CTTCGACGAT GAGCGGATTG ACGCGCATTT CCGGAAGATC CGTGATGACG     45540
     GAACCGTCCT TTCCGACCAG ACGCATGAGC ACGAACGGCT TGCGAAGCGC TTCTTCATCG     45600
     CGATTCGCGA ACGCGCCGAG CAGGAATTCC TCGGCGTTTT CATTCGTGAG GATCGTGGCC     45660
     GCCTCCGGCT TGATGATGTC GGCGTGCACA AACGACGAGA CCACACGCTC CTTGTTTTCG     45720
     CGGTCGCGGA TTTCGCCGAC GGCGATGTGT GCGCAAACCT TCTGGCACGC GACCCCCGGG     45780
     CCGCTTTCGA GCGTCTCGAC CCAGTGCGCC TTCAGGAGAC CGTCCTCGGC CGGCAGCACC     45840
     TTCGTGAACA TCAGCAGACC GCCTTGCCCG CAGTGAACCT TGCTCTTCGG ATTGCCGATT     45900
     TCGGACGGAC GCGGCCGATG CTTTTCACCG GTGCCGAGAT ACTGGTTCTC GATGCGCGCC     45960
     TTGGCCGCAT CGAGCAGTTC GCCCTTGCGC GCGTTGGCGA GCGCACCTTC GTCGACGAAC     46020
     ATCATCCGGA CTCGGATCGG TTCGTTCGTG TCCGGGTCGA TGCCGTGAAA AACAGCCGGC     46080
     TTGTCCGGCT CGTTCACGAT GCGGTCGAGG CGCATGACCA CATTTTTCGG CACTTCGGCC     46140
     TTGCGTTGCT TCTTAGCACC ATTCACGTTC AGCGCGTTCA GTTGCATGAC TTGCTCCTAA     46200
     GAATCGTCGA TCAGACAGAA TCGACCGCTC TCCGCATTCA TTCGCTGAAC GCACTAGCGA     46260
     TCTAGGTGCA TTTTTAGCAT GCAGATGAAC CATATGCAAA AATAAATCGC CCAAATTGGC     46320
     ATTATCCAAG CGTTTGCTTC CGCCTGTAGC GCAACAACAT TTATTTTTTT AGATCGAAAT     46380
     GTGAGCTGAT TGCCAATTTT ACTTTACTCG GGCTGGCGCG GCTCGGCTGC TGCCATCGCA     46440
     ACCGTGATGA CACGCTCGTG GCCGCGCTCC CGCACCCACT CGCTGAAGTT CTCGAAAAGC     46500
     GGACCCAAAT CGACTGACTC GACATTCGGG CCCATCACCT CGCTACGAAG AAAGTCCGAG     46560
     AACGCCAGTG CAACGACTTC GCTCCAGCCC GGTTTGGTCG TGGCGACCGA CACCAAGCGA     46620
     TAGCCCGTAG AGGCCCGTTC CGTTCTCTCG AAGCTGATCG TGGCAAAATC CACGCCGAAA     46680
     TCCGAGACAA ACTCCCCTGT CATCCACAGC AGCGCCCCCA ATCCGCCGTC CGGAGCTGCC     46740
     AATTCGTCGG CGTCGAGGCC GTCGCCGTCT CTGAGCAATT TCCCGCCCCG AGCCTCGTAA     46800
     TCATGAGCCA CCTTGCGCGC GATTCGCGAA AGACCGTCGA TGAACGTGTT CATAGTGCGT     46860
     CCGTTGGATA AGTTTCATGT TTTATTTTAT ATCACTTCTG TGCACATATC CCTTAGAAGA     46920
     CGACGATATT CGTTTTTTTG AGATGTCGCG TTCGAATAGT AACTTGGCGT TGATAAAAAA     46980
     AGCCCGGCGT ATGCCGGGCC CTCTCAATTC GAGCGGAATC GCGCTATCAA CGCGGCAGCG     47040
     CCAACCGCAC GGCCTCACGT CCCGCGAGAA TTCGGTCAGT TGCCTGTTTT CCCGCCTCCT     47100
     CCAGCAACTC GACCACCGTT ATGTGCTGCT CGATACCCGC GCGAAGCGCT CGAGCAAGTG     47160
     TCAACACATC CAGTCGCTTG TTCGTCATCT CGACCCATGC GCGAGAAAGT GCCTCCGCAA     47220
     ATTCAGGCTC CAGATCTCGT AGCCAAGATT CGACGGGGCC CAGTGAGCGC GGCTGCAGTT     47280
     CGCTGTGGAT CACTTTCGGC AGCTCGTTTT CTCCGTGAAT GTCGAAGTAG CCAAGACCCG     47340
     TGTCGTCGAC AAGCCCAAGC TTCAGGCCGC CCATGACGGG GTCACGCATC TCGACAATTT     47400
     CACCGGGAGG GAGTCGTTCG ATGGTCATAT TTCATCTCAT GAAGTCATTC AGAATGGCTC     47460
     GGGAACCGAT TCGTCCAGCA CAGCGCTTTT CTGGGTCGCG GCCGCCGCTC GCTTGATTTG     47520
     ATCCAACAAT CCGTGCTGGC GAAGCACCTC TCGCACGCGG GCGTGCGGAT CCGACATCGG     47580
     CTGCTCGATG GCATGCTCGA TCCGAGCCGA CGTATCCGAT CGGAAGCCAC ATGAGGAGGC     47640
     ATATGCGAGC CATCGCGTCC CGCGTTCGTT CAGCCGAAAG CCAACCCCCT TCTCCTCGAG     47700
     CAAACCTCGC TGCAAGAATT TCGAAGCGTG CGCGACGACG GTACTGGGCT TGCCGAGCCC     47760
     TACCTTCACC ATGTAGCGCA GCAGTGCCAC GGGACGCGGA ACGAGACTGA GGCCAGCCTG     47820
     CCGCTCGACA AGCTTCCACG GGCGTCTCGG GCGGGCGAGA TCGCACTCGA AGCCGAGGAC     47880
     CTCGCCGTCA ACTCGTGCAC GCACTCGCCG ACGCTTCGCC AACTGGCCGC ATTCAATCAC     47940
     ATTGCGTGCG ACCAACACAG CCAGCGCCTC CGCGTTATCC AATACGCTCA TTGGGCGCCC     48000
     GAGCAGCAGG TCATCCTGCA GAGGGCGAGG GCACTCATGT GCACGGCGCC CTTCAGCGTC     48060
     CGCGTTGCGC AGTGGGAGCT GCGCCGCATC GAACACACAC CCGTTGTGTA CCGCGATCGC     48120
     CGCTGCAACT TCGACCGCAT CTTGCGTGAA CGCACCAGCG CGCACGCGCG GGTAGCTCAC     48180
     TAGCCCGCGC TCATATGCTT CCTGAAACAC GGCAGCCGCA TCATCAATGC CGATGCGCAG     48240
     CCGTAGGGAA GTCTCCGCGA CAACGTCCTC GTAACCCCAC GGGCGTGCGG CCGGGACATC     48300
     CACTTCGAGC GCATCCAACA AGTGAACTTT CGCGGTTGCA GCAAGTCGCT CGAGCTCCAT     48360
     CGCCCGCTCC ACATCGGCGT CCGTTTTGAT GGGAATGGAA GTCCAATAAA CGCCTCCGTC     48420
     GCTTAGCTTG AGCGGGACCT CATACTTCCC GATGACGGGT GGTTCGGATT GGAGGTTCGC     48480
     AAGCAAGGAG CTTTGCACAC GCCCGACAGG TATCGTCGCG GCCCCATCGA CCTGCGTGAA     48540
     AGCGGCGCCG ATGGCTCGAT CTACGATTCG TCGGCAGATG CCATGCCAAG CCGGCGTGTC     48600
     AAAATCGCGG GAAAGCGAGC CACCGAAAGA CTCTTTCAGC TCCGACTCTG TGATCGCGCG     48660
     CAGGCGAACC CTGTAGAGTC TGTCACTGTA GTCCGAGAGA TATCGCGCCA TGTCCTGCGC     48720
     GATGACGTCA CCTTCGTGGT CATCGTCAGT GGCAATGTAG ATTCGGTCGG CATTGAATGC     48780
     TGCCCGCTGG ATCTTCCCCA GCAGCGCCAG ACGATCCTCG CGAAACGCGT ATGCGGTCTC     48840
     CCGTAGATCC GTATCGAGGC AGATCGGGTT GAGCGAACGC GGATTGTCCG CAACATGCCC     48900
     GACCGTCGCA ATCACGTCGG CGGAGAAGCC GATTGACTTG AGCGAGGCGC GCAGGGTATC     48960
     GACTTTCCCT GCTGCCTCGA CAATGACCAG ATTGCGCACA CTGCCTCCCG ACGCTCGCGC     49020
     TCAGATGTGC GCCGTCACTT CTCGCTGGCG CTCTTACCGC GAGGGGCCTT CGGCACCGGA     49080
     ATCAAAGGCC GCTTTTTCAG CATCAGGTGA AAGTCGCGCA ACATCTGATT GGCCATCTGC     49140
     GTCGGCGTAC GGCGGTGCAT GCGACCACCT TGCGAAGCCG CAGCCTCCTC CTCGACAAAG     49200
     GCCATCACGT CCGGATCCAG TGTGATGCGT CCTTGCGTCC GAGTACGCTT CCGGCTCCGA     49260
     TCGAAAATGC CGAGATCGAG CGCCCGCTCA CGAATCCGGT TGTACTCGTG ATCCTTCACG     49320
     TCGAAACGGT TGCGCAGTTC GTCCTTTGCT TCCCCGATGG TCTGCCCGCT GTTGACCAGC     49380
     GACACAAAAA TCAGCGCGAG CTCAGTATCG CGATGCAGCC TCACCAGACG ATTGTAGGCA     49440
     GCCTCGATTC GGCGCCCGTG AATCTTTCGA TGCTTCTGGA CGTCCGAGAT CTCGAATTCG     49500
     ACCGTCTTCG CTTGGGTCTG ATCGTCGATC GTGACCTCAA TAGCCGGCTT CTCGCCGTTG     49560
     GCTTCCTTGA TCCACTCGTT ACGTGGCAGG AATTCGAGGA GACCGCCCTT GTTCCGGATC     49620
     TTCAATCCGA ACATCTTGAT CACGAAGACG AAATCGCGCT CGGCGATTCG TGCGCCCGGG     49680
     CCCAACCGTT CATCAGCGAG GCTGCGGAGG AATTCCAGCG ACGCGCGAAC CGGCGTCGTC     49740
     ATGCGGTCGA CGACATAGTC GACATCCACC ATGAGCCGGG CTAACGCATA GACGGCGTCT     49800
     TCCGACGAAG CGTCGAGGAA CGGATATGAC TTCGCTGCAT GGCGGATCAT CCCCCGCAGC     49860
     TGGAGCTCAT CCAAGTCCCG GTGCTTACTG AGAGGAGTTG GCATCGTTTT CGCATCACAC     49920
     TGATATTTGT TTTTGTATTC TACATGATAC GAAACGATTT GTGATGTTCT GCTTGAAGTC     49980
     GTTCACGCCA GCGAAATTCA GGCAAAAATC CGCAAGATTT CAGCATCGAG GTGTGCGACT     50040
     GCTTGTCGCG GATCTTTTCC CGAAGCTATC GCCGCGTCCA AAATCCGTTC AAGGCCACGG     50100
     CACGTCTCTG GCAACTTCCA GTCCGGAAGG TCGTCTTTAG CGTGGATCTG CCGCGCGCGA     50160
     CGCTCGATGG GCCCGCGCTC CCACTCGATT TCGAGAGTGA CGGGCAAAAG ACCGAGCTGC     50220
     ACTGCCGAGA TCGGCTCCAT CCCATCCCTC TAGTGGATCC AGCGCGCACT GCGCTTGAGT     50280
     TGTCTTTCGT TGATCCGCTC GACCCAACGC CCAGCTTCGC CGGCCTCCAT TGCCGGCGAG     50340
     AACATCTGCA TCGCAAACAC TCCCGGCCGG TTCAGTATGT TCGTTGCCGG ATCGAGGTTG     50400
     CCGTAGCGCA GAAAGGCGCC GAGGACTGCC TTCTGATGAC GCATCTCCTT GGATACGTCA     50460
     CTGGGCGCTC TTACGAGCGC AGCAAACGGA ATACGGTCGG TTTCGCTTAA CCCGGGCCTC     50520
     ACCTCGACGT CGATAAGCTC CAACGTTCGC ACGATGTCAC CGAAGACGAA CCCAAGCCCA     50580
     TGGCCAACCG ACGCCTTCAT GTCCGCTGCC GCTTGCCCCA TCGACACGCC CACCTGCGGC     50640
     AGGTACGCGC CGTATGCAAT AGACACCTCG CCCTCGTCCG GTTTGATCCA GCGATCCATC     50700
     AGCGTTCGCG CCTTCTCCCG GATAATCGCG AGCTCGACGA CAGACAGCAT CAAGTCGCCC     50760
     GACGGCAGCG AGTGAACAAT GAAAAACGAC CCGCGTCCCG TCAAGGCTTC ACCCCGACAA     50820
     GACATCCCGT ATTTGCCTTG CCCGGATCAA GCCCCATCGC TTTCAGCGTA TCGAGCGTCA     50880
     CGCTTTGCCC CTGCAGAATC CCGCCACCTT CCGGCGGCTG CTTCAGTGCG CTGCCGATCA     50940
     TCGCATTCAC GCGCTTCTGC GCGTCCGGGC TCATCAGCGC CGACGCGATC GGATCCTCCG     51000
     ACGGACGCGT CTTCGCGTAA ATCCCGTAGC CAGCCATTGC GAGCGCAACG AGCATCGCGG     51060
     CCGCAAACAT CAAGCGCCCC GGACTCATCC AGCGACGCGC GGTCGCCACC TCAGGGCCAA     51120
     ACTGTTGCCC GTGTTGCGTT GCAGCCACTG CGGCGTTCGC GCCAACCACG TATTGCAGGC     51180
     CGCCTGCCAC ACGCTGCTCG TGGAGCTTGC CGATCGCATC GAACACCGCG CTCTGATAAC     51240
     CCTCGCGAAG AGATTCAAAG ACACGTCCGA GCCGACCCTT GATTTCGACA GGAGCGGTAT     51300
     CCGGCGAATC GACTTCAACA TTCGCGACCA ATGCGCCCCC CTGCCCGCCG ACAACAATCA     51360
     CCCTGAAGTT GGTCTCGTTA GCCGACTCGA TCTCGATCTT GGTCTGCTCG AGGTCCTCGC     51420
     AGGTCAGCTT GGCGATGTGC GACTCGATCC TCACACCCTC GGGGACGACC CAGTCGAACG     51480
     CGCGCAGGCG AATCGTGAGC GTCAGGCCGG CAGAACTCTG CTGCGGGAGG ATGTCAAACT     51540
     TTGCCAGCGT GGTCGTCATT TGCTCATGTC CTTGAAAATA CGGTTCAACA ACTCGCGATC     51600
     GTCGAGATTC GCCACCATCT GCGGCGCGCC GTCCGACGTC TGAAAGAACG CGACCGGTAC     51660
     ACCCGGCGTG CCAGCGCCCT TGTTGCGATC GAACGCGGCC CAGAAGTACT CTTCGTTGTC     51720
     ACGAATCGCG TCGAGTGTTG ACTGCTCGAT CTTGCCCGGC TGACGGAAGC CGCCGCTTTC     51780
     GACCCGCCCC ATCGCTTCGA TCGGATTTCG CGACTGTAGG ATGTCTGCGA CCATCGCCGT     51840
     ACCCATTTGA TCGCGGCCAA GGACCGTCGT CGGAATCCAC TTGATGGAGC CTCCGTTCTT     51900
     CACGAAGTTG CGCGTGTCAC GGTAGACGTT CTGGCAGTGC GGGCATCGGG GATCGAAGAG     51960
     GATATAGATC GTCTTTTCAG CGGCGCCACT ACCTTCCTTG ATTCCGCGCA GAGCGGCGAC     52020
     AGCCGCAATC GGAGTCGACG GCGCCCCCGC CTTCGCTCGC GCGGGTGCTC CATTCGATTC     52080
     CGCAGCTTGT GCGGATGCCG ACTGAATCAT GCTCGGCTTG AGAAACGCAT CGGACAAGTT     52140
     GACGCCCGAT TTCGCATCCC ACAGCACGCC CGACATCAGC ACCTTGTTGT CCGCAGTCGT     52200
     GTACAGCACG GTCTGGACAC CGTTGCGCTC AACACTCCAC ACGTTCAAGC CGCCGGGGCC     52260
     CTTGCGGAAA TCCAGCACTT TGATATCGCT CGACGCGAAG AATGCCGGCC GCTCAACGCC     52320
     AGCAGGAACT GACGGCCCGT CGGCAAACGC CTGCGTGACG GCAAGTGCTG CCATCCCCGC     52380
     AAAAAGAGTC TTTTTCAACG TTCGAATCCT TTTACTCGGT AGTGTTCTCG AAGGTAGACC     52440
     GCCCATTGCC GCGCGAGCGG GATGATCTTT TGCTGATAGA TCGCGTTGAA TCGCGGTGTG     52500
     CGCGAGTGGT AGTTCGCGAC ACAGGTCCAG TACGACTGCT GACATCCGGC GAGCTGCCGG     52560
     CGCAGCAGAT AGGCCGCCAT CGCGTAGTTG TAGCAGCCGT CAAATCTCAG GTAGTGGACT     52620
     GCCGTCGCAG CCGATACTCC GTATCGCTCG AGCTCTTCGA CGTGAACAGT ATTGATTCCG     52680
     GCTCGACCAA GATCGAACGT GCCATTGCCA TTGCGGATAG CGCTCCCCTC GTCGCCAGCT     52740
     TCATGCTGTC CGATCGCCAG AAGGACGTCG GCAGGGACTT GGTAGCGCAC GGCCGATTGC     52800
     AACACACATT CAATCGAGGC AGGCCGATAC TGTTCGACAT CGTAGTAGTT CATTCACCGA     52860
     GCCATGTCCG ATAGAGCTCG ACAGTCTCCG GCCCGAACGA CGATACATCG ATTTCCTGCG     52920
     CACTTCGATA CAGCAGCGCC CCGTACACTT CGGCCATCTT GCTAAGCGGC GCACTCAGCC     52980
     GCATCCTCTC CGGCGGGTTG TCGTCCCGGC ACCGATTGAT CGCCGTCTCG ATCTCGTGCA     53040
     GCGTGAGAAT CATGGTCATC ACCGTTCGCA AAATTCTTGA AGAAGAAGGC CCGCATCAGC     53100
     AGCCCACGGT ACTGATCGCA TGTGCGCTCG TCGGGATTCG ACGAGCTCTC CATGCGCGAC     53160
     ACGAGCGTGC GAGAGATCCC CCATGCGTTT GCGAGCTGCT CTTGGGTGAT GTCCAGCACG     53220
     GAAGAACGAA TCGCCGCAAG ATCTTTGCCC GTCAGGCAGA CACCGCCAAA CCGACGCAGT     53280
     ACCAACTCGG CCTTGTCATC CAGCTCGATC ATACGAACCA CGCTCCTCTC TTGATCCAGA     53340
     CTTTTAGTGA ACCGGGCACG AACAACTTGT CTTCCTGCAA TTGCCAAAAG CGGTAACTCG     53400
     CGATGGCGCC GCGCACAAAC AACAGGAGGG CTACCATCAT CGCGGTGAAG AAGAACGAGC     53460
     TCTTGAGGCA AAGGGCAACA ACGGAGAGCG CGAGGCAGAA AATGGACAGC GCGAAAAACG     53520
     TTCGGCTCGA GCGCTGCAAC TGCGCCAGCC GGGTGTCCCG AAACGACGCG TCGCTAAGAA     53580
     CCTCGTCTGC CGACGCGCGC AAGGCGGCCA TCGACTCAGG GTTTGACTCG TCGCCAGCAA     53640
     ATTCGAAGTA GTCGCAGCGG TCGCAGCCAA GAGCGTCAAC ACGTTTCGCG TCGACCACTT     53700
     CCGAGAACGG ATAGAGGGTT CCCTTCCGGC AACTCGGACA TCCACGCTTC GTCGCGTTGT     53760
     CCCAATTGCG CCGTACGGTT CTCCAACCCG CCGCGATGTG CTGGTATCCA GCGATGTATG     53820
     ACGCTTGCCG GACGGCGAAG CGGCCGGTGC GCTGGAAGAA GCCCATTTCC TCAGGCTCGC     53880
     CGATTGAACT GCTCGATGGC TTCCAGCACT GCCTCGTGGC TGCACATGAG CACTTCGCCA     53940
     TCTACCGTGA GGGCCTGCTC CTCGAAATCA AGGAGCAAAT CGAAAACGAT CTGCGTGTCG     54000
     CCGCCCTCGC TGGACGTCGC CACGTCGCGC TCGGTGATAG TGAGCTGGAG TTGGTTCTCG     54060
     CTCAGATCCA CGGACGCGAT CGCCTCGACG GTCGCGCCCT GCCCAACGGG CCACGACGCC     54120
     CGCTTGCCGC ATTCGTCGTC GCCGTCGGAC CAGCTCCATG CGCGCACTTC TTCATTCGCA     54180
     AAACGGGCAC CGTACTCGGC GAGAAAGCCC GCCGCATCCG TCACATTCAT ATCGACACCT     54240
     CTCAACGATG CGTCGATTAT AGTGCTTTTC AGAACATCAT CAACAAACGG GTGCAAAAAA     54300
     ATATCTGTTT TTGAATGTCG TCATAGCCAG TTTGGCGGGT TGGCATCAGC CGCACTCTCC     54360
     AAATCCTCGA TCGTTGCATC CCAGTCCTCG AGCGTCGCGG GTCCCGGCGT GATGCCCTCG     54420
     ACGTAGCTCG TCACGCGCTC GAGCTCTTGT ACCCCACGCT GAGCAGCAGT CTTGTTTTCG     54480
     AGCGAATCAC GCGACGTGCC GAGGGCGATA CGGGTCGTCT CAATCGCATC GGCTAGATAC     54540
     GACTGAATTT CGTTCGGTTC CTCTGCTTGA CCCAACACTC GGAAAGTCAG AGCACTGACC     54600
     CGCGTCTGCG GCTCTTCGGC ACCAGCCGCG TCGGCAGCGC CACTGCTCGA GTCTGCGCTT     54660
     TGTTCGTCGC TGCGACCGAA ATCGTAGCCG TCGAGGAAGT CCGTAACCTG CGTCTTGGGA     54720
     TCAAGCGATA CCGTCTCTTG CGAAACTTCG TGCTCGACCC GGACCGGAGT CGGCTTCAAG     54780
     GCCATTCCCA TGCCACCGGA TGACCCGCCC CCAGACGACC CACCGTCTCG CCCGTCGCCA     54840
     GCGTCACCCG AGCCCGCGTC ACCTGCGGCA GTGCCGCCCG ACGACTCGAT CTTTCCGCTC     54900
     TTGTCCGCGT CGTAATTTGG CGGATCAACG TCGTGATCCA AAGAGATGGG CTCCAGCCCG     54960
     AGGAGCGAAG CGCTAACAGC CGTCCCGTCG GATTCGAACG GTGTTTCCTC GGTCGGATCG     55020
     AATTCGAGCG CGGGTTCCTC CGGCGCCTCG TCCAAGACTG CCACGTCTGA CTCGCCAACC     55080
     TCTGCGGACG AAGCCACCAC CGGGGCCGCT GCCGCAAGCG CGCTGCTCGC CAGCAGCTCG     55140
     CCGTCGGCTG GCGCTGGCGC AGCGGCCAAC GCAGCAGCGC CGGCAACAAC CTTCATTTCT     55200
     TGATCGTCGC ACACGAATGC AACGCGCCAC GCCTCGGGGA GTGACAGGCT ATGCTTCTCC     55260
     CGTGCTTCCC GCATGAAAGT GCTCATCTTG TAAAACGGCT GCTTCATCGC CAGCATCGCT     55320
     TCCGGTTCGT TCGGGAATGC TTTTGCGAGC GAGCCATCGG CAATCATTTT TCCGAGCAAC     55380
     TGCTCGAGCT GATCGAGCCG TTCGAGGTCT TGCTCGCCGA AGCCCGACTT CGGCGGCTCA     55440
     ACCTTCAGGA AGTGATTGAT CCGAATCTCG TCCGGCGCCT CATCAACCTG AGTAAAGAAG     55500
     GTTCGCGCCC GAATCACTCG CACCCCACCT GCGGATTGCG AGTTCTTCTT CCCGATCAGG     55560
     AACGTGAATT CGCCGTTTTC CTGCTGCGCA AGGTCGTCAT ATTCAAGACG CCTTACACGG     55620
     TTGACGCGCG CGTCCATGTT CGTCGACCAC TTGAACATGC TATCCGCGTT ATGCTCCTTG     55680
     GCGCCGTTCT CGTAGACGAG GGTTTCACCC GCCACGCCGC GAATGCGCTC CCAAGTCTCA     55740
     GACTTTTCAC CCGACGTTAT CTTGCCGACA CATCGGACGT TGGTGTTTTC CCACGTCGCA     55800
     TCAGCCTCCT CCTTCGATGC TTTTTGCAGA CTCGAGAAGT CCTGCGCCGC GAAGGTGATG     55860
     CAGTTATGCG TGACGATGTC GTGGTCCGTG ATGTAGCAGT GCATCTCATC AGCGACCACG     55920
     AGACAGCGGG CCGGCTGGTT GCCGATCGTC GAAACACTGG TCACCACCTC CCATCCAAGC     55980
     TCGTCGCCAC CGGCTGTTGC GAGCTCGACG GTCATGCCCG ATTTGACCAA CACTTCGATT     56040
     TCTTGCGTCG TCACCACCCG CAGCTGCTGG TACATTACGC GCACCGGCCA GTGGTGCACA     56100
     CGCGCTGCTT CGACAGAACG CCCAGACTCC AAGGTCAGGC GCGCGATCGG CAACTCCTTA     56160
     TACTCCAGCA CCTGCTCGAC GCGCACGGCC GTGCCGTTCG GTGCAAGGAT CTCGTCACCG     56220
     ACCTGCATCT CCGACATCTT GCGTACAGTC CCGTCCGCCA TACGCACGAG CGAATGCAAG     56280
     GGCTGCGGGA ACCCAAGAGA TCGTGCCTGC GCAGGCGCGA CTGCAAAACC GAGAACGGCA     56340
     TAGTACCCAT ACTCGTCGAG AACGACGTAG AAAGGAACAG CTGCGTTCGT TGGCCGCGCC     56400
     TTGACGATCT CCCGCACCGA GCCCTCAACA CGGTTGCCGA GGCATCCGGC CATCATCTGT     56460
     TTGATCGCGC CGACGATCAA CTTGCCGAGC ATTTTCAGCG AGTCCGGGGC GCGCTCGAGC     56520
     GCCGGGAGCA GGACCGCGAG GATTCGACGA TTGATAACGA CGTCGTACAT GTCGACTTCG     56580
     CCCAGCAGCG TCTGGAAAAT GTACCCGTAC GTGAAGCTGA GGTCACCAAA CAGTCGGGTG     56640
     AGCTGCATCG TGATGAACCC GTGTTGCTCG AGCGTCTTCT GCTCCTGCTT GCCCTTCTTT     56700
     TCCTGCGTAT AGCCCGGCAG TGTCAGGACA AACGCTTTCA ACGGTTCCAG CACCTTATCG     56760
     AACAGCGGAT CCTTGATTTG GATCTCCTTG CCGTCGATCG TGATCCGCTT GTCCCATACG     56820
     ATCTGTTCGA TCACGGGCAA CTCGAAGTAC TCGATGAACT TGTTCGAGTC CAGCAAGGGC     56880
     GGAGTCAATA ATCAAGTGCA ACATCCCTGA TCTGCCTTGC ACTTGAGCCT GCCACCTTCT     56940
     CATGGGAACG CACTACCAGC ACCTGAGCGC CGAGGAGCGC GCCACCATCA TGATCCTGCT     57000
     GCAGCAGGGC TGCTCGGCAC GCGGCATTGC CCGCACGCTG CGACGCTCGC CGTCGACGAT     57060
     CACGCGCGAG ATCCGGCGAG CGCTGCAGTG GCCGCAGCGC ACGGCCTTCG TGCCGGCAGG     57120
     CAGCGGCGGC TGCACCTACG ATGCGCGGGC AGCCGGCGCG CGTGCTTGCG CGATGCGCCT     57180
     CAAGCGCCGA CGCCACCCCA AGCTGGCCGA AGACGGCGTG CTCTTCGGCG TGGTGCACCA     57240
     CTTCTTGCTG GAGGGCTGGT CGCCGTCCCA GATTGCCGGC ACACTCAAGC GCATGTGGCC     57300
     CGACGATCTG GATCGCCGCG TCTCGCACGA GACCATCTAC AACTGCATCT ACGCGATGCC     57360
     GCGCGGCGAG CTGCGCAAGG AACTCATCGC CTGTCTGAGG CGTGCGCAAG CCAAGCGCAT     57420
     GCCGCGCTCG CGTGGCCAGG ACCGGCGTGG TCAGCTGCCC GACGCTGTGA GCATCCACCT     57480
     GCGTCCGCCC GAGGCCAACG AGCGGGCCTT CCCCGGGCAC TGGGAAGGCG ACCTCCTCAA     57540
     GGGGGCGGCC AACCGCTCGG CGGTGGGCGT GTTGGTGGAG CGCAGCTCGC GTCTGGTGCT     57600
     GCTGGCCAAG CTCAAGGACG CCACCGCAGC CTCGGCCTTG GAGGGCTTCA CCGCCAAGCT     57660
     GCGCAGCATT GCCGAGCCGA TGCGAAAGAC CCTCACCTAC GACCGCGGCA AGGAAATGGC     57720
     GCGCCACCCC GAGCTGTCTG AGGCCACCGG CATCCGGGTC TACTTCTGCG ACCCGCGCAG     57780
     TCCGTGGCAG CGGGGCAGTT GCGAGAATAT CAACGGCCTG CTGCGCCAGT ACCTGCCCAA     57840
     GGGTACGGAC CTGTCGGTCT ACAGCCAGGA GGAGCTCGAT GCGATCGCCG ACCGGCTCAA     57900
     CAGCCGCCCG CGCGCCATCC ACGGCTTCTA CCCCCCGATC GCCGTCTACC AGGCCATGCT     57960
     GGAGAAAGTC ACCCAAGCCA GCCACTCCCT TCAGTGATTC CACCGTTGCA CTTGGTGCTT     58020
     GACACCGCCA AGATATAGCC GCGATCTCGC AGGAAGCAAA GCACACGCGT CAGGCCTGCC     58080
     ACGAAAGCAA TCGCGCGACC CTTCCACATG TCCCCGCCAC CACCAGAGTC ATCCATCAGC     58140
     GAGATGATCA GCTCGATCAA CATGCCGGAT GATCCGAGCG CGAACGGATT CATCGTGTTC     58200
     GTCGTTCGGT CGACTTGCTT ATCAAGGAAG TCGCGTCCCG ACGTCAGGAA GTTGATCAAC     58260
     AGAAGATCGC ATTCGCGGCC GAGATACCGT GCGAGCCTGA ACACGTTGTT CCAGAGTGCA     58320
     ACGTCACCCT TGCCATCGGT GTAGATGAAT CCGGAATTCT GAACGAGCGC GTTAAATACC     58380
     AGTCCGAGCA GCAGCTCGGT TTTGCCGCTA CCCGTTGTGC CAAGCACGAG CATGTGCGTT     58440
     CGAAGGTCGG AATCCGAGCT CCAGATTTCG AGTTTCGACG AGATCTCCTT CCCGAGATAC     58500
     GTGATGCCAT TGCCCAACCT CGGTACCGCA TACGATCCAT CGAACCGCTT TGCCGAGAAT     58560
     GGGACCCGGT ACGGAAAGTC ATAGATGCGA AATTTGCCGG CGATGCGGTT TGTGCCGGGT     58620
     ACTTTTCGCT TCGGATCATT GTGGCCCGGG TTGACGTAAA GCTGATAAAA GAGCCACGAA     58680
     GCCACGACAA CGAGCTCGCC CGACATCGGA ACGAACACTG TCAGTAAGGC AATGCCCTGC     58740
     AGCCAGAGCA TTGCCGCAAC GACGCCATCA GTCGTCGAGA AGTACGACCT CGCTTTCGTC     58800
     AACAGTGGCC GGGTATCCGG CCGAATCTGA GAGCTTTCGA GCTCCTCGGA GCGTTCGACT     58860
     CCGCGCTGTT TGGTTTCCGC CATCTTCGTG CGCCCTTAGT TCAACGCTTC TTCACTGACC     58920
     TGCGCGGCCT TCCGCTTCCA ATCGGCGATC AGGCGCTTTG CGGTTGTTTC GATGACGGTG     58980
     TTCTCCGCGT CCTCTTCAAT GAAGCTTGCG CCGCGCTCGT CCTTGGTACG AGCCTTCTCG     59040
     GCGTCGACAA ATTTCTTGCA GCTACCACTC GGGAACATGC CTTTGAGCAT CGCACGCGCC     59100
     TCCGGACCGG GCATTACGTC GTAAAGCATC GACCTCAGCT TTCTGTCCTC ACCAGTCGTA     59160
     GACAAGCCCC AAAGCTCAGT GCCACCACTC GATGCGGTGA AGAGCTGCGA CATCTCCCCT     59220
     CCCTTCGTCT TGATCTTCGC CAAGAACGTC GCACCGACAC CCGGCTCAGG GCCGTTTACG     59280
     TATGTTTTGA GCGCTGCCAC CTCGACCGGT GAGAGGCCGA AGATCTCGGC GATCTTCCTT     59340
     CGCGTCTGTT CGTTACCCTG ATCGAGGATG ATCACGCTGG TCGCGATCTG CGCGAGCTCA     59400
     CGGAAGTCGT CCGGCAACTG GCTCGCAAGC ATGATCTCGA GCAACCACTT GCGTGATTCT     59460
     CGACCGAAGA TCAGGAAGGC TTCGCGCAGG TTCGGGTTGT CGCCCGTCTT GTGATACTCG     59520
     TCCACGAATA GCCGCTTGAA GTCCTCCGCC AACTGATCGA CACGGGTAGC GTGATACCGA     59580
     CGATACAGGG CTGGCATATT GGGATCATCA AGGTCCTCCT TGATGATCGA GATCCGACGC     59640
     ATGATCACGT TTAGCGCAAC CATGTACATC AGCGACGCCT TCTTCTTCGC ACCATCGCTG     59700
     CCGGTCTGCA CGACATCCTG CAGGTCAATC GCCAAGATCC GCGACTCGCC GACATCAAAC     59760
     TGGGTCACAC CTCGGAAGAC CGGGAAGTCT CCGATCGCCG AGCGAATCAT GAGGTTGAAC     59820
     TCGTCAACAA CACTCACAAC ACTCGTTTGC TTCGCGTTCG CGACAAATTC AGACGCGAGC     59880
     TTCGGATCAG ACGCGGCCTC GACAATCGTG CTAAGCGTCG GCACCGCGTA CCGCTGCGCG     59940
     ACGGATGCCT CATACACCAT TCCCAACTCG AACAGCTTGT CGCTGATCTC CCACCATGTG     60000
     GTCACATCTT CGACGTACTC GATACCTGCT TCGTCAATCT TCTTCCGGAG CTCACGATTG     60060
     ATGTTCGGAA CAAACTTCGT CGGCTCGCCT CGATCGTCCT GATCGGACCG CTTGCGGAAC     60120
     GCCAGATCGA TCACTCGCCC CGCGAAGTCG TCCATGTAAT CGTGCGGCTT GCCCCGGTTT     60180
     GCCGGCGTGG CGAGCGCGAC GAGAAAGTTC TTCATCTGTT CCCGTTCGCG CGGGAGCGGG     60240
     AAGCGCATTC CCAGCTGCGT ATCGAACTGA TTGATTCCGT AGTCTTCGCG GTTCTGGAGA     60300
     CGCACATACA CTGCGAGATG CTTCAGATGC TCCGGCAAAG AGTCTTTCAC GAGCGAAATG     60360
     AAGCCAGTCG ACGAAATGCC GATGTCGATC ACGCCGATGT AAGGCAAGCG CTTCAACCCC     60420
     GGGAGCAAAC ACATCTCGAG GTTCAGCCGA TTTGCAAGCA CCGACTTCCC GTTACCCGGG     60480
     CCTCCGAACA GCAGCGTCAA CCACGTGTTC TGCTCCGACG AGAAGATCTC GTACGGAAGC     60540
     GGCTTGCCAT CAAGGGAGCG GAACAAACTG GACCCACGCG GAAACGGACT GCCGGGGCGA     60600
     GTCAGCGGCA ACATATACGC AACATCATGC AGCGGCGGTG CTGCAGCAGG TGCGACGGAT     60660
     TGAAGAGTAA CGCCGGGCGC CGCACCCACC AGCACGGCGA GCGCGTCACC ACGCTCCTCT     60720
     TGCGGCACGA CGTTGCCCCA CCCTTCGAAC GCCCGAACCA TTTTCGATCG CCGCATCATC     60780
     AGTTGCCGCT CGTCACCGTG GTCTGCCCAC GTGACCATCG TCGCCTGAAA CTTCACAACC     60840
     GACTGGTTGT TGTTTTCCCG GTAGCGCTCG AGTACGCGCG CGGATGCCGA GAGATTGCTG     60900
     TTATCAGACG ATAGCTTACC TAGCAACGTC GCGAAGATCT TGCGAAGCAT GATCGTGGAC     60960
     AAGCCGTCGC CTTCAATGTT GAAGCTGATC GACCAAGGAA CGGAACTGAT CTTTCCGTTC     61020
     TGATCCGTCG TCGTCGCCTT GTTCATCGCC CGGAATAGAT CCGCAAACGG CTTGGGCCGG     61080
     TTCGGCCCCA GCTTCATCAC GACCGGCGAG AAGACACGAT TGCCGATGCG TACCGCCCCT     61140
     GTATCGGACA AGCCACCGAC CTTCTTGCTG TTTCCGTTGA CTGCGGGCGC GTTGAACAAT     61200
     TGATCGTCCA AGCGCGGATA AAGGAGTTCG CTCGCATCGC GGAGCTTCCG GTTGTTCTTC     61260
     CAGCGCACCA TCACAGGGTC ACCAATAAGA ACGGGTTTCC ACGCGATCGG GGTCGTTCGG     61320
     AAGAAGTATC TCTTCATTTC GCAAAACGCT GCGTGAATCG GCACCACCCC GACCGAACAG     61380
     CGCAGCCTGA GCATGTCGTC GACGACCTTC TCGACAAACG ATTCGTGACG GTCGATCAAG     61440
     AAGCGATTCG GTCGAAAGAT ATCCTGCGCA CTGCGCAAAC TCGGTGTCTT GTAGCGCGTC     61500
     GCAAACTCGC GCGCTTCTTC GCGACCAATC TTGACTTCGG TCGGATCGAG CACGGTCGGG     61560
     CGGGTCCAGA GTACGAAGTA GACCTTCTCG TCCATGCACA GGCGGCGATG GACCTCTCGC     61620
     TTCTCATCCA GCACGTCCGA GATATTCATG TGAATCGTCT CAGCCGTCTC GTACATCGGC     61680
     TGCAAATAGC GCATCACTTC ATCGTCCGGG TCTTGCTCGC GCATGAACAC CACCTGCATC     61740
     TGGTGTCCCC GGCTGGAGAA GAAGTGCTCC ATGCTGTTCG CCAGCTCGTC GGCCATGCTC     61800
     TTGAATTCGC TTTGACCGAG CAGCGAGCGA AAGCCGTCGT ACCGAAGGAT CGTCCCCATC     61860
     GAACCATCAC GCGCGACGAG TGCGTTACCG TGCGTCGTCT CGAGATCGCA GTAGTCGTTG     61920
     ATGTGGAACT TCAACAGACC CATCAACGAT GATGCGACCG AATCCAGTGT TTCTGCGAAG     61980
     GCAGCGCGCA TTCCCATGTA AGGTCCCCGT TCAGGATTGA AGTTCAGACT TAAGATCTTT     62040
     CAGCGCATGC ATCTGCTGCG GCCGGTCCGT GATGAAGGCG ATGCTGTCAA GCTGCATGAG     62100
     TAAATGGCAC GAGCCGCGAC GCCGAATCGC TATCTCGACG CGTTTCAATC GCATTTGGTT     62160
     CTCAGTGGGC GCGTTCGGAT CGTCCGCGTA CTCTTCATCA CTCGTCGGCA TTGAGACGCA     62220
     GCTCCGTTTT GATTTCAGCG TAGGTTGCGG CAGGGATATC CAGCCCCTCG TGAATAGCGA     62280
     AGTCGACGAC GTCCTTCGTC GCACCGGGCG GGTAGTAAAC CGTTGCGTTG CCGATACCGT     62340
     ACGCAAATAC TTGATAGCGT TCACGCTGCA GCTTCACTGC ATGCATGAAC ATCGAGAGAC     62400
     GGTCGATTGC TCGATACCAG ACTGCACGCG GCGGAATGAA CTTCTGATTG GTCGGACTCG     62460
     TGCGAGGACT AGCCATCGAC ACCCAGAAAT TCTCAGCAAT CAGGCCGAGG GAATAGGAAG     62520
     CGAGCGAGAA GTCCCCAAAA TCTGGGAATG TCTCGATCTC CTTCTGCGGT TCGAAACCGG     62580
     CTTCGCACAC AAATGCACCA ATCACCTCGA CGTCACAGAA CTGCGCGAGC ATCATCAGCT     62640
     CGGGCTGGCA GACCCACGAC CTCGCATTCG CCGCGCCGGC GTTGTAGCTG ATCAAGTTTG     62700
     CGTACTCGCC CCGACGGGGT TTGACCGTGA CGTTTGCCAG CACCGGCAGT TCGTTCCCCA     62760
     AGCACCAGTC GATGCGGTCA GAGTTATCAG CTGGCAACCG TGCGTTCTGC ACATAGACCC     62820
     ATTGGTGTTC ACTGGGCACT GGCGTGCTCA GAACGTCCAA CGCGTGGAGA TAGCGCGGGC     62880
     GCCGCAAGAC CACCTTTTTC CACTCGCGCG GCACTCTCGT CATAACGGAC GTGTACGTCT     62940
     GGTAAGCGTG CAACAACGCA GTGTTGATCT CGTCTGGAAT CTTGTTCTTG TTGACCACTC     63000
     GAGCTGCGAT GAACTCCGCG AGACCCTTCG TCGAGATGCT GGTGGTCTTC AGGTCGACGT     63060
     TGAGCGTGCT GGTAGCAATA CGCATCACTC GGCCGAACAG CCCGGAGAGC ACTTCGGCTG     63120
     CGTTATCTGC AGACAGCTGC TCATCGCCCG CCCCGATCTC CTCTGCGATC GCCTTCAGCT     63180
     CCGTGCGAAG GAAGCCGCTG AAGTAGAAGT TTGGGTTACG CCCGAGCCCG TTCGCATTGA     63240
     AATCGGTGAA TCCGAAGTTG GTCAGCCACT TCACGTTCGA CTCGAGCTCG GAGACAGAAA     63300
     CGATGCGCCG AGATGGCGCA CCGTCGATGG AAACGGATGC GCCGCTGGCC ACGCGCTTTT     63360
     TGTTCGTCGA GGATTTTCGG ACCTCGTCGT CAAAGAGCAC AACTCCGTAT TGCATGGTCA     63420
     CTCCGGATTT GCGAGTCGCG CATTCGCCTC GTCGACGCGC TTGACACTAT CGAGCACGAG     63480
     CTCGCGGATG CTCTCTTCGG GGAGGATCTT CGTCCATCGC CAGACCGGCA AAATTTTGTT     63540
     CGCCTCGTCT CGCCAATGCT TGATCCGCTC CCCGAAGCGT TCGGGCTGCG GCAACAACCG     63600
     GAGACCGCCG AGCGCCTGAC CTCGCTTGGC AAAGGTCTCC TCGTCCAGTT GCATCAGGAC     63660
     GTTCGCGAAC AGAGACGGTG TGATCTGACT CAGAGTCGGT TCAAAATCAA GGGCGTTGTT     63720
     TTCCTTGACA TAACCACCAA TTCGCATGAG GACCGGCGCG CGCCGGTTTA CAAGGTAGCC     63780
     GCGCAACTTC GTCGCCGCGC TATGGACGCG CTCGAACAAC TGTCGCTCGC CCGCATCCTT     63840
     GAACGGGCTT GGTCCCGCCT TAACCAGCTC CTGCGTAGAA TCGATGATCC AGATGAGCAT     63900
     GACCAGCTGG TTCAGCTCGG CCTGCGACAT CTCCGGCATG TAGATGATCT GACCACCGTC     63960
     TCGGATCGCT GCAAGCCCGA GGTGAAATAC CTGATGGCAA AGGGGACATG TCCCGAACAG     64020
     ATTTTCTCGG GAATTGTTCG TGTGGTCGTC GTCCGCGTGG TGCACTTCTT GGTACTTCGA     64080
     CGACGTATGC TGACAGAACG CACATTCGTT TCCACACGCG TCCAGTATCG CGCGACGAAC     64140
     CTGCTGAAAG GCCTTGTCCG CATCTTCTCC GGCGTGGTCA TTCATCCGCC AAACTTTCCG     64200
     TTTGGCGGAG ATGACCAGTT CCGGCAACAC TCGCTTCAGC ATCAGCTTTG GTACTTCGCT     64260
     TAACCCGGCG TAGCCGAGTT GCGGATGATG CCGATGATCA CGGTCACGAT CGTCAGCGCA     64320
     GCGCCGACGA TAATGCCGAT GATTGCGACC TTCGGCGGTT CGCGGTTGTC CTTGTTAGCG     64380
     TCGTAGACCT TCTTGATGCT CGTGCCGCAA AGCACGATGC CGGCTGCGGC GAAGAACAGC     64440
     AGCACGAGAT TAACGCCGCT CTGCAGGTAA CCCTTGATCT TGTTCGCCCA CGCCGTGAAG     64500
     TCGGCGGAAC CGGCTCCGCT CGTGCCCGAG ATGTTATTGA GGTCGAACTG TTGGTCGGCC     64560
     CGTGCCACAG TCGACAGCAT CGCGACCGTC AATGCAGCCG CGACTTTGTA TTGGAGGTCC     64620
     AACGGATTCT TCAATTTAGT TCTCCTTAGC GAGTGGTAAC ACTTAAAACA AAAGCAGATT     64680
     GAGCACATCA ATGCCCGTCG CCCACGAGAT CACCTTCAAG ACCTGCGGCA AGTAGATCAA     64740
     TCCCAGCCCG GCACCGATCC AGACGAGTGG CGTCCGGGGC GATACATTTG ACGTGCCGGA     64800
     CTTGTGGGCA TTTAGCACGA CCCAACCATG ACCAAACGAC ATCACGCCCA TAATTGCAAA     64860
     CACCTTGAAA ATGCCATCAA GGGCTGCACG CTGGACCGCC GACATACCGC CTGTCTGATA     64920
     GGCCATCAGT CCTGTTGCGA CCTCTGTGCC GAAGACCGAG TTTCCGAGCA CCCCAATCGC     64980
     GACAGGCAGC GAGGTCAAGA CGGATCCGAT GAAGAGCCGC CACATCAATC CACCGTGGGT     65040
     ACGATGCTGG TACCCACCAT GGCCGTAGTT GCCATACGCG GTGAGGTCGT AGAAGCCCTT     65100
     TACAGCCGTC CCGACCATAA TCACACCGGC CACCGCGAAG AACGCGAGAA CCAACGCCAA     65160
     AAGCGCCGGT GCCGCACCCG CCACCAGAGT CAGAAGGTTG AGGAGACCGG TGCTTGACGT     65220
     GCTGTCCATA TCGACAGGCT CTCCGCGACG TTACTCGTCA CCGCCGGCAT TGCCGGTCGA     65280
     GATGTACTGA TTGCCTGACA GCCAGACACG CTTGGTCTTC GGATCGACGG AAAGAACCTT     65340
     TCGTCCATCG TCGAGGGTGT CGCCGACGGC TACCGTGCTA TCCGGGTTCA CGTCGTTGCC     65400
     GCCCTTCTTC GTAATGAATG CTCGCGTCCC GATCATCCCG GTGACGACGT ACGACGTATC     65460
     TGGCTTACCC TTATCTCCGG AGCTCGCGGT CTTTTTCGCA TGCGGTTTCG CGCGCGTCAC     65520
     CTTCTCGCGA TGCGTCACAG TCGCAGTCGT CGCTTCGCCA TCGCCCTGCT CTGCGTCCTC     65580
     GCCAGTTGCG GCCTGCACTG GAGCAGCTTT CTGCGCCTCC TTCTTTACGT GAACGGCGCT     65640
     CTTCACAACA GGCCGTGCGC CTCTGCCCGC CAGCTGCTTT TGCAGCTCGG CGATAGTCGC     65700
     TTGCATCGCA GCTAGTTGCG TCGCAACGTC GGCGCTTGCC GCCTGCGGCG CATGATCGAC     65760
     AGCGGCCGTG TTCGCTGCGG CTTGTTGCCC GCTAGCACCG CCCGTTTGTG CCGGCTGCGC     65820
     TGCATCAGAA GGGCCAGCCC GATGCGGCAC CGGTCCGATG GGATTTGCTT CGTTTCCCGC     65880
     CTGTTGCTGC GTGCTTGCGA ACTGGCTCCC AACAGGAGCG TTCGGGACCG TGGCCGCGAT     65940
     TTGCTGCCCT TGGGGCGGCA TGGACGAAGC TGCTTGTTGC GCATACTGAC CTTGAGGCAG     66000
     CGGTGCTTGC CCTTGCGGGG TCAGCGTCCC CGGCGAATTC TCTTGCGCCC AAACTCCGCT     66060
     CATACAGAAG GCGCGGCCGG TAGCCGCCTG CGCAATTAGG CCATTCGGCG CGCACGGCGC     66120
     ACCGATCTGA GCAAGCGGAG GCGGAACGCT CGCCCCTGCC CCCATTTGCG GTTGGGGAAC     66180
     GCTTCCGAAC TGATCCTGCG ACTGCTTCGG CTGCTGCAGC ACTTTGGCGA GACCGACAGC     66240
     TCCGACTACG AGAACAACAG AGACGGCGCC GATACCGCCC ATCAACTTCA TGAGCGGGAA     66300
     AGGCTTATGC GGTTTCGCGG GACCGCCTCC GGTCGGCTGA GCACGCGCGA GGTCCTCGGG     66360
     ATCGCGCTCG TCGTCGTGGT CACTATCTTC CGAGAACCGG ATCGTATCGA TCGCGTCGTT     66420
     CATGTTGCTC TCCAAGATTT CATTGCGAAA TTATACCGCT ATGATACAAA AACATTATTG     66480
     TTTTTGATTC ACTACATCAC TCAGAAGCAC AATTCCGATG TCTTTGCCCG GGTAGATCTT     66540
     GATTGTCGTC TTCAATGCAT CCGAACGGCG CTGCACGAAG TCGCCGATTG ACTGCCCAAC     66600
     GCCACCGGCA GCGCTCTCCG CGATCTGCGC GAGGTCTGGC CGCTGAACGC TGAGCGACGT     66660
     TGTGCTGACG TTCCCGATCG TTTGGGTGCT GGACGTACCA GTGACGAGCT GTGCTGCCTG     66720
     ACCAACTCCC TTCAGTAGGC CCGCGATCGC AAGTTCGCTA AATTTCACGA AAGCATGGCT     66780
     GTTCACACTG TCCTGCACCC CGGCCTCGAG CGTGTCATTC GTGAACGCGA CCGCCTGAAC     66840
     GGGCAACGTT CCGTAACCCG GAACACGCGC CGAACTAAGA GTCACGACGA ATCCCGGGTC     66900
     GGCCACCCCT TCCGGAGACG GCTCCGCCTT GCCGTTGAAA ATCGCACCAT CCCACGGACC     66960
     ACCGAAGCAT TTCGCAAAAA CGTCCTTGCG CTGCAGATCG GAATTCACCG CGTACTGAAT     67020
     CCGGCAATAG CCTGCATCGC CCATCTCCCA GTTTGGGATC GTGCGCCGTT GCGACTGATT     67080
     TGCCGCCGTA GTTGCCGTTG GTTGGGGCTG AGCCCCGGGG AATATCGACT GCGGTGCCGA     67140
     GCCCTGTTGG GCCGGCACCT GACCAGAGAC CTGCTGCGCA ACCACCGGGT AGTACCCGGT     67200
     CGTGAATGAG CGGCGACCAG ATCCGCCCTG CTGGCCTTGC TGATTGTTTC TCGGCTGCAC     67260
     GCCAAGGACA TGATCGATCT GCGAGGTCAC GTCGCCGTCA GATGCACCCA AGGCCATCGC     67320
     GATGGTTCGA ACGTCGTTGA GTGGCCGAGG CGCATTTGCT GCATTCGATC CGTTGTTCGA     67380
     CGTCGCATTG GCATTCAGGT TCGCGCTGTT AGGATCCGGC TGCTTCGCAG CGGGCTGACT     67440
     GGCGGTGACC GGCTCGCCAG CACCGAAGCC GCCCCAATCT CCGCCGCCGA CAGTCTGCGT     67500
     CGAACTCGCT GCAAGAACCG GCGTCGCGAT ATACGGCTGC TTGTTCGCTT GCGCTTCGGA     67560
     TGCCCCCTCT TGATTCGCTT GACGACGCAG TGCTGCTTCT CGCGCAGTTG TCACCATCGG     67620
     GTCGCCCTGC ATCCCGTTCG CATTGGGGAC CGCGCCCATC GGGGCAGCTG CCTGCGGCGC     67680
     GCTCGGCCCA CCACCCATCA GCGTGCAAGA GCCCACGATC GCCAGAACAA CGAACGTGCC     67740
     ACCGACTGCC ATGGCAGCGA TTCGCCCTTT GCCCTGTCCA AACACCTGAT TGATATTGTT     67800
     GCGCTTCAGA TCACGCGTCG CCGCCTCGGC TTGTCGCTGC TTTGCGGGAT CGAATACGGT     67860
     GCTGTTGTCC GTTGCCATAT CGTGTGCCTC AGTTGCCGCT GACGAGAAGC GATGTGGGTA     67920
     CGCCGTTGAC GCTGGCGAGC AAGCTCGGCA CGAAGCGGGG GTACTTGTAG ACGGAGATGC     67980
     CCTCTGCCGA TCCGACACGG TCGGTGAACG CGGGCGAGAG AAGCGAAAGG CGCGTTCGCA     68040
     CGTAGAGGGA ACCGTTAAGC ATCCACGCTT CGGCTTGTCC GCCTGCGACC TTCATCTGCG     68100
     AAGCACCCTG CGGAGGTACC CCGCTGAGGA AACCGTCCAT CCGGTCGTCA AACGCCGGGA     68160
     GTGACGTGGA CGAGATCAGT TGCGGCGGTG CCGAAGGATT GCGCGCCTCG ACACGAACGT     68220
     CGATCGCCAT ATCCGTCTTC GCGGATTTCC CTGTGCGCAA AACGAAGATG ATGGGCGTCG     68280
     GCAATCCATC GAGACGAATT ACGACATTGC CGTACGAGTA CGGACTGTTC GCTTGCAGAG     68340
     AGACCATGTT CGTCGCGTCG GTTGCGCCCG CTTTTCCCTG TGCGCTCGTG CCACCATCGC     68400
     AAGAGCGCCC GTCATCGAAG AGGGTGCAAT CGAAGGAGAC CGACTTGATG TTCCACGCGT     68460
     TCCCCGACAT GTCGGTGAAA ACGAATGTCG ACAGCGTTCC CTGCCACATT TCGATCGTCT     68520
     CGGGCCGCTT GACTACGTCC GGACGCCATG GAATCTGGCG CGATCGCGGC TCGGCAATCA     68580
     TTCCGCCGGG GTACGGAGAT ACTCCCGCAC GCCGAGCTGC ATCCACGGTA CGTCGAACCG     68640
     AATCGATTTG CTTCGGCGTG AGCACACGCG CGTTGCGATC GTCGACAAGG CGCTGGATCA     68700
     CGTCCTTTGT CACGGGGATC GGTGGTGTTG CGTCGTCCAT GTTCGGCGCA ATGACCGCCG     68760
     GCGCCTTGGG ATCAGCCGCC GGTTGCTGCG CTTGAACAGT CGTACCCTGC CCTGCAGCGA     68820
     GGGAGCCGGA AGATTGACCA GCGGCCACCG CTATCAGGGC AAGCGAAGCG AGAAAGAGTT     68880
     TTTTCTTCAT CTCGTGTCCT TAGTTGACCG CCGTCTTCAA GTCGATCCAG CTGACGCCAA     68940
     TGGCGCTCGG GTTGAGTCGG ATCTTGGTCG GATCGGTTCG AGTTACCGTC ACTTCGGCGA     69000
     CGACGCGATC GTCGTGTTGT TGGCGCCCAC TCGTGTAATA GAACGTGAGA GGCACCTGCA     69060
     CCTTCCACGC GTACGCACCG TTAAGCACGC CCTCGCGTAC AACCTGCGGT GGCTGGTTGG     69120
     GCGTCGTGAT TGCGGTGACG GTGAACTGAT TGCTGACGAG CGCCTTCAAG AAATCTGAAT     69180
     TGCTGATCGT TTGCATGAAC GGGCTGCGGA ATTCCGGCAC CATGAACTTG TCCGCCGCGT     69240
     TGGTGATCGT TCTCTTATAG TTGGCGTAGT CGGTCGAGTA GATCGTTACC ACCGCATCTT     69300
     TGGCGTAGTC GACGATCTGC GCTGCATTGA CGTTGGGCTT GTCGATCGGC TCGAATACGC     69360
     AGATCGCGGC CGCGTTCTGC GTCGGAACAT ATTTCTGCAG CGGGTAGTAG AAGAACGTCA     69420
     GCCACAGCAG AAATGCGATC GCCACGGACT CTCCCACGAT GATCGCGAGG TAGTTGATCG     69480
     AGTGCTTCGA TTCGCTTTTC TTCGCCTCCT CACGCAACCG TGCATTCTCG ATAACGAGGT     69540
     CTACCACCTG CGTGCCACCT TGGCCCGGTG CGCTGGCCTG CTTTTGAGTC GTCGTCTGAG     69600
     CTGTCATTTT CGGTGTGCCG CCACAAGCGG TATTTCGCAC GAGTACATCG AACCGTCAGA     69660
     CGCGAACAGG CGCGCAAACT GCGTGCCGAA TGCGAGTGTC AGGATCAACG CCACAATAAT     69720
     TAGGAATTCG AATAACGCGA TTGGACCCAA CCACTTGTTC AGGCGCCGCA ATAGGCCGAG     69780
     CATCTGCTGA TTGAAGCGTG GCGTGCGATT TTGGCGCGGG TTTCCCCACG TGGTCGGTTG     69840
     AATTGGCGCG CGCCGCGCGC TGACTTGACG ATCGTCGCTC ATACCTTGGG CAACAGCTCT     69900
     CGAAAGCTCT TTCGGACAAT CGTCACTTGA TTCGCCAGCG GGACTTGATA AGAGCGCAAT     69960
     GCCTCGGCGT CTCCGAGGAT CGTTTGACTC ACCTCGTCCT TCCATTCCGA GTGGGAGATT     70020
     GCAACGAAGC GATCGCGGCC GATGTGAATC ATCACCGTGT AAATGACCTG TTCGATCCAG     70080
     CGATCCGCAA CGGCTTGCTC GGTCGGCGGA CACGCCATGA ACAGCTTTGC GCGCTCCGCC     70140
     AGCTGATCGA ATGACAGTCC GAGCGCAGCG AGGGTCGCTT CCGCGACAAG GGTGCGCGTT     70200
     TCGACAGGCG TCGGACAATG CTCGAATGTG TTGACGATCC GCCTTGAGGC GATCTCGGCA     70260
     ACCTTCGACC GAACTTCTTC CGGTACGCGC GCGAACAAAG CGGTGAGGTA CAGCGATGCC     70320
     GGCAACGTCG GCAACGAATG TTCCGAGTCA GCCTGATAGA GCGCCTGCAC CTGCTCCAAG     70380
     AAGCGGTGCT TGAAGTACGC CTTTTTCTCC AGAACACGAA GTACGGTGTG CGCTCCGGCG     70440
     CCCATGCGCT CGACTGCACC CCTCTCGCTG CCAGACATCT CGACCCTCCA AATTTGTCGG     70500
     TATTGTCTTG GTAGAAACGC AAAGAGTCAA TCTTTTGAGA ATCTAAAATA TATGTTTTTG     70560
     CATCCATTTG AGCAGCAAGT CTGTATCTTT TCCACCTTTC CGACTTCGGC ACGTCGGTGT     70620
     GGAACCGCTA GGGCAGCGCC CTTGGTACGC CTGCCGGGGT TGCTTTTCAG ATCTTGCAAG     70680
     ACCCACGAAC ACGCCTCACT AAAAACTCTG TGTAAACTTT CTAAAATCTT TTTAAATACT     70740
     TATGCCGGCG ACGCTCTGGG CAGGAATCCC CTTCTAAATC AACGCGGTTA GGCTCATTTC     70800
     AGGCCGCTTG TTTACCGAGT TCGGCACGCA TCCTTTCCGA GATCGGCACG CTCGTTTACC     70860
     GGGTTCAGCA CGCGCCTTTT CCGAGATCGA CACGTTCGCC GACCGAGTTC AGCACGCCCA     70920
     CCTTCCGAGT TGAGCACGCC TGTTTACCGG GTCGAGCACG CGCGCGTTCC GAGTTCAGCA     70980
     CGCGCATGCT CCGCGCTTGC GATCAGCCGT TTCCGACTTC AGCACGTAGG GCGGCTGCCC     71040
     TTAGATGTAC AACGGGGATC GTTGCGCAAT GCTTTCCGAG TTCGGCACGT CGGCCAGTTC     71100
     TGAGTGGCAT GGTCGTCGCC GTATTTCTTT CCGAGTTCGG CACGCTCGTC TCGTGAGTCG     71160
     CCGCATTTGC GCCAGTTCTG AATGCGTGCG GGACCGAATG GAATGAAGCG ATGCGGAGCA     71220
     GCCCGACGAT TGCGAGTTCG CAGTTTCGAC GTTGGCTGAC CACGCTACCT GAGGGGATTG     71280
     GATGCCGTTC ACCGGCCCAG ATGACGTTAC GGGGCCCGAC CGGGCGCCCT AGTCAAAACT     71340
     CTGTGGCACA GAATTTCTTC AGAGTTTACT TGAAGTATAC GAGTTAACCG AATATTCTGC     71400
     GGGTTAGTCA GAAATTTCGG GGTAACCTAG AAATTTCGAG CTTACCTTTA ACTCTCGATC     71460
     GAACTTGGAA AAGGCCGTGA CAGCCAACGA CTTGCTCACT TCGACCGCAC CGGCGATTGA     71520
     CCCGTCCGTG TCCATTGCGG ACATACGCGA CGGCATCGCT CCGCATGCGC TGGACTTCCT     71580
     TGATCTGGTT CGATCGACCT TGCTCGAGCC GTATCCACGT AAGCTTCCGC CGACCTACAC     71640
     GGCAGCCAAC ATCGCTACGT TGTGTGGGAT CGACAAGAAG CGCATGCCCT ACCTCACAAC     71700
     TAAGCTAGCG CTGCCTACCG GTACACAAAC CGGGGCTGGC CGCGCAAAGA TTTTCACACT     71760
     CGAGGAGGCT ATCGTTTGGG TTCAGGCTAC CTCGAATCGG GTGCAGCGGC GAGCGGGATC     71820
     GCGAGGGCGC GTTGTGGCTT TCGCTAATTA TAAGGGCGGC GTCGCAAAGA CGACCACCTC     71880
     GATAAGCATC GCACAAAAGC TCACGCTGAT GGGCCGCAAG GTACTGCTCA TCGACTGCGA     71940
     CCCTCAGGGG TCTGCGACTC AGCTGTGTGG CTACGCCCCT GACGCAGAAA TCGGCTACAA     72000
     CGACACGATT CTTCCTCTGA TCGACGGCGA AGAGTCCACG TTGCATTACG CGGTTCACGA     72060
     CACGTACTGG AAGAACCTGC ACCTTATTCC GAGTTGCAAC GCTGTTCAAG AAGCTGAATT     72120
     CGGCGTGCCC GCCCAACTAT TGACGAACAG CCGGTTCGAA TTTTGGGACA TCTTGAACAA     72180
     AGGAATTCGG CCTTTGCTCG ACGACTTCGA TGTGGTGGTT ATCGATACAC CGCCTGCCCT     72240
     CAGCTACATC ACGACAAATG TTCTCATGGC CGCTGATGCC ATTGTGATGC CGCTTCCTCC     72300
     AGAGGCTCTA GACTTCGCCA GCTCGACGCA GTTCTGGCAA ATGTTCGCAG AAATTGCGGC     72360
     TCGGCTTCCG AAGGTGATGG AATCGAAGCG CTATGACTTT ATCAATATCT TCATGACCAA     72420
     AGTTCGTTCC ACAGAGGCAT CGAAAGGCGT GCAAGGGTGG ATTCGAAAAG CGTACGGCGA     72480
     TCTGGTGTTC CCCCACTTTG TTCCGGAATC AAAGGTTCAA GCCGCAGCCC TCGGTGCTCT     72540
     TTCTACGATC TACGACCAGC GTCGGATTGA CGTTGATTCT GACGGCGACG CACCTCGCAT     72600
     GTCCGGCGAG CAGTACGAGC GACTGCGGGA ACCGCATGAC GCGCTTGCCG AGCATATCGA     72660
     CAATCAGTTT TCACAAATTT GGGCGAGGGA GGCTGCTGAA TGACCAAGAA AGGATCACTT     72720
     TTGGATCGAA CAGCTCAGCT GGAGGTTGGA GACCGGCCTG AGCGGCCTGC AGGTGGTGCG     72780
     CGCGGCCCCC TTTCGGCGCC GGGACGCATG TTCGATCTCA CCCAGCGGAT TAACGATGCA     72840
     GAGGATCGCG CTACTGCTGC TGTAGCCGAA GCCGAGACGG CCAAGCAACA GCTGGAAGAA     72900
     GCCCGCCGAA CAATCGAGGC GCTTGAGCGC AATGGCTCCG CAGCGGGTGC GATGGAGATC     72960
     GATATATCGA CTCTCGTCGA GGTACCCGGG CGACGTCGCG TTCTGTCGCC AGCGGAATAC     73020
     AACGAGCTGC GCGACAACCT CGCAAAGAAC CCGCTTGTGC ACCCGATCGT TTATCGGTCA     73080
     CTTGGCAACG GCAAAAACGA GATCATCTCC GGCGGCAACC GTGTTGCTAT CTACCGCGAC     73140
     GATCTGGGTC GAACGAAAAT TCTTGGCGTC CCGTTCACAG GCGACGCCAA GGCGGCGGAA     73200
     ATGGGCGCGA CGTTTGCGAA CTTGCTCGCC CCGTCCCTGC CCGACTTCGA GAAATTTCGC     73260
     CAGTTCGAAC GCCTTCAGCA CGAATCCGGG TTTACCCGCT CGGACATCAT CGAAGCATCC     73320
     GGCCTGACTA AACAGCACGT CGCTCGGATT CTCTCTTTCG AGAAACTACC GCAAGCAGCT     73380
     CGCGACGCAA TCTCGAAGCG GCCGGACAGA GTCGGCGGAC ACGCGGCGGA GGATTTCGCC     73440
     CAACTGGCAG CGAACGGTAA CGCTGAGGCT GTCGTCAAGG CGATCGAGGC GCTGGTAGCC     73500
     GACGAGTCGT TAACGCAGAA GCGCGCGCTT GAACTTGCAA AGCCGAAGGC TGCGCCGAAG     73560
     ACACCTCAAG TAGCGGCGCG CACGATTTCG ATCGGTCGCA AGAAGTTTTG CGACGTGTCC     73620
     GTCCGTAGCG GAACCGTGGG TTTGCGGTTT GCAGGAAAGG GCGCTGACGC CGATGCAAAC     73680
     GCGCAGACGT GGGCTGACAA GATTGAGGCG TTCATTCGCC GCGAACTCGA AGCGCAGGGT     73740
     GGTGAATGAA GTCGCCAATG GTGACTTCAA CGAAATCAGG CACTTACCGT TCCACAAGCC     73800
     GCAAGATCGA AGAGTCGCCA ATGGCGACTC TTTTAAAATC AACGATTTAC GAATTCAGGT     73860
     AGAGGCGATG GCGTAACGAT AACGACGCAT GAAAGACAAA GGCCCTCGGC GGGAACCGGG     73920
     GGCCTTTGAA AAATGGGCTC GACTGGAATC GCGCCCGCTG CACTCCCCGG CTGGAACCGG     73980
     AAGAGCTTCG ACATCTCGGA GTGTAGCGGA AAGCGAATGA CAGTCAAGCA TTGACCATCC     74040
     ATTTTCGACG AAATGGACGC TCGACATGTC TATCGCGCAA CACTCAGTTG CTGGCGAGGG     74100
     TGAAGCACAT CCCCTCGACA GTGAATCGAA CGCACTCAAC GCTCAACTCG AAGAACTCGA     74160
     GCTGGGCCGC AACCTCCCCT ACGCCACTCT TCGCGCGCAT CAACGCGCCC TCAACCTCAC     74220
     GACGCTCTCG AAGCGTGCTC GCGCGGCACT TGCCTCGATC GCGCTCGTTG TCGACGCCCG     74280
     GAAGCCGCTC AATTCCGTCT TCGCGCGCCG TAGCTACTTG TCTCGCCGCG CGGGCCTGTC     74340
     GGAGCGTACT TGGTACCGTG CCGAGCAGGA TCTCGTCGAC GCCGGCCTCG TGACCGTATC     74400
     CGAACAGATC CGCAAGCCTC GCGGGGGCCT TTTTGGCGCC GCGTACATCC ATCTCTCCGA     74460
     ACAAGCGGCC CGGGCACTCG GCCTCATCGC CACGAAGAAG CCAGCAATCG AAGCGCCTGC     74520
     TGCACAAGCC GATGCAACCG CTGGCACCGA AGACAGCTCT TTGCCGGCCC AACCGACTGC     74580
     CAAAGTGTCA GACCGGTTTA CATATAAGGA TTATCAGTAC CCTCCTACTC AAAGGAGACA     74640
     ACCGGGCCAG CTGCCTGAGG ATGTTCAGCC GCTGTTGGCC GTGGGTTTTC GGAAATACTT     74700
     CATTTTTTGG CTGATGGGCA TTGCTCGTCG CAACCACGGC AAGCAGCTGG GCCATGTGGT     74760
     CACTGCCTGC TGGGAAACGA TCAAGAAGGC CCGCAATCCG ATCGCCTACG TCTTCGCATT     74820
     GCTCCGAAGC GCAACCGATT TCGCTTGGCT TGCCAAGCAA CGCCACGCAG CCAAAATTGA     74880
     GGCGCAAGAC GTTGCAGAAC GGCATGCTGC CGCCGAAGCC GAGCGCGAGC GCATCGCTGG     74940
     CAAGCGGTTC GTGGCCGTCG ACGGTTCTAA GCGTTTTGAG GTGTCGGCCG ACGGCAGCTC     75000
     GCTCACGGTC GAATGCGTCG TCGAACATGC TGTCCGGACA GCGGGCGGTT ACTGGATCGA     75060
     TGACTTCGTC GTCGCCCTAC ACGCCGGCAA GATTCGCCTT GCGGTATCGG CCGACCATGC     75120
     AGCCTTCGAG AAGGCTCGCG ACGCGAACCT GCAAGCCCAA CTGATCGAGC AGATGCGTCA     75180
     AGCCCAACTC GCGCGGGACG CAGCGGCTGC CATCACGGGC GCTGTCTCCG CTGTCAGGCG     75240
     CCAGTCTGCG GATCTACCGC CGACCGAGTG TTCGTGGAAA CTGTCGGGCC TCGGACACAC     75300
     CACGCTGGGT GGCTTACGCA CTCTGCTGGC CAAAGCGCCT CGGAGCGTGG CAGCGTGAGC     75360
     GCGCTCCGCA AAGAATTGCC CATGACGCAA ACCATCGCAA CACGTTGCGG TCGCCTTATT     75420
     CGGTTGCGTA AGGCGCAAAA TTTCGCAAAT ATTTACGCTA AAAAAACCGC CCAGAGACTG     75480
     GGCGGTAAGG GGTACGCCTC GCTGTTTGGG CAGCGCTGCG CTAGCAAACT AACGACGTGG     75540
     GCGACGGCCA GTGAAGGCGC GGACGCGACC CACGTCAACG TGGGTGAAGC TGTTGTAGAT     75600
     CCCGACTCCG CCCATTTCGA AGAATCGCGC CATGGAAACA ACCGCGCCCG GCTGCACGCC     75660
     CGGGATTTTG ATATCGGCCG CGCGGCCGTT CAGGTGCTCG CTTGTCGGCG ATGCACCTTC     75720
     CGCGATGAGC ATCGAATTGT GCTCCGGGGT TCGGTAACCG CTTGTGAGAT CGATCGGCAG     75780
     CAAGCGGCCC GTTTCGAGCT GCACCCATCG CTGCAAGCCG AACAGCAGGT GGAACAGCCG     75840
     TGGATCGATC TCAGCGACGA CATCCTCGTT CGAGTCTCGG AAGAGATAGC AGAGGCGGAC     75900
     ATAGTTGTTG GCATCGAAGC GACCGCCTGA CCAGTACACA ACTCGAAACT CCTCGAGCTC     75960
     GCGTCGCGGG CGCGCCCGGC GAACCCAGAG CTCGCGATCG CGAACCCAGA AGTCGTTATC     76020
     GGTCGCGTGT CCGATCTGGG GAATAAGCAA CGACGCTCCA AGCGCACCGG CGCCCCCGAG     76080
     GAATTTACGG CGATCAATCA AGCCGAGGGT CCTGCAAGAA CACGGACGGG CGAAGCATCC     76140
     GGGTTGCGAT TGATCACGAC CTTGTCGGTA CTCTCGTCCA GCTTGTACGA CCGGATGATG     76200
     TTCATCTCTT TCAGATTGTC GAGCCCTGCC GGCAAATTCT TGCGCCGGAA GTCCGACAGT     76260
     TTCTTGCTCA TCGCGATGCG GACCTGCGCG TCGGTTTTCC CCGGATTCGT CTCGCGATAG     76320
     TGCCGCTCGA GCGAATCGAG CGTCCCGTAA CAGAGCTCGA AAAGGCTAGT GATCTTGATC     76380
     GGCCGTGTGT CCTCATACGC CGACGGAATC GTCGAAATGT ACTTAAGAAG CTGCCGTGCG     76440
     ACGCCCGACG TCTTGAACAA GTGATCGGTG TCCAAGGCGG TGAAGCTCGA GTACAAAATG     76500
     ATCAGTGCGG GATCGATCTG TACGTGGTGA TTGGAGCCGG ATCCGGCGAG ATCCTTGATC     76560
     AGGTTCACCG TGATGTAGTT CGAGCGCGAT TTCACGACCA GATAGCCACC GCGCATGCGC     76620
     GCCAAGGATT CCATGACGCT GTCGATATCC TTGGAGCTCG CGCGCCTCGT AACGCCTCGC     76680
     GAACCCTTGA AAAACGGCAC ACTGAAGATG CTGAACCATT CGTAGGGATA CTTACCGCGC     76740
     GCAACTTGCA TCAGCTGCAT GAGTACGAGC TCGTCGTCGT GCCGCAGTTC TTCACCACGA     76800
     TAAACGGCGC TGACCGTCTC GCCGATCCGC CCCAGCGGCT CATCGCGACA GAAGCGTCGC     76860
     GCCGTGTTAT TGCTCGCGAC ATGAAAGAGC GACGTCTTAT TCAGATCTGT CGCCATTATT     76920
     CGGACCGTAT CCGAATGAAA CGGAAAACGA TACTGGCGCT GATGGATCGT CTCCATCGCC     76980
     GCGCGGCGTG ATTCGCTGAC GGCACCGAAC TCGATGAATC TCGGGGACGC TGCCCGAAGG     77040
     ATCGAAACGT CAGGGTGCTC GTCAGCGAGT TTGATTTTCC CGCTGGTAAT CGCCTCGACG     77100
     ACCGACTCTT CGTGCCCGAG CCCCAACTCG CCGCGATCCA GTTCGCGGAT TGCGTTGGCT     77160
     GGCGCCCCAT TGAGATGGAG CACGCGTTGG TCGATCTCGA CCTCGATACG CGGCATCCTT     77220
     GGCCGCGTAT CCGTGACGGG TTTCGGGGCA GGGGAGACCA CGGCTGGTTG AACGTCGACA     77280
     GCATTGGCCG TCTCTTTGCG CCCGCCCTTT CTTGCAGCCC GGGGATTCTC CATCAGGAGA     77340
     CGAACGACGG CGTGCTTCAC GTGCTCCCAT GCCTCCTCCA CGGAACAATT GAGATCGTTC     77400
     GCGGTTTGCT GGATCAAGGG TGTGTGCTCG CTCTTGTCGA TCGGCACTTG TGCGCCGTTC     77460
     ACCAGAACGT AGTCGGAAGC GTCGGTCATA AAAGCCCGGA AAAGGGATGC AGGGCACGTA     77520
     ACGGCTTGCT ATTATACAGA AAAGGTAAAA AAACGTATAT TTTTTTGATA CATTCACGGG     77580
     TGTACAACCT GAGAAGGGGA ACGGAATGGA CGAAAAGCGA CCGCTCTCGC GGCGGCAGCT     77640
     GCGGAACATC CAGCTCGCGC GAGGGATACC TGCACTGGAA TTTCAGCATC GGACCGGCAT     77700
     GCCGCGCGCG TCCTACGAGG CGCTACTGGG TGCGAGCTCG GGCGAGGAAG GGAAGGACGC     77760
     GGCAAAGCTG ATCTCCCGGC AGACCTTCGA TCGGGTGGTC TCGTTGCTGG GCATCGACGA     77820
     GGAATTCACC TCGTTGAGGA GGAAGGGGGT CATCGAATGG CGGGCCGAAG GCACTAGTAA     77880
     GGTGACTGCG GCGTCGTGGC GAGAGGCCGT TGAATCCCTC GTATCCGAGT TGTTTTCCGA     77940
     TGACCTGCTG CTCGTCGAAG TGCGAACGGA GGGAGCGAAG CGCTTCGGCC GGGGATCCGA     78000
     GCGGATGGTC TTGTTGCACG ACCGCGTCAA CGAGTTCCGG ATCGCAATCA TGAACGCGGC     78060
     CGACGATCTC GTCGGCCTGC TCGAGAAAGC GTTCGGAACG ACCTGCGAGC GCCGGGTAAC     78120
     GATCTCGGCG CCTGAATTCC ACGATGCACG CGAAATGATC AGTCACGAGG TATTCCGTTC     78180
     AGTCCAGTTC GATGCGATTT CCGGCGCGAT CGCTCCGAAG TACAGCTGGC GTGACGTGCA     78240
     GGCCGGGGCA CGAGAGTTCG GCTTTCTGCC GGACGACCTG ATCGAGATGA TGCACCAGCG     78300
     CGCGCAAGAA CGCGCGCAAC GGGGATCGGT CGGTCCGGCG TCCGGCGGCG AAGAGGAATA     78360
     CGCAGTACGG CGGCTGCAGC TGGTGACGAC CGCGTAACCG CCAGCCGGCA TCGCTTCAGA     78420
     AGCCCGTCTT CGGACGGGCT TTTTGTTTTC GTGCGTCGTT TTGCATGGAA CCGCGACAAG     78480
     CCTTCCATAC GTACCACCGC GCGGATAAAA TAAACCTATA GGTTTATTTA TGGAGGTCTT     78540
     GTGACCCGAC AATTCTCGGC TGATGAGATG CGCGCAGTCA TTCGTGCAAA AGGCTGGAGC     78600
     CATACGGAGC TTGCGCGACA CTGGGACATC TCGACTGTTT ACCTTAGCCG GTTGATCAAC     78660
     AACGATCAGC GTCGGATCCA CTGGAATGAT GCCGTTGAGG GATTGCCGCC GTACAAGCTC     78720
     TGTGCTCAGC ACCTCGCCAT GCGGCACGCA CGAGCCGCCG CGCTCCTTGA TGAGCCTCAA     78780
     CCGCGCAAGC GCGGGCCTCG GCCGGGTTCA GTGCGCAGCA GTGGATATGA CGACGGGGAA     78840
     GAACGCTGGC CTGAAGCGGG GCAGACGACG GTGCCGTCAA CCGGATACCG ATATCGCGGC     78900
     TATATCGTTG CCGGCAGCAT CCTGACAGCA ACGCAAGAAA TTGGCGAGAT GGCGCAGGAG     78960
     GGCGAACGAG GCATCGTATT CGCTGTCGAG GATGTCGGGA TCGGCGAGCG GTACGGAGTC     79020
     ATCTTCGAGC GAGGCCTGTG GGATTGGTTT CTCGCGCACC ACGTTGACGC TTGCCTCGCC     79080
     GAGACCGGGT TGGATGCCGA GGGGTTTGAT GGATTCGTGT ACGACGGTGA TTTCGGTCTC     79140
     AAGAACGCAT ATGATTCCGG TCGCTTCAAT TTTTGGTGAA CTCGGAATAA TTTTGCAAAT     79200
     ATTTGCCGAG GCAGCTTCAA ATTGTCACGA TGTGCGGCCG CGCGGCGTCT AGCGCTCGTC     79260
     GTCGAGAATA TCGAGCCCTC GAACAGGAAC AAAGCTCGGG CCGCCTGCTC GACTGCGCTC     79320
     GAGCGGTTCA AACGCGAAAA TGTCGATTCG CGTCTCCACA TTCACATCGC CGCGCTCGTC     79380
     GAAGTCGCTG CGATCGACGG TCACCCAAAC GTCTCCTCGC GCGATTTCCT GCGCAGTTAC     79440
     GAGCCCTGCT GCTCGAGCGA CCTCGATAAA GCGAGCGGCC GTTGTCGCAC ATCTCATTCG     79500
     AACCGCATCC AGCGACTCAT GATCGTCGCC ATCGATCCAG ACCGCTTCGG TCGGCACCTC     79560
     GTCGACGCTG AAGCCGGTGC TGGCGCACCG GTAGGTGAGT GGGTTCATGA TCTCGCTTCT     79620
     CCTAGTGGTT TTGCACGACA CCGAAGCTGT CGCTGTACGT GATGGCTATG CTGGCCGTTA     79680
     CCCGGGCCCA AATTCCAACT GCGATCCCGA GACTGTCTTT TTCCGAGTTC GGCACGTCGT     79740
     CTATTCCGGT AGACGAAGCG CGCCCGTGAG GCGGGCGATG AAATGTTGCT TCGCAATCAG     79800
     GGTGGACGCA TGTATGCCTC AGGCGCAGGG CAGTGCGCGG CGCGCCGTGT ACTGCGCGAA     79860
     CGATCACGTT ACCGCTGCGC TGCCGTGCGG CGCACCGTCG GGCGTAGCCC GTCAATCGAT     79920
     ACCGAGCCTG CGCTCTACTC GATCCCAAAA ATCGGGAATG CCGGTCGCGA ACTTTGCTGC     79980
     CCACGGGTTT CGCCGTTCAA TGATTTCGAT CATGCGAGCA CGATCCCGAT TGAAGCCCTT     80040
     CACCCATGCG ACCAGTTCGT CACGCGTCGA GCGTTGGTCG AGCGGCGCCA CCGCCATCTG     80100
     CGCATCCAAC TCCTGCCTCA ATGCGTCGAC AGCGCATTGG ACCGCGCCAT CCCGAATAGT     80160
     CTTCGGATCC AGTTCATCCA TGTCAGTGCG AGCTCGGTGA GTGGGTGATG TTTGCGCCAC     80220
     GTCGTGCGAC GAAGTCGCGA TAGGTTTCGA GATACCGATT CTGAACTGCA GCGACCGACG     80280
     ACTCCGTCGG GTAGACCCGC ACCATGGCGC GGCCGTTGCG CCGCTTGCCG TAGTGCTGGT     80340
     GCGCAGTCTT CGTACTGGAG TGACCACTCA AGGCTGCTGT GATGACGGGA TTCTCGAACG     80400
     TCAACTTTGC GTTCGCCACG AACTGATGCC GGAACGAATA CAGCGTCACG CTTGATCGAG     80460
     CCCGCCGCTT GCCGGCTACC GCCAGTGCGC GTGCGGCCTC GAGCTCGTGC TTGAGCGCGA     80520
     GCTGGAGCCG CGTCGCTTCT TCCGCTGATT CCGACTTGCA CGCAGCGAGC GCGCGCGCAA     80580
     TGACTTCGAT CTCGCGCACC TCGAGCTCGT CGACGTACAT CTCGCGATGT GTTCCGTTCC     80640
     CACGCCCGTT CGTGTGCTTT GAATTGCGCA CGCGCAGAAC TCTTCTGCCA TCGGCTTCGT     80700
     GCTGTCCGAG CTCGGAGAAT GCCCACTCGT TCGGCCGCAG GCCAGTCAGC AGCGTGCCTT     80760
     CAAGCACGGC GAGAAGCGTC GCCGCATGCT TGTACTGCTG TTTGATGCGC TCCTGAATTG     80820
     CGTGCTTGAT TTCATTCCAC ACGGAATCAG GAACGTCCTT GCGTTTGCGG CCGCTGGTAT     80880
     TCGAGCCGCC ATTGCGCAGA TCGCCGGAGC CGTGACGCTT CAATTCGTCG ATCGCGGTCT     80940
     CGTGATGGGG GTGATAGGTC TCGAGATAGT AGATGGCCGA AGACTTGTAA AACCGCCACG     81000
     TCCGGGCGGC GTACTCCGTG CGAGTCAGAA TCAGGTGTGC CACTACCTCA TCAGGTGCCA     81060
     TGTCGGGTTT TCCGAGATCG CTCATAAAGC GCTTTCGATT CCGTTCGTAG CACTGCTCGT     81120
     ATTCGATCTT CGTCTTGTCC GAGATCGTTG GGGTGAAGCT GGCGAACGGT TCCATGGTCG     81180
     AGAGTGCGAT GCCGTTGTGT GGATGTGCAG CCGTTCATCC CTGTGCGGAA CCGAACAGCG     81240
     TCTTTTCGCC TTCATATCGT GCCGCGCGAT GCCATGTCAA CCTTGCGAGT GAACGTGAAC     81300
     TGCATGTGAG GTATCTCCCC CCGTTACAAA CAGTCCCGGC CGTGCTCCAC AACGCAGCAC     81360
     TTTGTCCTGT TTGTAACGGG TGTCATAACG CGTGCACTTT GATACCGCTG AAGGCCTCTT     81420
     CGGTTCACGA AAAGCGCGTC GGGAAGAGGC ACCATGAACA ACGATCTGCC TGCGGCTGCG     81480
     CATCCAGTCA AATATTGTTG GCACCACAAA ATTTCGCAAA TATTTGTGAT CGAGCCGATG     81540
     TAAGTCCTTG ATTCGTTGCG GAGCATTGGG GTTGTGCGGC GCGCCAGTGA AATTTGAGCG     81600
     GTAGTGCCGC GCTGGACTGG CGCAAATATT TGCGCCGAAC GCAAAAATTT GCCGACGCGC     81660
     TTGGCGCCAA TGTCGTCAAC GCGCTTGCGG TGCGCGCTCA TTCAAACGAC CCGCCCACTG     81720
     TCACAACGCG TCACGACGCG CTGTGACAGT GGGCGACTAC GGCGGCGACA CGAAATTCTG     81780
     TGATGTTGCA TTTCCGCGAC AACCCGCCTT TTTTCTAATT CAAGCCAACA TGTGCGCCAA     81840
     ATGGGTTCAA AAACATATAC GTTTTTAGCT CCGTTCAGTG CATAATCCCG ACTGAGATCA     81900
     ATCACAGTCG AGAATTGGGT GACGTATGAC TAAACGGGCT TCAGGTCCCG CGTGTCGTGC     81960
     TCGGGCTTTG GCGGTTGTCG CAGCTCTCGC CGCATTGAGT GGTTGTGCGG TTCAGCCGCC     82020
     CGCGCCGACA ACGGAAGAAC AGCGTCGGCT CGATGTGCTC ACGAGACTCG ATCAGGCGAC     82080
     AGCGCTGGCG GTGAACGCGC AGCGTGAGCT GGCAATGACA GCGGACGCAT CGGTTCAGCG     82140
     TCAGGCAACC GAGCGGACGC GATTGCTGAC CGACAAGGTC AGCTACGACT TCTATGGGGA     82200
     TGTCGAGGAG CTCCTCGCGG ACATCGCATC GAAGTACGGC TACGCGTTCA AGGTGTTCGG     82260
     CAAGCGACCG CCGGACCGTG TGAATGTGAA CGTGTACGTG AAAAAGATGC CGGTGCTCGA     82320
     AGTGCTTCGA TACGTCGGCA ACACTGCGAG CAGCTGGCTC GACGTTGCCG TGAAGCCGGG     82380
     GGTGATCGAA CTCACGTACA AGCCAAGCAA TACCTGAGGG ATACGACATG CCGATTGATG     82440
     CCGTTTCTCT CGAGGCGCTC CAAAACTACA GTCAGCCGGC GGCCGAGCAA CGTGTCGTGG     82500
     CCGGTGCCGG CTCTGGCGAT CTGGGCAACT TCCGCCTGAA TGCGCTGCGC GATGCCGCGT     82560
     TTGGGCTTGG CGCGCGCGGC GGTTTGATCG CCGAGAGCCG CTTGATCAAC CAAGCGCTCA     82620
     GCACGCAAGC GCGCAAACTC GACGTCACAT GGGATTTCAC GCCCATGATG ATTCAGGGGC     82680
     GGGTCTTGCC GCCCGTCTTG AATCGCGTCG ACGACATCTA TGCGCAGCCG GGCGATCAGG     82740
     TGATCCGCAT CGCTCGGACG AAGTGGGCAT TTCAGGCGCA GGCGCGCTTT ACGTCGCGTC     82800
     CGCCGACATG GCGGGAATAC CTGATGAACG ACCCGGGCCC GCTCGCTCCG CCCAGCTCAG     82860
     TGCTCTACCC GCGAGATGGC GCCGAGCGGC AGATCTGGCA GCAGGCCGTA GCCGAAGGCT     82920
     GGAGTAACGG CGTGAAACAG GCCGACGACA TTTTTCAGCT GAACCTCAAT CGCCTGACGC     82980
     GCGACTACAC GGGAATGAAG AACTACCGCG TACTCGCATA CAAGCACATG GTGACGATGC     83040
     CGATTGTTGC CCAGATGGAC ATGCCGTTGA ACACGACGGG CCAATCGATG AGCGTCGACG     83100
     AAACGCTGCT GCGCCTGACG GTGCTGCCCG AGTTCAATAC GAACATGAAG GACTGGCAAG     83160
     CGCTGGGATC GGAAGTTGAT CGCCTTCAGC AGCCGGTGCC GGCGAACGGT GCGTCTGCTG     83220
     ACGGATTGCC GTCGCAGGCG GATCTCGCTC AGCCCGACGA GGTTCAGTAA ATGGTTTTCC     83280
     GCAGCAAGGA TGGCGTGCCT GACCGACTGA CGGATTTCCG TGAGCCGGAC ATGTTTCGCG     83340
     ACGGGCGGCA TCTGCAAGAG CTGATGCTGG AAATTGTGGC GCTCAACGCA AGCGAAACGA     83400
     TCATTCAACC CGGCGAACAA GTGCTTGTCG AGATCGGGGG GCGTTTGCGT CCGATTACCG     83460
     AGCGGCGCAT GACGATCGAA GAGGTCAAAA GCTTCGCGAA CTGGGCGGCG GACAACGACA     83520
     AGGCCGCTGC TGAATTGATT CAGCGCCGCG AGGTGAAGGC GAGCTACGTC GTCAAAGACC     83580
     CAGTCGCGCG AGACGCGCGC GGTGAACGGA AAGCGACTCG CTTTCGTGTT GCTGCAGGCC     83640
     GGGGGGAATT GCGCGGCACG ATGGCCGTGC AGATCGTGAT GCGTCGGATC AACTCGGAAC     83700
     CGGCGTACAT GAACGACAGC GAGTTGCCGC CGGAGGTGGT CGAGGCATTG ACGCCGAAGG     83760
     ACGGTGTCAT CTGGGTGACT GGGCCTACGG GATCGGGCAA GAGCACCTTC TTCTCAGGCA     83820
     TCGTGCGCTA CGTGCTTGAG AACGACACGC CCATCAAGGG CAACATCGTA CTGCTCGAGG     83880
     AGCCGATCGA ACAGGTCTAT GACTCGATCG AATGTGACCA CAGTGTCGTC TTTCAAATCG     83940
     AAGTCGGAAA GGACGTCGAC ACATGGGAGG CGGGTATCGA GCAGCTGATG CGCCGCTTGC     84000
     CGCGCTTCAT CATCATCGGT GAGACCCGGA GTCGGCCGAC CGTCGACGCG GTGCTTCAGG     84060
     CGGCGGTAAC CGGCCACCCG GTCGGCACTA CGCTGCACGC CAACGATGTT CCCGGAATCT     84120
     TTCCGCGACT CCTGTCGTTC TTCAGCGACG AAGCGAAGGA AGCCGCACTG TATAGCGCAA     84180
     TCAGCACCGC GCGGGTCATG TTCAATCAGG TGCGCGTTCC GAAGCTAGGC GGCGGAATGA     84240
     CGGTCTTGCG CGAATACCTC GTGGTGGACG CGGATCTGCG CGCTGACCTG CAGCGCCGCG     84300
     CGACGCCGGC AAAGATCGAA GCCCAGATGC GTGAGGCCCT CGAATCGCAA GGTTTCCCGA     84360
     TGTGGAAGGC AGCGGAACAG GCGCACGCGC GGGGAATGAT CAGTGCCGAC CTGATGCGCT     84420
     TCTACCAGTC GCAAGCGACG GGGGCAAATC GTGGCTGACA CTCACTGGCG CTACACGGCG     84480
     AACACGCCGC GCATCGGCCC CCTTGATGCG CGTGCGTTCT CCCCATTTCC CGCACTTCTT     84540
     CTTTGGAAAT CTCTAATACC GCTCACATTC GGATTCATTT TCATATTCTT TTTTGCTATC     84600
     ATCCAGCGCA AGGGTTACGA CTTTCCAAAT TTTTGTCGAG CTCTTCGGAC GAAACTGTCC     84660
     GGATCCATAA AAGCCGTCCG GCAAATCCGC TAAGCGACGG CATCATCAAG GGTGCATAGC     84720
     AAATGACGAA GAACGCAGCA GTGAGTGAGG AAGTCGGCAA CGTCGTCCAC CTCCAGCCGG     84780
     AGGGGGAAGT CCGGTTCGCG GGAACCGACG ACGGGCACGA CGGGATCAAG ATCGTGACGG     84840
     ACGACTGGCG GCAGATTCAT GTGCCGTCGC GTATCACGCG CGGCGCAGAT CTGATCAGCC     84900
     TGAACGATGC GGACGACAAC GTTTATGAAG GGCCGGACGG CACGCTGTAC GCGGTGTCGC     84960
     CGACGCTTCC GTATTTCGAC ACGACCTTCA GCGACTACGC ACTGTCGGAT ATCAATCTGG     85020
     TGCTGGTTCA CCACGCACTC GCGAAGGCCG GTTTGGGCGG CCAGCGCGTC AACCTCGTGA     85080
     CCGGATTGCC GGTCGGCGAC TACTACGTGG CTAACCGCCC GAACGTCGAT TTCATCTCGC     85140
     GCAAGGTGGC GCACCTGCGC GAGAACACCG TGCGCAACAA GAACGAATCG GTCGCGCTCG     85200
     CGACGATCGT CAAGCACAAC GTCGTGTCCG AGGCGATTGC AGCGTTCTTC GATCTGCTGC     85260
     TCGATCGCGA AGGAAACCAG CGCGACGACG TGGCCGAGAT GGTGGCGACC GGCGGCATCG     85320
     CGATCGTCGA CATCGGCGGG AAAACGACGG ACACAGCAGT CGTGATGAAT GGCGGCCGGG     85380
     ACGTCGACGG CAAGCGCTCG GGTACCGATC CGATCGGGGG GCTGTCGCTC AACAAGGCGG     85440
     TCGAGAACGA GCTGAAAGCG GAATTCTCCG TGACGGCCCT GAACCCGGCT CAAGTCGATC     85500
     GCGCGGTTCG GGAGGGCGTG CTGCGCCTGT ACGGGAAGGA TCACGATTGC CGCGCGATCA     85560
     TCGACAAGCA GAAGAGCGAG CTCGCCAAAC AAATCATCGC GGCTACGCAT CGCAAGATGC     85620
     GCGACGCGTC CGATCTCGAA AGAGTCTTTT TCGTTGGCGG GGGCGCGCTC CTGTTGTGTG     85680
     ACCAGCTGGA GGAGTTGTAC CAGCACGCGG AGTTCGTGGA AGACCCGCAG TTCGCGAATG     85740
     CGCGCGGGAT GCTGAAGGCA GCGATGTTCC TGCAGCCGCG CTGAGCGAGG TACGGCAATG     85800
     AGCGAGACCG ATACCACGCT ACGGTTCGTG GTACCGCTCG ATCTGGCGCG CCCGGAGGAC     85860
     CGGGCGCTGT TCGATGCCTT TCAGGCTGTC TCGAATGGCT TGAACGGAAG CGTTGCGCGG     85920
     CTTTTGATGC AACGAAGTTT GCCGAAGCAC GCTGACGGAA TCGACGCGCT GTTGATCGAG     85980
     GCGGTTCGCG ACCAAGCAGC TCGTAAGCGC TTGCGGGGGC GGCCAGTGGG GAGTGGTTCA     86040
     AGGCGGCCCG CGAGCGCTTC GGCCGAAGTG CCGCCGGCAC AAGCGGTTAG CCGTGCGGCA     86100
     GTTGTGCCGG TCGCGATTGA GAGCATGGTG GCGGCGCCAG TAGCGCCGAG TCACGTTACG     86160
     GATATGGCGG ACGCAGCGGC AGTGAATCGG GCTACGCCGG AGCCTGTAGT GGCTTCTACT     86220
     GTTGAAGTCG AGCGGGTGGC GCCGACGGTT GTGCGCGGCG ACGAGAAGAC GGCGGGCGGC     86280
     GAACGCGCGG CAGCAAAGGA GCCCGTGTCG GGCCCGAAGA AGGGCGACGT GAAAGCAAAC     86340
     ATAGGCGGAC TCGTCGCGTG GAACTGATGA GGAATGGATG AGGACGGCAT GAAGAATAAG     86400
     CTGGTGTTGA TCATAGGGGC GATGGCTCTG CTGCCTCCCG TTGCGCGTGC GGGTTTCACC     86460
     GTAGACCCAG CGCTCGAGAA GGCATTGGCC CCTCGCCCGA CTACGCCGCT CTCGATTGCA     86520
     TCCCTTCCTC CCGCAGCAGC GCCGGGGGCG GAGCAGCCGA TGGCGGCTGC TGCGGCGACG     86580
     GCTGCGGCCG TGCCGGCGGC AACTGTGTCG ACGACGACGC TGGGTGTTCC TTCGGACGCT     86640
     TGGGGAGAGA AGATCGACGG CTTCGGCCGC AACCAGCCCG CACGTCAAGC CCTGACTCAT     86700
     CTCGTCCCGA GCGGCGGGAA GTTGATTGTC AATACTGCGA TCTCGCCGAC GGCCCGCGTC     86760
     TCGTGGAAGG GCAACGACAG CCGGCTCGCA ATCGCACGAA AGATTCTTGC GGATGCAGGG     86820
     ATTGACGGTC GTTTCGATGG CGACAACCTC ATCATCGGCG CGGCACCGGC CCTCGTCGCC     86880
     GCGCCCGTGG TAGCGCCGCA AGATCCGGCA GTGGAGTCTC GCCTGTGGAC GATGGCAAAG     86940
     GGCGTGATGC TGAGTGACGG ACTCGCAGAC TGGATGGAGC AGACGGCAGC GCCCAGTGAG     87000
     CGATACCGAT GGACGCTGGA CTGGGCAGCG TTTGATGGCG TCAACGGTGA GCGCCGCATC     87060
     GACTACCGGA TCGTCGCGCC GCTCCGATTC AACGGCACCA TCGATCAAGC GGTCGCGCAG     87120
     CTCATCATGC TGTACAAGAA ATCGACGAAG CCGCTTGAAG TCAAGATCAA CAAGGATCAG     87180
     CGGCTGATCC ATATCAAGCT TCGGGGTGCG AATTGAAGAA TGTCCGTCGT TTCTCGTCTG     87240
     TCGCCGCAGC GGCGATGCTC GTGATCGCCC TCTCGGGGTG TGAAACGGTT CAACATGCGG     87300
     ACCGCACCGA CAGTAAGGCA GATCAACGTG CGTCAATGAT CGACCACAAG ATGAACGATC     87360
     AGCTGCGGGA TGCTCGTCCG GATGCCGACA TCGTTCAGTA CCTCGATCAC CAATACGTAT     87420
     CGCTTGAACC GGTTGAGCGC GAAGTGCAGC CGGTGGCCGG TACCAAGAAG AGCCTGAACT     87480
     GCCACATCCA GATCGCAACC GAGCAGCCGA TCTCGATTCT CGAGGCGGCG CAGATTGTCA     87540
     CGCGCGAATG CCACGTTCCG GTTCGTGTGA CGCAAGATGC GATGCAGCAG ATCGCAAATC     87600
     CGGCCGGATC GCTGGCGCAG CTGCAAGGAC AGGGCGGGGG CACGATTCCG ATGGCTGGCG     87660
     GCACTGTTCC GGTGGTTGGG GCGATCGGCG GCGCACCGAA CTATGCATCG CAGATGGCCC     87720
     GATATGGTGG TGGCGCCGGC TTCGACAACA GCCTGATCGA CGTCAACTAT GACGGCGAAG     87780
     GCGACGGCTT TCTTGACATG CTGACCGCCC GGATGGGTGG CCTGTCATGG CGGCAGGACG     87840
     AGAGCGGTGT GATCCGCATC TATGCGGTCG ACACTCGCAC GTTCTCGATC GCGTCGATCG     87900
     CGACGGACAC GCAGCTCGAT TCAAACTTCC AGAGCGGCAC GACCATGGTG GCCGGTGCGA     87960
     CCTCCGGAGG CACGGGTGGC TCGTCGGGTG GTGGGCAAAG TGGCAGCGGG CAGGGGACGA     88020
     GCACCACGAT GCAGAGCACG GCAATCAAGA TGAAGACTGA TCTCTGGAAG GATATCCAGA     88080
     ACACGCTCGA CACGATGGCC GGCAAAGGTA ACGCAGTCGT AGCACCGTCG ATGGGCTCGG     88140
     TCACGGTGCG CGCAAACGTT GATGTGCTCG ACCAAGTGAA GAAGTACATC GACTACCAAA     88200
     ACAAGCGGCT GTCGAAGTTC GTTCAGTTCA ACGTGAAGGT CTACTCCGTC ACGTTGAGCA     88260
     ATAACGACAG CGCTGGCGTC AACTGGAACG CTCTGTACCA GACAGTGACG GGCAAGTATG     88320
     GCATCAAGCT GTCCGGTGCG GCTTTCTCAG CACCCGCTGC GGCCGTGAGC GCAGGGTTCT     88380
     CCGTTCTCAA GAGCAGTGGT TCCCCTTGGT CGGGCACAGA AGCTGTCGTC AGCGCACTCA     88440
     ACGAACAAGG CAAGGCGAAT CTCGAGCGAT CGCAGGCTCT GCCGACGTTG AACTTTCAAG     88500
     CGGTCGCGAC GCAGGTCGGT ACGCAGACCG GGTACGTCGC CGGCACGCAG ACGACGCAAA     88560
     CCGCACAGGT TGGCAGCAGC ACGTCGATCC AGATGGGCAC GATCAATGTC GGCTTCAACC     88620
     TGTCGCTGTT CCCGTATGTG CAGGACAACA ATGACATTCT CGTCCAGTTC AACCTCAACC     88680
     TGTCGAACCT CGACAGCATC CGGAAGGTGA ATATCGGTGA CTCGTCTGCG GAAGCACCGA     88740
     ACATCAATCT TCCTCTGAAC ACGGTTCAGA AGGTGCGCAT TCGCCCGGGC GACACGCTGA     88800
     TGCTCACCGG CATCAATCAG AACGACGATA GCTCGAACCG CACCGGTACC GGCATGCATT     88860
     GGAACTGGGC GCTCGGTGGT GGAGTGAACG CACAGAGCAA TCGCACGATG CTCGTGGTTC     88920
     TGATCACGCC CATCATGCTG GACTGAGCGC CATGTCGGAT CTGATCAACA AGCTGCTGCC     88980
     AAGCGGTTTC GCCGAGTTGC GAAACAAGCT GTCCATGCGC GGGCGTCAAG CTCGCGTGAT     89040
     GCACGAGGAA GAGAGGCTCG ATCTCGAGAT CGAAATTCTC GAGTATCACG GCCGTAAATT     89100
     CGTCACCGGA CTACATTGGG CGCCGCTCAC GAGTCCTTTG AAGTACAAAA AGGAAGCGAA     89160
     GCAAATGGCG GCCCAATGGC ACTGGGACGT CGTTGCCTAC CGGCGCGAAG CGGGGGGGGT     89220
     TCAGGCCGGC TTTGTCAGCA CCTCCAGTGG CGCCTACAAG CGCATGTATA GCGTGGCGTC     89280
     TACGCTGGCT GGTGAGCTCT CCAAACAATA CGGGAACAGA TGGATTGGAC TCTTTGCGGT     89340
     ATCGGAAGAA AAGTATCTTT TCGTTGCCGT GTGGGATGGA CTGGTCGTTG CCGGTACTGA     89400
     CCGGATTGTC TCGCGGTCCG AAGCTCGCGG CGCGTTCAAC GAGATCATCA ACCGGCATAC     89460
     GCAGGGCGAA GACCGATTTG AGGACGACAA GCAGTTTGCG CCCGTCGAGC TCGAGCTCAC     89520
     TCACACGGAA CTGAGCCTGA CCGAAATTCT GTCGGTGAAA AAGCTCAGCC GCGAATATCA     89580
     GCTCCGGGCA ATTACCTTTT CACTGTCGGC CGCCGAGACT CGAAAAATGA TTCTCCTCGC     89640
     GGTGATCGGT TGCGTTGCGT GGGCGGGCTA CTCCAAATGG AGCGACGACC AACACGAAAA     89700
     GATTGCGGCA CGGCAGGCGG CAGAGAAGGC GGCCAACGAT GCACGTTTGG CGCAGGCCAA     89760
     TCGGAATGCG CGGAACAAGT TGCTTGAGCA AGCTCTAGCG CATCCTTGGG CTTTCGCGCC     89820
     TTCGGCTCGT GACTACGCCG CCGCATGTGA ATCGATGACG GATGCGCTCC CGCTTAGCAT     89880
     CGCGGGCTGG CTGTTTGCGA GTGCGCATTG TGAGGGACCG AAGGTCACCA TCACGTACCA     89940
     ACGAAAGACA GGCACAACAC AAGGGACGTT CGGCCAGAGT GTCGGCCAAG TTCTCATGGC     90000
     ATACGGGGCG CAAAGGGCCA AGCCGGTATT GAGTTTTGCT GAGTCGGGCT CGGAGGCGAC     90060
     GATCACGATT CCGATCGATG CTCCCGCTGC TGGCGACGAT GCTCTTTTGC CCGCATTCGA     90120
     GGCGACTTCC GAGCTGCTCG GTACGCTCGA GCCGGCGAAT TCCAATGACT TGCAAATCAT     90180
     CTCTGGAATG AACGTCACGG AAGTGCCCGT GGAAATCAAA TTGCCGCCGT CCGCGCAAGG     90240
     CGCGTCGGAC GTGGCCGTTC CGTCACCGAC ATGGCGCCAC TATGGATTCA AGTTCGACAG     90300
     CGTTATCAAG CCGGAGGCGA TCATGGCTTC GATGAAGCTC TCGAACGGTT TGCGATTCAA     90360
     CGGTATTGAG ACCAAATTCA ACGCCGAGTC CGGCACGCTG ACTTGGTCGA TTTCGGGAGA     90420
     TCTGTATGTT CAAAGGTAAC GTCGCTATCG GTCTGATCTG CGCGTTTGCG CTGACGTGTC     90480
     TGACGCCGCA GGCATATGCC GAAGATGGCG ACAACGTCGG AACGCTGGGC CGAATCCAGA     90540
     CGCATACGTA CATCCTCAAT GCGAGATATC TGGAGAAGCA GGCCCAAGAC AAGCTCGATG     90600
     GCAAGGTCGC AGCCGACGGC ACTGCGACAC CCGCCGCGAC GGCAAGCATT GCACCGCGCA     90660
     GCGTTGTCGA CTCTGCACTG CCGAACGTGA AGATGATCAT CAACGGCGAT GCGGGGCCGT     90720
     CGGCCGTGCT GCTTTATGCG GGCGGGATAC AGGCTGCGGG CAAGGTCGGC AGCAAGTTGC     90780
     CCGGCGGATA CACGATCAAG GCGATCTCGG CTTCGAATCG CTCGGTCGAC GTGACAGATC     90840
     GCAACGGCAA GTCCCTGACG CTCGGGATGT CTTCGACGCC CCCCCAAGTG CAGGAGCAGA     90900
     CGCCGGGCCA GCCGCAATTC GGGGCGCCGG TGCCGATGCG TATGCCCGCA ATGGGCGCCA     90960
     CGACGATGTT GCGCTGAGGG CGGGCCATGG GTGCCAATGA CCTTCTGAAG CCGACGGGGC     91020
     GGCCTGCTGT CATTTCGGTC GGAGACTCAC AGCTTCGTCC GCCACCGAAC CTGAAGGGTA     91080
     AGGTGGCGCT CATGTCGAAC AATGAGCTGC TCGTTGGCGA TGCGTACGCC AACGATCCGG     91140
     CAGTTCACTC GTACCTGTCG CTGGTTCGGC GTGCGCGAAA AGTACATGTC GGGATCAAGT     91200
     CGATCGGTCT CGACGAGCTC GGAGAGATCC TGTCCAGTGC TGACAAGATC TCGCACACGG     91260
     GAAAGCGCAG TGCGACGCAG AGTGAGGTGC TCGCTCGGAT CCGCGATGGG TATCAGCGAC     91320
     GCTCGAGCGA CATTCATTTC GTGAATGGTG AAACGACGAC GAAGATCAAA TATCGGATCG     91380
     ATGGCGTACT GCGCACCGTT GATGAAATCA CTGTCGCCGA TGGGATGGCG CTTTGTCGGT     91440
     CGATGTACGA GTCGATGACT GACGTATCTC AGGGCACGTA CAACGAGCAC GTGTCGCAGG     91500
     ACGCCCGCAT CGAGCGCGCG TGGTTGAAGG AGATCGGTCT CACCGGCTCT CGGATCGCGA     91560
     CTCGCCCCCT CGAAGTGAAC AACCTTTTTG TTCTTCGACT GCTGTATCCG GGTTCGCTTG     91620
     GAAACAAGAC GCTACCGGGC CTTGGTTACT CCCCCGAGCA GATCGCTGAA ATCAATCGGA     91680
     TGATCCGCCG CGATGGCGTG AATCTGTTCT CGGGCAGCAC CGGCTCCGGG AAGTCGACGT     91740
     CACTGATGGT CATCTGCAAG ATGATCTTGG AGCTGTTCAG CTACAACATC CATCTGCTGA     91800
     CGATCGAGGA CCCGCCGGAG TACGACATCC CGGGAGCGAA CCAGACGCCC CTGAAGTACG     91860
     ACGCAACGAA GCCGGATGAG GTTGGGCGCG CTTGGGCGCT TGCTATCTCC AATGCAATGC     91920
     GTTTGGATCC GGACTTTCTG ATGGTTGGCG AGCTTCGCGA CTTCTCATCG ACGATGGCAG     91980
     CAATTCAGGC GGCGATGACC GGACATGGAC TGTGGACCAC TACGCACGCG AAGCACATCT     92040
     TCGCGTCGCT CGATCGTCTT GCCGACCTGA ACGTTCCGAT CGGTCGGCTC ACCGATGCTT     92100
     CGTTGATCAC CGGGCTGATC AACCAGTCGC TCGTTCCTCG ACTGTGTCCG CACCCCGGTT     92160
     GCGCACGACC TTTCTCGAAA TTCAAGGACG AGGTCGCTGA GGACGTTCGT GAACGAATCA     92220
     TCAAGTACTG CGACGCAGAT CGGGTGATGA TCCGCTGTAG GGCGGACAAC ACGGATTGCC     92280
     CCGTGTGTGG TGGCCTTGGA TATTACGAGC GGACGGTCGC AGCCGAAGTC GCAACGCCCA     92340
     CGCAAAAGCT GATGGATGTG TATCGAACGC ACGGCAGTCA CGAAGCTCGG CGCTACTGGG     92400
     TAAAGGAGAT GGGCGGCATG ACGTCGATGC AGCACATGAT CCGAAAGATC AACGAGGGAA     92460
     TCGTCGATCC TGTTGCCGGC GAAGAGGCAA TGCGGCGCGG CCTCGATGAA GACGAGCTCA     92520
     CACTGGCTTG AGGTTTGAAT GATCGATTGG TTGATGGATC TCATGCTCGA AGTTGCCGAG     92580
     TTCTACCGGC GATCGCGCTT TAGCTCGAAA GAGCGGAGCT CGTTCTACAG CAAGCTTGGC     92640
     ATGCTGACCA AGAACGGGCT GACACTAAAA ACGGCGTTGA CGACGCTGCA CAACGTCTTC     92700
     AGCGAAGGCG GGACGAAGCC GAACAAGATC AAGGCAATCG TCACGGAGGA ATGCCTTGCC     92760
     GGGCAGCGTG CTGGTAAGGA GATCGCGTTG ACACTGATGG AGTGGGTTCC ATATGAAGAA     92820
     GCTGCGACCA TTGCTGCGGG CGCTCGTAGT GAGGGCGGGC AACATTCCGC GTTCTTGCGC     92880
     GCGCGGCAGA TCGTCAAGCG AAAAGCTGAA ATGCGGAAGT TGCTGACGAA AGCTTTGTCG     92940
     TATCCGACGA TGTTGTGGGT CGCAATGGCA GGGCTGTTGT ACTACACGTC CAAGACCGTT     93000
     ATGCCGAATT TGATTCGGAT GACGAAGCCA GAAAACTGGG ATACGACGGC GCAGATTATG     93060
     AGCGTGATGG CGAATATCGT CGGCGAACAT GGAAAGCTGG TTCTCCTACT GATCTTCGCC     93120
     GTCGTCGCAT CCGTCATTTG GAGTATCGGC CACGTCACGG GCTTGCCTCG TGTCTACCTC     93180
     GACCGCGTGC CTCCGTGGTC GATTGTCCGT ACCGTGCGCG GCGCCACGTT TCTATACAAC     93240
     TTCGGCGTTC TTCAGGCGTC AGGCGTCAAG GCGCTGTCAA TTCTTCATAG TGAGCTGAAA     93300
     CATGCCAACG CATATATGAA GGAGCGGATT GAAGGCGCGA TCATGGGCGT CAAGAACGGC     93360
     AGGAACATCG GTGAGGCATT GCATCTTGCA GGACATGAAT TTCCGAGTCG CGAGGCCATC     93420
     GAGTATCTGC GCGTGATTGC CCCGCTCAAT GGCGGGCCGG AGCAGATGAT GGAGTTTGCC     93480
     GAAGACTGGA TGGCGGAAAG TATGGAGCAG GTAGAGGCGA TCGCGGCTGT CCTTGGGAAC     93540
     TTGTCGTTGA TTGCGGTCTT CGGTGTGATG GGTTTTCTGT TGTCCGGCGC AGGTGCGATC     93600
     GGTATGCAGG CGATGGGGTC GATGGGCCAG TAAGCGTGCA GTGCGAAATA TTTTCTTGGA     93660
     GAAATCATGA ATAGCTTGTT TAAGAATCAA CCTGTATTGG ATGCGTGCGG CACGACTGAC     93720
     GCGAACGAAG AAGCGATCAT CGAAGGCCAG CTTCGTTCGC AGCGCGGTAT CGGAGCGCTC     93780
     GAGTGGATCG CGATCATCGC AGTAGTGCTG TTCATGCTGT ATCAGATCAT CGGACGTGTC     93840
     TCGGTGATGA ACACCAGCAA CAGCACACTC GGCGAGACGT CCTCGGTCTC GGCATTGCAT     93900
     ACCGCGCTGC GCTCAAACCT GAAGTCCGGT ACGGGGTATG CCGCAAACGG CGCGGATCTG     93960
     ATCGTGCCGC TGTACAACGC AAAGGGAATC CCGACGAACC TGTCGTACAA CGGCGGTGTG     94020
     TTGCTCAATA CCTATGGTTC GCAGTACACG ATCGTTGCCG CGAACGCTGG TTTCGGTTTC     94080
     GCGATCACCG ACCCGGGGGT ACCCGCCGCT GACTGCATCA AGCTGGTGAT CCAACAGTCG     94140
     CAAAGCGGGA ACTGGACGGG CGGAATCTCC GTCGGTGGCT CGAACCTCGG CAATGCACCT     94200
     GTTACGACGG CGAATGCGCA AACCGCCTGT AACGGTGCAA CGAACAGCAT CGTGTTCACC     94260
     TCCAACTCGT AACGCGGTGG CTTGAGGCAA CTGTAATGAA GATTAGTGAA GCGGAATTCG     94320
     CGGACCTTTA CATCGGTGAA GACTTTGCTG ACGTGGCTGG GCTCAACGGT ATGGATAAGG     94380
     ACGAGCTCAT ACCCGTGCCG GCGCAGTTTG ACGACGAGAT CGTCCAGTTG CGTGCGCAAT     94440
     GCTTCAAGAT CATCGCCGAT CAGCCCGTTG GCGAGTTCTC GCTTCGCAAA GGGAATGTTC     94500
     TACTTCGGGT GACGTGTTTG CCGAGCACCG ATGGCAAGGA CGTATTCGTC ATTCGGAAGC     94560
     CGATGGCGAA GCTGCTGGAT CGCGAAGAAA TAGGTCTTGG CAAAAGCGAC CTTGAGTACC     94620
     TGATGCGACC GGAGCTTCGT GGCTTGGTGT TGTTTGTTGG TGAGATGCGG TCAGGAAAGA     94680
     CCACGCGTGC AGCATCTTTT GTGAAGGCGC GGCTCGAGAC GCATGGTGGG ACGGCGATTG     94740
     CAATCGAAGA TCCTCCGGAG ACCGCTCTTG ATGGTATGCA TGGCAGGGGC AGGTGTATTC     94800
     AGGTTGATGC ACGTGGTTCT GGCGCCTATC AGGAACAGCT GAAGCGGTCA GTGCGTACCG     94860
     GGGCTGGAAT GATCTACTTA GGTGAGGTAC GAGACGGCGA AACCGCGATG CAAGTGGTGA     94920
     GCGCATGTAA CAACGGTCAC CTCATTCTTT CGACGACGCA TGCACTGTCT GTCCAAGACG     94980
     CAATCATGCG CATTTGCAAC TTTTGCGCAG GCAAACTCGA GGATCCCGAA AAGGCACTTG     95040
     CGTCTGGACT GGCCGTGGTT GTCCATCTGA AGCTGTTCAG CAAGTGGGTA AATTCTGCGA     95100
     CGGGGCCGAA GGAGGTGAAG CGTGTCGAGT ACACCATGCT TCGCGTCGAA GGTAACAAGC     95160
     AGGTGCAAGG CCTCATTCGC ACCAAGCAGT TTCACTTGAT CGACAACGCG GTCGAGGAGC     95220
     AGCAGGCGAA GCAGCGCAGT GGTAGTTTTT AACTCGGACG AACCGGACAA GAAAATGAGC     95280
     AGAAAGATTC TTTTGCAGCT CGGCGGTCCG AGCGCGTCCA TTGAGGCGCG ACGCCAGCGT     95340
     GAAGGCGGGG TTGGCGCGCT CGAAATGATC GCGGTGATTG GCATTTTCAT CAGCATGATC     95400
     GCGCTGTCCG CGCCATTCGT CACTCAATGG TCGAACTCCC GCACGGATCA GATTGTTGCG     95460
     GATCAGTTCA AACTGGCGAT GCAGGGCGCG AATACCTTCA TCCAAAACAA CTCCGCGACG     95520
     ATCGTGGCGG CTGCGAATCC GACCGTTGTG TACTCGTGGG CTCAGATGGC TGGATCAATG     95580
     CCCGCAGGGC TCAGCCCGAC GAATACGTTT GGCCAGACTT ACCAGCTCGC GATCCAGAAA     95640
     ACGGGCACGG CGCCAAACTA CACGTTGAAC CCGATGCTGC AGACGACTGG GGGGCAGCCG     95700
     ATACCGGAGA ATGAGCTTCG CGCGATCTCG GCATCGGTCG GTGGCTCGGG CGGTTATATC     95760
     TCGACGTTAA CTCCAACGGT CGCTACCGGC GCCAAGGGCA GTTGGGGTCC GCTGACGCTC     95820
     ACATCGTTTG GCGCGAATCC CGGCGCGGGG CGGCTCGCGG GAGCGCTGTT CTACCAGACG     95880
     TCGACGCAAG CGAATCAATA TCTGTATCGC GTGAACGTTC CGGGGCATCC GGAGTTGAAC     95940
     CAGATGCAGA CGTCGGTCGA CATGCAGAGC AACAACGTCA ATAACGCCGG CATCGTCAAC     96000
     ACGAACAAGT TGGCCACGAA CGGGCTGAAT GCGAACGACA TGCCGCCAAC ATGGGGCGGC     96060
     GGTATTCGCA CGTGGGACGT CTATGCCGGC GGCACGGTGG GCGTCGGTCC CGGCGGTGGT     96120
     GCGCCGCCGG TTGCGTGGAT GGCGCAAAAC GGTGTGGTTC AAGGGCAGTG GTTGAACGCT     96180
     ACCAACGACG TGAATGCACA GGGCAACGTG AACGCGAGCA ACAGCGTCAA CGCGTCCGTC     96240
     GGCGTGAATA CTGGCGGACA GATTTGGGCG GGCGGAAATA TCACGACGAA TGGGAGTATC     96300
     GGACTGAACA GTTCGGGCGC AGCGATCACG AACCCGGGCC GTATGCACAT CAATACCGGT     96360
     GAAAACCTGT ACCTCCAGCC GTGGTCGGGC GGAAGCACGA TCGTCGGTGG TGGTGGCGGC     96420
     AGCGGGAACC TGATTGTCAC TGGCAATCTC GACGGCAACG GATATATCAA GCCGGGTCAA     96480
     ATCGCGTGGG CTGGAGCGGG CTGCGGTCCG AACGGGGCGT TGGGCACCGA CGGTCAGCAG     96540
     GCATTGTTCT GCAACAGTGG CGTGTGGACG GCCGCTGGAG GCGGAGGTAG TGCGGTATCG     96600
     CACTGCAAGG GCAGCTCGTG CACGATTACG CTGCCGTCAG CCGGGACGTG GGATATTTTT     96660
     GGCGTCGCCT ACGTACACCA GTACGCTTGG CTCGGCGGGT GGTTCTATAT CAACGGCGCG     96720
     TTGGTCGATA CGAACGCGAA CGAGGGCGAC CAAGACGGCA CGGGCTGGGG GATTATGAGC     96780
     GGTTCCTATC GGATCGCCGT TGGCGGGCCG ACTACGATCG GCGCGAACAC GGTCTGGAAC     96840
     GGGACGTGGG GCGACTTCAC GATCAATCTC CACGCGACCA AGGAGTAACC GATGCCACGC     96900
     GGCGGGCCAC TTGGGTCCGC CGCTTTCTTT GCGCGGCGGG TCTTGTCGTT ACTCAACGGA     96960
     ATGAGGCGAG ACGCTCACGC CGTGGGTGTC GCTGTAGCGC GGAGGCTGGC CACATAGTCA     97020
     ACGGCCTTCC GTAGTTTGGC GAGCCGAACA TTTTTGCGTT TCGCGAATTC TTCGAGACTT     97080
     AGGCCGCTTG CTTCCAGCTT GACGACCAGC TGCTTTCGCT CTTCCCGGCG CTGTTCTCGT     97140
     TCGCGGAGCG CTCGGTGGTA CTCCGACTGG ACGCGATCAT AGTCAAGGCC GTTGACACTC     97200
     GCGTACGAGG CGGTTGATAG ACCGCTCTTC TCGAACGCTT TCAGGAAGAT GGCGCGGCGC     97260
     ACGACTTCCT CACCGGCGCG TAGGCGTGCC TGCTCCATTT GCGCCAACCT CTGCTTAGCG     97320
     TATTCCTGCT CGTGCGCGGT TACGTGGCCG CGCTCGTTGC CTTGAAGGTC ATACCGGGGG     97380
     CCGCCGCCCG CAACGGCTGT CAGGTACTCC AGCTTCCCCG CTCGTGCGGC GATGGCGCGG     97440
     TGAAGATCCC GTCGAGGTGC GTCGGCGCCC ATATCCGCAA CGAGCATATC AACGACGCCG     97500
     ACACATAGTG GTCGCCATTT TCCACCGAAC ACGGCAGGGT AGCGCTCCTT CAACGCGCGG     97560
     CGAGTCGACT TGATGAGGCT GGTCTTTGTT GCGCCCGCCA TGATCGGTCC CTAAAAAAAC     97620
     TCAAGTCTCG GCGCGATATT CCGACAATAG TCGGATGATG ACTATTGTCG GCACGAGGAC     97680
     AATTCCGGCA GACGATTACT TGCCGGAATG ACGAACAGCT ACAACCGCGC GTTTGGTACA     97740
     GTCCTGCGCA GCTTCCGCAT CGAGCGGAGG GTGACGCAGG AATCGCTGGG CTTCAGTGCC     97800
     GGCCGGGACC GCACCTACAT CTCTCTACTG GAGCTCGGCC AGAGGTCGCC GACGCTTGAC     97860
     ACCATAGTGG TATTGTGCCG CGCCCTCAAC GTCACGCTCA ACGAGTTCAT TGCTGCGGTT     97920
     GAACGTGAGG CCGATTCGTC CGTCGATTGA GATCGCGCGA TTCGGAATTA TGGTATCGGT     97980
     CAGCTCGATT TTGCCAGTCC GATCAAAAAA ACAGAAAAAA AGGGACAGTT TTAATGTCGA     98040
     TTCCGACAAT AGTCGGAAGA CGTTTCTTTG TCAGGCCACT GACAATGGCC GCTCTAAAAC     98100
     CCGGTCAAAT ATGAGTGTGT GGAGAGACAC AATCGATGCT TCGGACGAGT GCTGCGTAGA     98160
     CTGCGCCGCG ACATGCATCT CTCACAGAAG GACCTCGCGG TCCATGCGGG CGTCGACAGG     98220
     ACATACATAT CGCTGCTCGA GCTCGGCAGG CGCTCGCCTA CGCTAGAATC CATCGTCGCG     98280
     CTGGCGGCCG CGCTGAAGAT CCCACTTTCG AGACTGTTTG CCGAGCTGGA AGTCGAGATT     98340
     GCGCGGGACG TCGATTAGTT GATCAGGTCT TCGGAATTTG CGTTCGACGC CGAGGCGTAA     98400
     ACCGGTCTGC CGGGAGTTGC CAGCAGCAAT CGGACATCGT TGACCACGCG ACGCGCACCA     98460
     AACGTCTCGT GAACAAATCC AGAGGGGCCG ATCGTCAGAC GATGTGATTT TCCGCCTTCG     98520
     CGCAAATCCA CAACTTGGAC GTCGACGTCT CGCAACGTGT TGATTGCGGC GCAAACCTCT     98580
     TCCAGCCCGA GAGGCTCATA TATCCCGCCA AGGCAAATCA GTCGAAACAT GGCTATCTGC     98640
     TCAACGCTCC CCGGATTTTC GTGCTGAACT TGCGTTCGTG TAGTGGGCTC GCAGCACGCT     98700
     CACGTGTTGG GCGGTAGCAG CGCGCCCATC GCAAGACCTG CCGTTGCGAA TGCTACGCCA     98760
     ATCCATGACC ATACCCGTGT CCACGACGAC ACCTCCCAGT GCGCAAAATG CGCGCCGAGC     98820
     AAGATTCCTA AGCAGGGCAG GCCGCTTACC GCACACACGA TCAAAGTTGG TACCTTCTTC     98880
     ATTGTGTCGT CCCGATTTCG CGGCAATTCC AATCGTGTGT CATGAGGGCT AGCCAGCCGC     98940
     CGAAAATTGC TAGAGTGGAG AGCGCAGCGA GCGACGGATA TAACACGACC GAAGCCCACG     99000
     TCATTGCCGC CCACATTCCG ACTCCCAATA GCTTCAGTGC GACGCTCACT ACTACTACCA     99060
     TCGGAGCGAT CTTCATCCAC AGGCCGATCG ATGCTGCAAC CCAGCGACGG GCGAATGATG     99120
     GTTTGATAGC GATGCTCATG AACGAATTTT CCGATGGTTA GGTATGTTGA CTCTACTATT     99180
     TACGGTCAGT TCTGGCAAAG CAGGACGGGC AGTATTGCCC CGCCCGGGTG CGATGGTTGC     99240
     GGACGCACCT TAAGATGCGC ATCATTGGGA GCCGGGATGT CATACGCGGT TCCGTCAACA     99300
     CAAACAGCGG GATTGCCTTT CTCGTCAACG CCCATATGCA CGGCTGCGCT CTCAGGTACA     99360
     GCGCCAGAGC TGCGCACGTA TTCGACCTTC ACTTGGGTTG CAGCGGACGC TTGCTGTGCT     99420
     TTAACGGTCT CTCGCGTCGC GTAAACGGTG GTCGCGGTGT ATACGACAGT CGCGACGGCA     99480
     AGTACCGTAG TCAAGGCGAT CATTGCCTTT TGCTGGCGGC CTTGAGCCTT GCCGTTCTGT     99540
     TTCGCTTGAT CGATGATTTG GTCGAGGCGA TGAGACAGTC CGTTCATCGC CTCATTCGTT     99600
     CGGTGCAGCA TGGTCCGCTG ATAGAGCTCA ACGAGTCCGG GCCTGCTTGG CTCTTCGGTC     99660
     AGCAATTTTT CAAGACTGAT TTGTTCCAAC GTTTCCTCCC AGAGGCGTTT CATGTTTTCC     99720
     GTTATTAACG CCGTGTACCT TCAATCGAAT ACAGCCGCGT CACTGAGCGC GGGATTTCGA     99780
     GTAGATCAAG GACACGCTCC TGCTGGACCG GGAGCACCAG TAATCGATGC ATAAACGGCC     99840
     CCTTGATTGG GGCGATATGT GCGAGCACCC GGGCTACGAG ATCGCGGTTC TGAAGTGGTT     99900
     CGTCGACGAT TACCACGTCA GCGCTCTCGA GATCGAACAT TGGATAGTGC CCGGGCAAGG     99960
     CCCCCTTGAC CTGCCCATCG AAGGCAACGT CCACCTTGGA GGAGATCAAG AGCGTATGGC    100020
     AGTCAATGTA CGCGACGCGC ATGGATCCGA TATCTCGAGC AGCCTCGGAC CATCGCTTCA    100080
     ATGACGTGGT CTTGCCAGTG CAGCATGGAC CGACGATGCA AAGGACCTTG ACCACCCCAA    100140
     GGCAATCAGC GATGAGATCT GACACGACTT CCGGGCTGAG AACGGCGTTG CTCATGTCCC    100200
     TTCCTTCTCC GATCAATCTT GCGATGGCAT CTTCACCAAC AGCGCGACAG TCCCGGGATC    100260
     CGCATCCTTC GCATCGACCA TCGTCGCTTT CCTATGTTTC CGTTAGCTCA GTGGGCGAAA    100320
     TGCCCGGCGA ACTCGATGGC AGCCGTGATC GCGACGTAGA AGCCGACCAG TCCGAATGCG    100380
     ACGACTCCTA TCCTCCGGTC CGGGCCGGCT TGAATCTGGA ACAGGTGAGT CAAGGCTGTT    100440
     CCTGTCTTTC GCCAACTGTC TGCGTAGGCC GCCCTCAAGG ACGTTTCCGA CGACCAGATG    100500
     AGCATCAACA TTTGGAGCGT GAGTATTAGC GTCACTGCTG CCTCAAGCGA CTGCACTATC    100560
     ATGAGAATTC CTCTTCTTTG ATGCCGGCGG ATGGACCGCT TCCGTGGCCG TTAGAACGAC    100620
     ATCTTGATAT CAGCAGGAAC GTGATACTGC TTACCGCAGC CATCGCATCC GTGAACCTTC    100680
     TCACGCGGGT CCGCGACCCA ACCGGCTTGT GATTCACCGC AATGTGGGCA ATCTATCGAG    100740
     ATCGACCAAA TGTGCAGAAC ATCAGCTTGG GCAATCTCGG CCACTTTAGC GCGCTTAGTC    100800
     GTCATCGCAA TGTCCTTCCT CTCACCGGAG GTCGTAGTCA CGTTCGAGGG TATTGTCCGC    100860
     CAAGCGGCAT TCGCGCATCG TTTGGAGCAT TACATGACCA TCCTTCACGT CTCGCGCGGC    100920
     TTGACGCAGT TCATCGAGCG TCGCGGTCGA CTGAAGGTCA ACTTCGATGT CGGGGAGACC    100980
     AGTCTTATCG GCGTGCATGG TCCAAGCCGT GAGCAGCCCC CATTTGGCAC ACGCTTGCTG    101040
     GAGGCGTTCC ACATCTGCCG AACATTCGGC GCGAAAAGAA AAATTCTTCA TGTGATTTCC    101100
     CGATGATCAG TCGTCGTTTG TCGCGAGCTG GGCCTTCCTT CTGATGGCAT ATGATAGGTG    101160
     CACATGTGCA CCACGTCAAC ACCTTGTCGG TCACGACTAG CGCTGGCGTA CAAGTGCACA    101220
     ACAAATTGCA GCATGCTAAA CCCCTTCCAA ATAACGGTAC CGCGCGTGGC TCCCTTTAAT    101280
     CCCATTCGCC GCCGAATGCG ACGGCATCAC CGTTTCGAGC TGTTCTGGCG TGGGGCGGGT    101340
     CTAGGCAGAG CGAAATGTGA TCGAGACGTG AATGGCCGAT GCGAATTTGA TGTAACCGGC    101400
     TCCGATGCCT TCGACATAGC ACTAGCTGGT CGCGTGGCTC CGGTGGCTAT CGGCGGCGAT    101460
     TGACACGACG CCTCGCTTGA CCGGAATGCA CCCATTAGGG CATGACCACG ACACTGCCGT    101520
     TTGGCACCTG CGATGGAATC GTCAACGATG CGGTGTCGGA CGGTAATGCC GATGGACTCA    101580
     CCAGTACGCC ATTCTGATTG ATGCCGGCCC CGTAGATGTC TCCGGATGTC GCGACTAGGT    101640
     ACGCCGGGAG CCCTTGTACC GGACCGTTAT AGTAGACGTA GGCCTTGCCG CCGTTCAGGT    101700
     AGGTGGCGAC GTAAGTGGGT CGGTTGTACC AGCTCGGTGA CCCGAGAGTC GCGTCGTTGG    101760
     CGTAACCCGA ATATCCCGGA TTCTGGCTCG CGTATAGCGC GGCGAAGCCG TGCAGCGCAA    101820
     GCATGCTTTG TCCGACCGTG ACGGTATCGG ATTGTGCGAC GGCTATCTTG CCGTCGTCGA    101880
     CCGAAGTGAG GCTGACCATC ATCTGGAAGA AGATGAAGAT CGCGACAAGC GGGATGAAGC    101940
     CGATCATGGA TCAGGGCTCC TCGTCGGTGA CGTGTAACAC GGCGAGCTTC TGGCTCAACA    102000
     ATTGCGGGCG CTGGCGCACT GCGTACGCCG ATGCGGCGGA GGGCAAGCTG GGGTCGCCAT    102060
     TGCCGAGGAT GTCGGTATCG ACCATGGCGG GGATGGTGGG CTCGCTTGGG CTCTTGGCAT    102120
     CGACCACGCT CTTGACGTAG CCGTTCGAGA ATCCCGAAGT GAAATTTCCG GTGTTGTAGG    102180
     CAGAGATTGC GGCGAGGATA GCGCGGTTAG GATCGGCAAT GGTTTTGCGC GCTTTGAGGT    102240
     AGAACTCGGT GAGGATCGTT GAGCCGGTTC GAAGATTGGT GCACGGATCG AGCACCTGCC    102300
     GAACGTTCAA GCCAAAGCGC TTCAGGTTTT CGCTACTAAC CTGCGACAGT CCGATGGCAA    102360
     CGATGTGGTT TGCTGCGATC AGGCGCGTCG CGATCTGCTC GGCTTCGTCG GCAGTTGCGG    102420
     GGAAGTACGA TCGAACCATC TTCTCGCGCA CGCCCTTCCA CGGCAGCCCC TTGGGTCCCG    102480
     CATCAGCCAA TGCGTATTGC CGTCCCCTCG ATTCCACCTT GACGATCTTT CCCATCGTGA    102540
     GCGGATGAAC GAGCGGCGCA CACACAGGGA GCATCGATTC CAGCGATTGC CCGGATGCCT    102600
     GAACCGACGC GCCAAGCGAA ATGGCCGCAA CCGTTACACC GACAATCGAC CGTCTCATTC    102660
     TAGACCCCCG AAAACAAGCT GGTTTCCACG GCGCCGCGCG GCAACGTGCG GCGCTCACGC    102720
     TCGTACCGCT CTCGTGTATA GACCGGGATG GCCTTGTTGA TGGGAGTCGG CCCTGATTCG    102780
     GTGACGTGGC AGAAGCCCAT CATCCGGGCG GCCGCAAACT CGTTGCGGTA TTCGTGCGGT    102840
     ATGAAGATGT CGACGCCGAT CGACGGAAAA GGCTGCTCGA AGATTGTGTG TTCGGCGGTA    102900
     ACAAGAATGA CCCCGTCGCC ATAGCCGACG AGCGCCATTT GCAATGGCAA ATGGGCAAGC    102960
     CAAGGCGCCT CTGATTCCTG CATCGTCAGC ATTGGGAAGT GCTCGCCGCG CACCATGCCG    103020
     AAGAGATGGA GCAGCGCGGA CGTCAGCCGC ACCCCGCTGA CAGGCGTCTC CATCTGCTTG    103080
     ATGGCGTCCT CGCCGAACGT ACTCGTCCAC TTGATGAAGT CAACCGTGGC AATGATTCGA    103140
     TCGGATACAA AAACAGATCT TTTTTCCGCT TCCATAGTGG CACAGATGCG CGATAACGAA    103200
     CAGGATTCTA CATTATTTTG CTAAACTCAT ACTGTTCATA TTGGATATCT GCATCGGATC    103260
     AGGAGCACAA ATGCCGGCCG AGGAATCGGA CAACATTGAG GCCGTGTCGC CCATGGGCAG    103320
     CGGAAAAGAA TCTTTCTCGT CGGTGGCGTC GGAGCGGATG ATCCCGCCGC GCGCAGCGGC    103380
     GTCGACAGCC GATATCGGCT GGAAGGGGCG AAAGGTGTGT TCAGTGATGA AGGTCGTGTC    103440
     AGCGCTCATG AGCGCAGTTG CGACGGCGCC GGGTGGCAAC GCGAGTGCCG AAGACATAGC    103500
     TGATGCGGCA ACGACTCTGC TCGAGAGAGC AACGCAGCTC GCTGATGCCG CCACGCCGCT    103560
     GCTGCGTGTC GATGAGGCGT CGCCGCAGTT TCCGGCACTG CGTAACGCCT TACGTGAGGG    103620
     GGCGGCCGAC ACGATCTCGA TGCAATGGCG GCTCGCACAT GCGACAGGAA TGCGCGAACT    103680
     GAGCGTCTCA CAGATCGCCG ACATCTACAG ATCCGTGAAA GAGGCCGACT TCCTTCCGAA    103740
     CGCGGATCTC GAGTATTCAG CGTCGCACGT CGTGGATCCC GTCGTTGCGC GACGACTCGC    103800
     GTTGTTCGGC GCTGCAACCG AAATCCACAA TGCTGTCTCG GCGTTTGGCT ACTTCCATCC    103860
     GCAGCCCGAC GAGCTGGTCG CTGTCGGGCT GTCCGCCGTT GTGTCCTGTT GTGATCGAGC    103920
     GATCGCCCGA ATCGTGTCGT CGCGAGAAGC ATCGGCGACG ACGCGCGCAG CAGTCGAGCA    103980
     GACGCTCATC GAACGTAGCG GGTTGCTATA CGCGCAGAAC TACCGCGCGA TCGCGAATCG    104040
     CGACATCAAG GACCTTTCAG TCCTCGATCC AGAAGAGCGC ATGTGCCGGA TCCGCGAGCA    104100
     TCGTGCGACC GGCATGCCGA CGGCGCATAT CGGCGATGGG TTCACGCGCT TGATGGACCG    104160
     GATGATCGAC ATGATCCTTG AGTCCGCACC GGAGCTCGCC GAGGCGGAAG TTCCCTCTTC    104220
     GGATGCGAAC AGTGTGTCGT TGCAAGAGAT CGGAGCGAAA GCATGAATCT TACCGTGATC    104280
     CCGTTTGGCC CCGAACTTGT CGCGCGTGCA CGGCAAGAGA AAATTGATCA GGAAGTCTAT    104340
     CAGAGCATTC CTGCGCTCAA CAGCCTCGCC AACGCATCGT TGGCGCTGTC GACGAAGCTG    104400
     ACGCTCGACG CGCGGAACGC GTTGTTTTAC GCAAATAGGG CCATCGACCC GAGTCTGCGC    104460
     CGCGTAGCCG TTGAGCTGGG CGTTGAGCGG CGCTTGTCCA TGGAAAGCGC GATGCCGGAT    104520
     CCCGAGTATC TCGCTGGTCA GGACAAGGCG ACGCGCCAGC AATACGAAAC CGCCGAGAAC    104580
     GATATCTGGC TGGCGCCTGA TGAACCGAAT GCCTGAAGGC AACTGCATAC GAGGGACTGT    104640
     TGAATGAAAG CAATGTTTGG GTACGACTCC GGCGAACTGA GTCGCGGCAA GAAGGTCCCG    104700
     GTTATGTGGG ACACCAAGCA GGTCGTGAAT CCGCACATGC TTATCGCCGG GATTTCCGGG    104760
     ATGGGTAAGA CGTACACGCT GAAAAAGATC ATTTCACACG TCGCGTCTAC GTTGTCACCG    104820
     GGCCAGAAGA TGCGTGTGCA CGTGATCGAT GTCCACGGCG ATATTGATAT TCCCGGCGCC    104880
     AGTACCGTGG TCTTCAGCGA GCAAAGTCCA TACGGGCTGG TGAATCCGCT GAAGATCAAT    104940
     CCCGATCCCC ATTTCGGTGG GCTGAGAAAG CAGATCCAAG GCTTTATCGC AACGATGAAT    105000
     CGAGTGATGC GCCAGCTTGG CAACAAGCAG GAGGCTTGCC TCCGAAACCT GCTGACCGAT    105060
     CTCTACATCA CTCACGGCTT TAAGCAGGAC GATCCCTCGA CTTGGATGAT CGATCCGGAG    105120
     AGCGCGCGAT TTCTGTCCGA TGGAAGCAAC CGTTTGTATA TCGACGTCCC CCGTGCCGAG    105180
     AAGGATCAGG CGAAGGCACT TGGTGCCCGG TGGGAGCCTA CGCTGACGTG CTGGTGGGTG    105240
     CAGCCTGACA AATACCAAGG TGGCATCACG CGCTGGCCGC CAAAGACGCT TGGCCGTACT    105300
     CAGCCGTCGA TCCGCGATGC GCTCGTGCTT GCCCGCAGAA TTCTTTCGCA GTCGTTCCTC    105360
     GGGGCCGACG AAGAAGCAAT CACCAACCTC GAGATTTTTC AACGCGCGTC CGATCAGTAT    105420
     CAAAGCTCGG TTTTGGAGGC GATGCGACGT GGCGAAAAGC TCGTCGAAGA TGAGGCGTTG    105480
     ATCGCCACGC TCGACAAGAA GAAACACGCG GCGATCGATA CGTTTACCCA ATACGTCGAG    105540
     TCGATCAAGA CGGGACGCGA GATCGAAACG CTGATGAAGT ACAGCAGTAC CGATGTGCTG    105600
     GCGTCGGTAG TGGATCGGCT GGAAAACCTC GACGCGATGG GGATGTTCAA GACCGAACCT    105660
     GCTCCGCACG ATGAGAATGT GATGGTGTGG CGTTACGTCA CGAATGCATT GCTGCTCGAC    105720
     GAGCGGCGCC TCGCCGGACT CTTCAAGATG GAAGAGATTT TCCTGAACGC CATCCAGCGG    105780
     GGTGAGCAGG ACGACGTGGT TGAGATCATC ATCGCGGACG AAGGACACAT CTACGCTGAC    105840
     GATGATCCCG AGAACATCAT GAACAAGATC GGTCTCGAGG CACGCAAGTT CGGTTTGTCG    105900
     CTGATTGTCG CGACACAGAG TCCGAAGCAT GTGCCGGACG GGTTCATGAT GTCGTGCGGG    105960
     ACGAAGGTGA TTCTCGGTCT CGACGAGAGC GAGTGGCGCT CGTCGGCAAC CAAGTTCCGG    106020
     GTCACCGAGC AGGCGCTCGC ATGGACGAAG GCGCGCGAGA AGATGCTCGT CCAGACGAAG    106080
     CAAAAGGGGC AATCGAAGAA CGACTGGAAA TGGACGGCGA TCGCGGACAC GATGCCGGAA    106140
     ATGGAAGCCG TGGCGCTCGA GGCGTGATGG AGCGGTCGTG CGCACGTGAA CCGCATGCGT    106200
     AGGCCGGCTC TTTGTTCCCG TCGGTCAGGT TGAAGGAGGC CTCATGGCAA GGATCGAGCA    106260
     AATCGATCGC AGTAAATCGG TGACGATTAC CGGACACAAG ACGGTTCAGC ACACGGATCA    106320
     ATTTCTGGTC GATCTCGCAA AGCACATGCA GCTGCCGCAG CTGTTGAATT GCGACGTGCC    106380
     TGTTGGATTG CCGAAGGTTA CTGATGCGGA ACTCGGAGCG AGCCTGCTGG ATCGCTTGTC    106440
     GGAGTCGAGA TGGCGCGCGC TTTTCGAAGC TGATCTTCAG TGCATCTGCG AGGACTCGGA    106500
     TGGCAACCCG TTACTGACGA CGTGGATGCC AATTGACGTC TTCTCACGAT TTGCCTCGAG    106560
     TCTCGACGAC ACGATGGTCC GAATCGAACT CGAGGCCACG ATCTCGGATT GGGAAGCGCT    106620
     GGGCGTTGAA ACGGTCTACA TCGATGCATA TCAACGGCCC TAGCAAAGCC GCGCACCATG    106680
     GCCACCGTTT CGTGGTTCAG GTTCACCGAC AGTACATCGC CGCGCTCTGC ATCTGACGTT    106740
     TGCGATTAAA ATTGCGCCGC GCTCCTCGAG ATCGGGGGCG AGTCGCAACC TTGCCGCTAG    106800
     TACGGCCGAC ACCAGAACAC CTAGATGCGT CACCTCGCGA TCGTGCCGGT CGCGGGCGAG    106860
     CGCCAAATTC GTAATGAACA CCGTAGACCA GAGAAGTGTC CTCGCCGCAG CGCAAGCAAG    106920
     CGGAATGAGG AAGCACGCCG ACGTCCGACC AGCGTCCGGC TATCGACCCG ATATCGACGC    106980
     GTTGCGGGCG CTTGCTGTGC TGAGCGTCGT TGTGTTTCAT GCGTTCCCCG GAATCCTTCC    107040
     CGGCGGCTTC GTCGGCGTCG ACATTTTCTT CGTGATTTCC GGGTATCTGA TCACGTCCCA    107100
     CATCCTGCGC GAGCTGGAGG TGGAGCAGTT CTCGATCGGT AACTTCTACA GTCGCCGGAT    107160
     CCGACGCATT TTTCCCGCAT TGCTGATCGT GCTCGTCGGC TCGTACCTGA TTGGCTGGTT    107220
     CAACCTGCTG CCGGCAGAGT TCAAGGAGTT GGGAAAGCAC GTCGCTGGCG GAGCTCTCTC    107280
     GGTCGCGAAC CTCGTGCTAT GGAAGGAAGC GGGCTATTTC GATGCGTCGG CCGATCACAA    107340
     GCCACTCTTG CATTTGTGGT CGCTGGGGGT GGAAGAGCAG TTCTATCTGT TTTGGCCGCT    107400
     GATCCTTTGG GCAGTCACGC GCGTGAAGCG CTCTCCGATG TGGGCGATCT CCGCCCTAGG    107460
     AATCCTGTCG TTCGTTTCCT GCGTGATCGT GGTCCGGTCG GATCCGACGA CCGCGTTCTA    107520
     CTGGCCGATT ACTCGAGCAT GGGAGCTGAT GGTCGGCAGC TTGTTGGCGT ACCGGGAGTT    107580
     CTCGCGCGAT CAGCGTGATG TGCACCATGC GGAAACGGGG GTCATTGCAG GCGTTGTGCT    107640
     CCTCGTCGCG TCGATCGTGT TGATGAATTC GCGCCTCACC TTTCCGGGAT GGTGGGCTCT    107700
     CGGGCCTACT GTCGGCGCCT ATCTTGTCAT TCGAGGCGGG CAGCAGTCGA GGCTGATGCG    107760
     TCGTATCTGC GTCCGCCCCG TTTTGCTGGC GGGACTGATC AGCTATCCGC TGTACCTCTT    107820
     CCACTGGCCG TTGCTGTCGT TCTTGCGGAT GATGTCGACC GGTGTGCCGG CGTGGTACAT    107880
     GCGAGCTGCT GCCGTGGCGG TCGCCATCCC GGCCGCGTGG GTCACCTACC GATTCATCGA    107940
     GCTTCCGATT CGTCGCTCGA GATGGCCGAG CTCGCTGGCT GTAACGCTCT TGGTCCTCGT    108000
     ACTGGGCGCA GGCTTCGCTG GCTACAACGC ATTTGATCGG AACGGTATGG AGTTCCGCAT    108060
     GGCTCATCTG ACGTCGCAGT TTGCCGACGG TAATTTCGAT CTCGATCACG AGTGGCGCAA    108120
     GGGGGCATGC TATCTCGAAT CGCCGGTCGA GACGTTCTCG CCCCAGTGTG TTGAGCAAGG    108180
     TGCCGCGCCA CTTGTATTTC TCTGGGGTGA TTCGCGCGCA GCAGCAATCT ACCCGGGTTT    108240
     TCGTGATCAA CGTGCGGCTT TCGGCGTCCG AGTGGCGGAA TACAGCGCAT CGGGGTGCCC    108300
     GCCGTTGCTG GGCGGCACGG ACCGCTGCGG TCGGATAAAT GAAGGGGCGC TCTCCGCCTT    108360
     GAAAGCCGCG AGGCCGCACA CGCTGGTGCT CACTGCAAAC TGGACTGAGG ATCGCCTTGC    108420
     TGGACTCGAC AGGACGGTCT CTGCTGCCCG TGAGGCGGGC GTGGCTAGAA TCGTATTACT    108480
     CGGGCAAGTC GCGACGTGGC AGAGCCCTCT ACCGACCCTA TATTGGGTGT ACTGGCGCGC    108540
     ACATCATCAG GAACTGCCGG CTCGCTCGAA CTACGCTGTA GACCCTCGCG CGACGCAGCT    108600
     CGATCGTGAA GGGGAGGAGA CTGCGAAGCG GCTTGGGATC GAGTACGTGT CGGCCTATCG    108660
     AGCTATGTGC GATGCAAATG GGTGCCTGAC GCGAACAGGT TCAGGCCGAG GCATGCTCAT    108720
     GTCGTTCGAC GATTCGCACC TAACGCCATC GGGTGCTCAC GTGGTAGTGC GGGCGCTCTC    108780
     GACTCAGCTT CTCCACTGAC CCTTTTTACG GTCGTGGCAG GCCCTTGACC GGATCACATC    108840
     TGTCGGCGAA TGCTGGATAT CTATACAGTA TTCGCCGATC ATGCCTTGTA AGTCACTCCC    108900
     CGAGATCTCC CCGCCTACGA CCAGACAATT GCGGGAGATG TGGCACCGAT ACCGAGCGGA    108960
     TGGCAAGGTG CGGATGCTCC TGCTTGAAAT CGTGCGCGCG CCGGCAGATG GCGCTTCCAG    109020
     CAGTACATCG GTCAAGCACG GAACGCGGAG ACGGTGGCCA GCCTTCACAT CCCGTTGTAC    109080
     CAACTCAGAC TTCAGCGAGA ACGCGGGAGA ACGGGAGAGA TGTAGGGAGG CGCGGAAAGA    109140
     GCCCCGAAAA ACTTGCGGTT TTGGGTTTCG CCAAAGTCTC TTGAAATTTG CTCAATTTTG    109200
     GTTAAACTCA AAACTACGCG ACATTTCTTT GAGTTTATTG TGAAAAAAGC CCTACATGCC    109260
     GACCTACTTC CCTTCGAGGC GGAAGAGGTT GTCACCTCGT TGGGGGAAAC CGTGACTCTC    109320
     GCCCGCCGGG CGCGGGAATG GACCCAAGCT GATCTGGCCT CAAAAATGGG GGCAAGTGTC    109380
     AACACGGTTG TCAACATCGA GAAGGGTAGA CCATCCGTGG CGTTCGGACA GGTCCTTAAC    109440
     GCGCTGTGGG CGCTCGACCT TTTAGGGGGA CTTCGCGAAA GCCTGCGCCC TGAAGACGTC    109500
     CCGGATATCA AACGGGCGGC AATGAGACGC TTCAAGCGCA GCTCGCGAGG TGCCCATGGC    109560
     TGAGCAAGAG CGACCAGTAT GGGTCTGGCT GCCCGGCTCA ATCACGCCCG TCGAATGCGG    109620
     GACCTTCACT TGGGAGCCGG GTGAAGGCAA GTTCTTGTAC TCGCAAGACT ATCTTGACCG    109680
     CAAGGACGCG GCCGTCGCGA TCGACCCCAT CAACCTGCCG TTCTCGAGGT CGAAAAAGCC    109740
     GGCAAGGACG ACCGCAATGA ATGGGGTTTT CGGGGTATTG CGCGACGCCG CGCCGGAGGG    109800
     CTTCGGCCTT GATCTGCTGA ATGCGAAGCA CGGGAATCGG ACGCTCGATG AGATCGAGCG    109860
     GATGGATCTC GCGGCCGGGG ATGGTGTTGG GGCGATTGAA GTCTGTCGCC CCGAAGAGAT    109920
     CGAAAAGAAA ATGTCTTTCC TGCCGCCTCG GGAGGAAGAA CTGCGAGATC GATTGGCAAG    109980
     GACGGACGTC GGTGAATCCA TTACGGGGCT CGTTCGGCAG TTGACCGGCG ATGACGATGG    110040
     CACCAGCCTC GGTGGCGAGA AGCCGAAGCT CACGGTCACA CGCGAGATCG GTGGCAAGAC    110100
     GGAGTGGTGG ATCGCGAAAT TGCAGCCGCG CAACGGCGCG CGGCTTCTAC CTGCTCGCGA    110160
     GTACGTCGCG ATGAAACTGG CGCAGCGCTG CGGTATTGAC GTAGCGGAGG TGACGTTCGA    110220
     GCGTGTTGGT GTCCACGAGG TTGTGATGGT GAAGCGCTTC GATCGGAAGG TCGTCGACGG    110280
     TGGCGTCGAG CGCACGTTGT TCGCGAGCGG GGCCACGGTG CTGCGATTGG ATAGTGATAC    110340
     GACTCGGGAA GATCCGGATC GGTCTTATCC GAAGCTTGCT CACGAATTGC GGAGATGGTC    110400
     CGGTGATCAT GAACATCGAG GCGCTGTGGA CCAGCAACGA GAGTTGTGGC GCCGAATGGT    110460
     GTACAACGCG CTGGTCGGCA ACTACGACGA CCATCCTCGC AACCACGGGT TGCTCTATCG    110520
     TGATGGTCGG TGGGTGCTGT CGCCTGCGTA CGATATTGTC GCGATTCCGC AAACTCCACT    110580
     TGTTCAAGCG ATGGCGGTAA ATAGACACAG TCGGTACGCG TCGCCGGAGA ACTTGGTTTC    110640
     GGATGCGCAG GTATTTGCAT ACGAACCCGT GCAGGCGTGG GAAACACTTC GCGAGATGGC    110700
     GGCTACCGTT CACTCGTCGT GGCGCCAGAT GTTTCACGAC GAGTGCAGTG TTAGCGAAGA    110760
     GGACGTTGAG ATTCTGCGAC CCGCTTTCAA GCTCGCAGAA GGCATCGTGA CAGGTGAGAT    110820
     GACGCTGGAT CCGGAGATCT TCAATCACAA GCGTAGACGT GGTGTTGCAC GAGCGCCCGG    110880
     GCATGCGCTA GAGCCGTAAG TGCATGATAG GATGATGAAG CGATGGGGCC GACGTCCCGT    110940
     AGGAGAACAA CATGTTTGGA ATGAACGCGA AAGACGCTCA AGGGGCGCTC GAAGATTTGA    111000
     CGATGCTCAA GTCTGCAGCG GCGGGGTCCA CCGTAGGCGC GGCTGATCTG TATCGTGCGG    111060
     GTGCTGCTTT GCAGAACGCA AAGCGTGCGA TCGCGGTCCG CACGGACAAG TTGAACGATG    111120
     TTGGTTCACG ACTGAAAGAC CTGACCGGTG AGTACAACGA TCTCCGCGCT ATTTCGAATG    111180
     CATCAAGAAA GGTGATCGAC GCGCTTGCCG AGGATCTTGC AAACGCGTTG GGGCTGGATG    111240
     TCGTCGACGT TCGCAAGCGG GCATACGGTG CAATGACAAA AGCCTATGAT GCGGAAGTGG    111300
     CCGAGATGCT GTCTACGGGA TATCTCGAGC AGGATCCGCG TCAGAATCCC CAAATCGCGG    111360
     CACGCAAAAG TCGTGACTGG TATACGCCGT CCGCTGACTC TCCCGCACTG TAGTCTGCGG    111420
     AGATTGCCGG CGCCGCAATG GCGCTGGCGA TTTAGGTGTC TTCCCCCGGC CACCACGTCT    111480
     TTGGTTTTCG ATCGACAAGA TAGTGGTCGG AATTCTTCCC CTGAAGCCAT TTAGGCATGG    111540
     GTCCCCGGCC GGACCAAGTT TTTCCGGACG ACGGGTCGTA GTATTTGGCG GCGGCTCGCG    111600
     CTGGCTTTCG CTTGGTGAAT CCAAGTGCCT CGAGCAGTTC CTCTTGTGAT ATCGCGTATA    111660
     GGTCGACTTG CAGCTTGAAT GCCACGAGCG CTGCATGTTT CTCCTCGCGC TTGGCGTTTG    111720
     CGATACGGAT GTTCAGCTCT CGGAGTTGAG CATTCAGATC TTTCAGTGAA TGGGTCACGA    111780
     TCGGTAAGCG TAGGTACACG AGGCTGAAAT GTTACAGGAC TCGCGACCTA CGCGACCCGG    111840
     ATCGCTCCCG GGCCGGACTG AACGACTACT CAATACGCAA CGGACCCGGC CCAGTTTCGG    111900
     TGGCAGGAGT GTCGAGCGCG GTTTGCATCA TGGAGTCGTC AGCCGCCGCA AAGGCGCGCC    111960
     GAGCGTCGTC GTCTCGCTGC TTCTGCCGGG CCTGCGACAA GTGTGCCTGT TTGGTCGCAG    112020
     CAGTGACCAT GGCGGTACGG GCTTGCGAGC TCGCACTACC CTCGATCTTG CCCATGGAGT    112080
     TCTGCTCACC CAGATCACCG ACGCCGGCAC CGATCCAGCG CAGGATTCGG TCCGGGAGCG    112140
     TCTGTGGAAG ACTGAAAACG AGCATGAACA CCGCGAAAAT GATCACGCAG TAGACCAGCA    112200
     TGAACGCGGC AATCGACAGT GGTCCTGTAA CGGTGTCCTG CTGGATGGCT TGAACGCGCG    112260
     CGAGGAACGC TGCGTTGATG TATGAGATCG ACGGATAGAG CACGGCGTTG CTCGCGACGA    112320
     GGCCGACGAC CATCAGCGCG GGTCGGAAGA AGCCCGACAT CACGAGCATA TAGCCCTGCA    112380
     TCTGGCTGCC GATGAAGCTG TTGTCCCGCG CGGGAGTTGT ATGCGCGGCG GCCCACAACA    112440
     CGCCAGCCGC CATCATCTCG ATGACGAAGA CCAGCCAGCC CACAACGCCG ATCGCAAACA    112500
     CGTAGAAGGG CACCATCGGG ATCCAGATCC CGAGGAAATA CCCCGCGTAC ATCAGCATGA    112560
     AGAGCGATGG CGAAACGAGG GCAAACATGT CGGTGAAGAA CACAGCAGCA GCTTTCGCCC    112620
     AGCCGGCCGC AATCGATGTG CCGGGGAGCA TCGAGCTCGC AGCGGCCGCG CCGAGGCCTT    112680
     CGAGCGCCGC ATGGACCGTC GTTTTCAAGA GGAAAACGCC TTCTGCGAAG GACGAAATCC    112740
     AGTCGCCGAG ACTCTTGACC TGCATGACCG GATCCTCGTT CGGATCGTCG AGGTAGCTGA    112800
     TCATGCCTGC GATGAGCGAT GTTCCGAGGT GACGGAACCA CTTGCCGAAC ATCGTCTTGG    112860
     CCGCGCTATC GCCGTCCGTG AAGTCGTTCA GAGTGAACGT GGTCTGCAGC GACGGGATTG    112920
     CCGGCGCGGA CGCGCTATTG TTGGTCGACG GCGTGCTCAG AGCCTTGTTC GTCAGCAACG    112980
     TTGCCAGATT CGTGATGCTC GACATGGTCG CGTTGGCCGC AGTGAGGACG GACCCGTTCG    113040
     GCAGCAGGTT TTCGAGCGTG TTGCTGCCGG CGGTGAAGTT GGCCTTCGAC GTCGTCGAGG    113100
     TTCGGACGGC ATCCTTGATG CGGCCCAGAT CGGTCCAGTA CGACGCCGCG AAGATCCAGC    113160
     CTTGGCTCGT CATGGTGCTG ACGAAGCTGC TGTTTTGACC GGCGATCGTT TGCTGCACGG    113220
     CCTGCTGGAC GACGCTAGCC AGCTGTTGCT TCTCGGCTGC GATCGCATTC GACAGGGCGG    113280
     TGGCACTGAG CTGGATATCG GTGGTGCTGA CCGCCGCGCT GACGATTTGC GAGACGGCGT    113340
     TCGGGACAAA CTGCTCAAAC ACGCTGGTGA AGAAATTGTT GCGCGCGTTC GCGATGTTCC    113400
     GGCGCAGCAT ATCCGCCGTC TGCGTGTTCG AGGACGTATT CGCGCTGGAC GGATTGCCGC    113460
     TGAAGATCGA GTTGAGTGCA TTGCTCACGA TCGGATAGCT GTCAGTCAGC GTCATCGTGC    113520
     CGCAGATGGC GCCGCTGCCC GCCCAGTTCG GATCCGCGTA CGTATAAGTG GTGATGTAGG    113580
     TCGTTTCGCC GAAGTGCTGT TCGGTCGTCT GGGCAGTCTG CAATTGCAAA CTGATGCGCG    113640
     AGTCGGGCAT GACAGACGCC ATCGCAGTGT TGACACCCTG CGCACATGAT CCCATCCGAA    113700
     TCGCGGCCGC AATGTTCGAC TCGAAGTTCG GATCCGATGT GATGCTGCTC ATCGCTGCAC    113760
     TGGTGATGCT TTGCGAGATG CTGTAGTTCG CAACCGCTGT CCAGATGTTC GAAGCAAACC    113820
     CGATCGACCA CGTGACCACG AGTAGCAGGA TGATCTGGAT GCCCGCAAAA CCGCTACTCG    113880
     TCGGCATCAG TACGGCTGCC GCAGAGAACG TCCGAATCGG CGTGTAGAAG GTCGACCACT    113940
     GTTTGCCGAG GACCTCGCCG TCGTTGGCCG AATTCGCGAT CCCGAAGATG GTGACCCACG    114000
     TCAGGATGAA GGTCCCGAAG ACGAGCACCC CCCCGTTGAA GTAGTGGAAG GCGACCCCCA    114060
     GCATCGTCGC CGCCGCGTTG CTTGCAGCGC TGGGCGATAG GCCGGACACG AGGTGCGTGA    114120
     TCACATCCCC GAAGATCATC TGCAGATATT TGACCGCTGC GTCGGTCGGG CTCGGGGTAA    114180
     ACGGGTTCGC CATCGCTGGG CTCCAACGAT ATAAAAAAAT ATATGAATTA GGATCCTAAT    114240
     AAGCTGACAT TTTACAAGAA AACCATAAAA CGCGTTATTT TTTTGCCGTT TCGAGGTCGC    114300
     TCGGTATAAT CGGTGCCAAT GCGCCGTGTG GCGCGTTTCA TTCGAGATTT GGGGAAATCA    114360
     ATGCAGCCTT CCGAACGCCA CGCCATCGCA GATCAACTCG TCGCTTCGCT CGCCGAGGCG    114420
     TCGCCGGAGT ACGGTCCCAA CGTGTTGGGT TCACTGATCG CGTCGCGAAT CGTGACGCTG    114480
     ATCGCGGCTG CGGACGCGCT CGTGCAGTCG ACGTCGCACC CGATCTTGCT GGCCGAGATC    114540
     ATCCCCGGCG TGGACGTAAT CGGCGTCCGG GACTACACCC GACCGCCTCG CGAAGACGCG    114600
     GATGCCGTGA GTCTCGAATC GATCTGGGAG CAGGGCGATT CCGGGTTCGA ATGGATGGCC    114660
     GCGCTCGGCA ACGTGGCAGT GCGATACCTG ACCTCTCGTG CTGCTGGGGC GACGGGGCCG    114720
     GGTGCGATCA GTCACAGCGG AGCGGACGGG ATCTACTACT TCGCATTCAA GGCGGAGTAC    114780
     CGGGGGATCG CGCTGGCGCA AATCGGTCTC ACCCAAGACG AAGTCCGAAT CGTTGATACC    114840
     GGTGCGCCGG TAGGAGCGTG ATCATGAACC CTTCCCTTTC CGCTGCGGAA TTCGCGCCGA    114900
     CGTCTGCTCC GGCGTACATC TCGTTCGCCG ACATGGGCGG GCTGATTCGC CAGCGACACC    114960
     TGTATGCCGA TTCGGCTCTG CAGGTCGACG GACGTCGCTT TGGCGCTGCG ACCGTCGGCG    115020
     CGATGCGCAT GGCACAAGCA GAGGAGGCGA TCAACAGGCT CGTCACGGCC GCGCGAGATC    115080
     GCGAGAAACC GAAGGGTCGC CCGCAAGCGA TTCGAGAGGC CTTGCGAGTC GCCAAGGACT    115140
     CGGACGATCC GCACGAGCTC CACTACCTGA CCAGCATGTT CATCAACGAA CCGACGGTCA    115200
     TCAAGGAACT CGCGAAAAAC CCTCATCTGC CGGAGAAATC GCAGCGAGTG ATCGCCAATG    115260
     ACGCGACGTT GGCGGCCAAC GTGCATGTGA TGCGCTCGCT GGCGTCGAAT CCGTCTCTGC    115320
     AACCGGAGTT GATGCGCGAT CTGCTGAATT CGTCGGAGGA TTCCATTGTG CGGTACGAGA    115380
     TCGCCCACAA CGCGGCGCTG AAGTCCCGTT TCGCGCCGGA TGCGGACAGC CCCTACGTTA    115440
     AACTGTGCGA TGAGCTCGCG GACACCACGT ACGACAACGC GTTGCGTCTC GCGGCCCTCC    115500
     CGGGCGTGCG GGACGCGGAT GTGCTGCGCA AGGTTGCGCG CACGCGCGAT GTCGTTTTCG    115560
     GTGCGAGGGA GCTGGAGGCA GTGGCCGACA ACATCCACAC CCCCGTCGAC GTTCTTGCCG    115620
     ATATGGCGAA CGTGCCGAAG TCGCGCAAGA TGCTGCATGC AGCATTCGGG GTGACCGTTG    115680
     CGCAAAAGGC GGCTCGAACG CTCGTCGAAC TGCGCCATCC GGAGGGGCCG GGTGCGGGAA    115740
     TGGAGGCGGC GCTCACCTGA CGAAAATGGG CTGATTAGCC CGAACACAAC CGAGATACCA    115800
     CATGTACTTT TCGACCTCGC AAACCGGCAA TCAAAACGTG GCGCCGCTCG TGAATCTGTC    115860
     GCTGCGCGAG TTTGGCGCGC ACCTGATCGA TGACGCATAC GCACATGTGC CGTTCGAATC    115920
     CGTGGTCGCG GCTATCGCGA AAGCAAAGCC GATTGCTCCC GAGCTCGCGG CCCGGGAACT    115980
     GGTGGCGCAC GCGCCCGACT ATCGAGCGAA GGCATTCCGA GTCGGGGTCG AAGAGATCGT    116040
     CCGTGCGTTC GGCAACGATG AGCGTGCGAT GCAGTTCTAC CGGAGCGTGG CTTCCGAGCG    116100
     CAGCCAACTG CGCTTCGAGA GCATTGGCGG TGTGTCGGAT GACCTCGTCA CGGTAAAGAC    116160
     GCGACTGGCA GCGCACGCGG CTAACGCGTA TTGGGCTCGA CAGCACGACG GCAGTGCAGG    116220
     CTTGATCCCG GCAGAGCGTG AATACGTCGA TCTGATGAAG TCCGTGCGCC AGTCGCTCGA    116280
     GGCGAGCCTC ACGAAGGGCA AGGTATCCGC CGATCTGGCC GAAACGGCTA TTGCCGAGAT    116340
     AGAGGCAGCC TCGGTCTCGG CTGGATTCTT CGGTATGGAA GAGGTTATCC GGCCGCTGCA    116400
     GGAAACCGCG CGGGACGAGA TCTATACCGA GCACATGGAG CGGGTGCTGC AACGCTACAC    116460
     CAACGCACCG GGCGCCGATG GCCCGGCACT GGAATGACGA GGAGCTGAAA TGACCGGTCC    116520
     GGCAGGCGCG ATTTCACTCG ACGTGAGCGA CGAGGTGGTC AATATTGCAG CGGCGCTCGA    116580
     TCGAGGACTG GTGGTCCGAC TCGTTGCGCC TCCGGATCGG GAGCATAAAT TCGGCGTGCT    116640
     GAGCCGCGCA TTGACATCGC AGGCAGATAC ATCGGCGTCG GCATGGTTCG TGGATGCGTA    116700
     CGGACGAAAG CACGAGAACA CCTTGCCGAT GCCGATTGCA CTCGGCCGTG TCGAATTTGA    116760
     GGCGCTGACG TCATGCCCTG ATGACGTCGC GCAGCTGAAG GCTCTTCATT CTGGCGAGAC    116820
     CCTGCGTACC ACCAACGCGA TACTTGAACA GGCGGAACGG AGGGTGATTC GATCCCTTGT    116880
     CGCGGCGGGT GGAAGCGAGA AGCTGTATCG AAAGGCGCTG ACGCTTGTGC AGAGCGCGGG    116940
     CGGCCTCGGC TATCCGAACG CACGCGAGCT CGGCATAGAT CGATGTGCGG TTCACCTGTC    117000
     TGAGGCTGGG CTCATTGCCG AGCGACGCGT AGCAGTCAAG GACGGGCATG GCGTCGTGCG    117060
     AGGTGCAAAG ATTCTTTTCG AGAAGCCGCA GCACCTGTCG GTGCTGGGTG ACTACCTCGC    117120
     ACTGAAAGAG GCGTCGCTGG GGAGCACGTC ATCGCTGAAT CGCCTCCTCA AGGCGCGAGG    117180
     ACTGGACGAG TCGATGCGGG TCGCAATTCG AGCGCTCGCC GACAGCGATC TGAAGGCACT    117240
     CTCCGCGCGA ATCGATGCGT TGTACGAAGA GCATACCGAT GCCGAGCTCG ATCGTATCCC    117300
     GAAGATCGCG CTCCTCTATG CAAAAGAGTT TGACGATCTG ATCGCAGAAA GCCCTTTCCG    117360
     TGATTCGCCT TTGCCTCAAA GAGACAGCGC GGACGAGATG ACCCCGGGCT AAGCTTCGGG    117420
     GCTCGATGAA CATCAATGTC CCACCGGCGA TAAGGAATCC TATTCGAACA AGTCGGACGA    117480
     ATTTCAGTAA TCAAAGATGG ATTTTCTCTA CGGTCGCGCA GTACTGCATC CCATTTTTCT    117540
     AGACGAGCTC CGCGCTTGCA GTGTGGAATT CGCCGAGTCG GAGCAATCGA TCGAGCAAAT    117600
     GCGGCTCGAG GATGGCGAGC GCATCATCAT CCACATCAAG TTTTCGTCTT CAAGCCATGC    117660
     GGCCGTCAGA GCGCTGGCCA GTCAATGCGG AAGTGCGCTT GAGATCGATG CAATACCTGT    117720
     CGAGATCGGC GCTACGAAAT TTGGTGAGAT GGCGAATTGC AGCGCAAAGA ATGTGGCAGC    117780
     ACTGACGTTC TTCCATGAGT ACAGCTTGAT CGCAAGCAAG GGCGCAGCGC AGAAGGACCT    117840
     TCACGCGCGC GCCCTCGAGC GACTATCCGC GAGCTGGACC CGATCTATTC GCCAGATGAC    117900
     GACGCTCGAT TGCACCGGCC CAGAAGATGG CCCCCTTGGA GACATGTAGG CGCCCGGCAT    117960
     ACGTAATCGA GCAACTCGAA TACAGCGGCG ATCGTGTTCT GCAACTAACG CTCAAGCCGC    118020
     CGCGCGTGCT TGATCGAAGT GATAGGCAAG GCCTGCTTGT CCATTCCGAG CTCCGATGCT    118080
     AAGCGCGAAG AAGTAGTGTG TAGACGCGTT CAAGTCGAGA GCTGGATTGC CGTTATCTAA    118140
     GACCGGTGTC TAGTGTGTGA CGTAAGGAGT AGATCGACTA TGCGAGCGTT CCTGCTTGGA    118200
     CTCGCGATCC TGATGGCGGA GCCCGCCGCG TGGGCTGACC AAATCGGCCG TGGGCCGCAA    118260
     ATTGGCTGGC AAGTGAAGCA GCCGATCCGT TTTGTCGTTT CGGGGATTCT CCGAAAAGAC    118320
     GGTTCGACGG ACGTCATTCG TCCGGTGCAC GCAATATTCG AGGCACCGAC CGACAAGGAT    118380
     GCCGTTCGTC AGTTCGAGGA CGAAGTTGGT CGGCGCTTTC GTGGCTATAC GCTGGTGGGT    118440
     GTGCTGGTCG ATCCGATTCC ACCGGTTGGC AGATGTGAAA ACGGGATCTA ATGCGCGAGT    118500
     GCGGGTTCTA GCGAAGCCGG GCTGGTCCCG CGATTGACGG GGGCGGAGTT ATAACTGAAT    118560
     CGAGACATCG ACCAAGTCAG CGGGTATGGT ATCGAAACAC CCCAAAGCTC TCTTTCTATT    118620
     TTTTATTTTT TCAATGCAGC CACCCAAAAT TGGGGCTCGT GGCTGACGCA TTTTCGTGAT    118680
     CATGAAACCC GGAGGGGAAG TGGTCCCGGT GGTTGACGTC TTTAAAAGAA AAAGAAAGAC    118740
     GGACAAGAGT CTTTCGGGGT GAGCGGGATC AAAGTTGGTT CGAATTCGCA CAGGGAATCG    118800
     CGGTGTTGCG ATTCATATGC GCGGTGACGC TGCACGTCGA GGGCGAGTTG ATGCAGGAGT    118860
     GCCCTACTGG AGGGGATGTT ACTGCATCGG CCGTCGCGCC CGAAAGGTCC GCGACAGGCC    118920
     GAGTGCAGAG CTCCGCATTA CGCCGGCTGT TCGATCAGGA AGCGATCGCG ATTCTTTGCA    118980
     GATGCAATCC ATGACGGAGC ACGGCCGAAT CCCGACCACG TTTCACCCGT CTTCGGATTC    119040
     CGATACTTGG GCGGGCGGGG AGCCTTCTCT TCGCCCGAAG CGGCTTTGGC CCGACCCTTC    119100
     CGCGTTGCTT TCGTAGTGCC TCCGACACCG AGGTCGTCGA CGGTGAGATT ATAGGTCGCC    119160
     ATCAGTTCGC GGATCTGATT GATGATGGCG GGCAACTCTT GTTCGCGAGC TGCTTCGGCC    119220
     TGTGCCGCGA TGTCTTTCAT TTGTTGACTC AGTTTGAGAT AGGTCGAGGT CATAGTTCGA    119280
     TGTCCGATAG GCAGTTTCGA ATTGCTCGCT GTCCGACTCG TTAGCGAGAT GTGAATCGAA    119340
     TGTTGCCACG CTTGAGGAAA AAAAGATATA TGGAAACGCG CGTCGAATGA TACATTTCAT    119400
     TGTTTCCGAT GTCATTTCGA CGAGTGACTT CGTTAGTCGG CAAGTTTAGG CGGTGATCGG    119460
     TAGTTCGGAA AGTGAGCCGA AAGTGCGCAA TAGTGAGGTG GCGGGAGCGA TGCGAGCGAA    119520
     AGCTTTGAAC ACTACCGACG AGTTGGCGAC AGCAAGCAAT CCGGACAAGG TTCGCGAGCT    119580
     GGGACAGTAT CCGACGCGGG TGTGGATTGC TGAAGCCATT GTTGAGCAGT TTTTCCCCGA    119640
     TCTGAGTAGC GAAGATTGCG TGATCGAGCC CGCGTGCGGG CCCGGGGCAT TCCTTGGGGC    119700
     TATTCCGCCA CAGGTACGCG CATTCGGCGT TGAACTGGAT GCCGCGATCG CGGAAGTCGC    119760
     CAGAAGGGAG ACAGGACGGC CCGTTATCGT CGGCGATTTC CGCAGTGTGC CGCTGGACTG    119820
     CCAGCCGACC GTCATACTCG GGAATCCACC TTTCAAGCTG AGTGTCATCG ATGGTTTCCT    119880
     CGATCGGGCT CACCAGATGC TGCCGGAGGG TGGGCGCGTA GGGTTTATTC TTCCGGCCTA    119940
     TGCATTCCAG ACTGCGGCTC GTGTTGCCGC ATACGCGGAT CAATGGTCGC TCGAACAACA    120000
     ATTCCTGCCA CGCAACATTT ACGACGGTCT GAGCTTGCCG CTCGTGTTTG CGCGCTTCTC    120060
     GAAAGATAGG AGGCGGACGC TGGTTGGCTT CGCCCTGTAC CGAGAGGTTG CAGACGTACA    120120
     GAAGCTCCGT GCGCCCTACC GGGAGGCTCT AGCGGCTGGG CATGGGCCCG TGTGGGCGCG    120180
     AGTGGTTGAG CGCGCACTCG CGCAGCTCGG CGGGGAAGCT GATTTGGCGC AGATCTATGC    120240
     AGAGATCGAA GGCAATCGTC CGACTCAGAC GCAATACTGG CGTGAGCAGG TGCGCAAGGT    120300
     GGTGCGCACG CACCGCTGGT TCACGTGCGT CAGTACTGGC CGGTATGCCT TGAATCAGGC    120360
     GACGGCTGCC GCCGCCTGAA TTCCTGACAG GTTACCGCCA GAATCGCGCG ATTGTGCGGG    120420
     CCGCCGATCG GTAACTCGAG TACTGCCGGT CGCTGCCGTG ATTCGGGGCC GTTTCGACGG    120480
     CGCTGGCGTC TGCATCCGCG AGTTCGTTCA GTGCGACGGG CTTGATCTCG ATGCGATCGT    120540
     GTCGTGGGCG CAGTAAAGGA CCGATCACTT GCTTCGTGGC TGCAGGAATA GCAGGGAACG    120600
     GGTCGATGCC GGCGAAAGCA ATGAATTCAT CGACCGACAG CATCGAATAC CCGGTGCCGG    120660
     GCGCATTGAG CGTCACGTAC ACGGCGGCGC CGCGATCCGG CGAGAAGACC GCCTTCCACA    120720
     TGTGCGTTGG GACGTAGAGG CCTGCGCCGA TTTGCTTCAA CGATGGACCG ATGAAGGCCG    120780
     GGCCGGTGAC GACGTATGCT TCGCCGTCGC GCTGAGCGAG CACGCGCGTA CCATGCTCGA    120840
     TCCACTCCCA CAGGTTTCCG TTATTCTGAT GCGACTGCGG CACCATGTTC GAAAGCAGGA    120900
     AGGTCTCATC CTGCGCTTCT GGGGATGGGG CATCCCCGGA TGGAGCGAGA TGCCCTCGAT    120960
     CGTAGCCCCG GCCGGAATAG TCGCTCAGCT CGGCTCGATC CCGTGAGGGT ATGGCGGGGT    121020
     CCGGACGGAA GTCGTCGAAC CTCGCAATGC CTCGCGCGGC CCGAACGCTA TCGCGTGTGA    121080
     GGTGCTCAGC CGACCAGATC CCGGTTTTGG TCAGCCCGGA CGCCTGCGCT GCGTAGGAGA    121140
     GATGGCAGGT ATCGTATGTG CGCGTCTGCA GGGCCGGTAT GTGCACATCC GGTGCCGCAC    121200
     CGCCGGCGAA GTGTTGAGGG CAGGTCGTCG GCGCCGCGTT AGCGTTTGCC GATGTGACGA    121260
     CGAATACCGC GAGAGCCACA CACACACATT GCGCGGCCCT CATTCGCCGG GCCTCGGCGT    121320
     ATCTTCTTCC CGCGCCTTGC CGGCGAACGC CTGATCAATG GCGTCCTTTC GCCGGATCTC    121380
     GTCGAGTGCG GCTTGCGCTG CCGCGCGCTC CGCCCCCGTC GCGTCTGCTG TCGTCGCGCC    121440
     GATCGCGTTG GCCCAGTCGT GCCAGCGCAG CTCCGCCTCG AGCTCGGAAG CCGTCATTTC    121500
     GTCGATAGGC TTGAACGCAC GAAGATGCAG GTCCGCCTCG AAATCGCCCT TAAACTCGGC    121560
     CAATCGCATC ATGGCTGCGT GCGTCGCTTC GGCCATGAAA GCACCGCAAG AGTGATCGTA    121620
     CGGTGCGAGC CGAAGACCGA AGGATTGCAG CAGGAGTTTT TCGTTCTCCG GCGCTCGCAC    121680
     AAGTCCGTAG TACCGACCAG CGAACTCGGT GTTCATTTTC TCCTCCGAGG GCTGCTTCAT    121740
     TCGCGTGCCA TCAGGCATGA CCACCTGATG GAACGTGAGC GGATACCTCA GGAACACCTT    121800
     GTCATTGACG CTGCGTGACC ACACTACGGA GTTCTGCACG TCGAAGTTCG ATCCGTCCTC    121860
     GAACGTCAGG CGCAGGTTCC CACGCAAAGA CGTCAGCTGA ATGCTGTAGC CGAGTACTTC    121920
     CACGGACGAG AGATTGTCCT TTGCGTCGAC GATCGAGGCG AGTTTCGAGA GGTTCTTGAA    121980
     CACGAACGTA TCGCGAATAT CCTTCGCCTC GCGCTCGGCA ATCTCGCCAA GGATTGCTTC    122040
     GTGGTTCGGA AGCAGGCGGG GCCGAACGTT ATTTGTGCCA TGCGGCATCG TTTCAAGGCA    122100
     ACGCGAGGTG ATGTGATAAG CCTCCGAGTT ACGCTCCTTG CCGCGAACGA AGAAATCGTA    122160
     GGGATGCTTG GGCGATTCGC AGGCGCCTTC AGACGTCATG TACTGATCGA TGAAGCCTTT    122220
     GTACTTTCTG AAAAAACCCT CGCGGAGCTC CTCGAACGAA TTCTTGGTGA TGGTTTCGAG    122280
     CGCTTCGCGC ACCTTCACAA TCGCACCAGT GGACGCTCGC GGAGGCGTGT AGCGCGGCTT    122340
     CTGATCCTCA ACGGCCTTGG TTGCGCGTTT GACGACCACC GTTTTCAGCT GCTCGGCGGC    122400
     GTCGCCCAGC GGCTTCACTT CCTGCAGGAA CTCGCGAATG CAGGTGGCCA GCGGATGGTC    122460
     GACCTTGAAT TTCGCCATAC GTTTTGTCCA GCTGCCGATC GTATGGAGCT GGGGAGCGGT    122520
     GCCCCAATAG AGCTCCTGCA CGGGCTCCGG AAGATCTGCA ATGGCCTTGA TGTGGCCGAA    122580
     CGCAGTCGAC CGGACGTGCT CGGAGTACGC ATCTCCGAGG ATGCGATTGA TGTTCTGCTT    122640
     GGCCTCGGTC CAGTGAGTGT TCGATATCTG ACCGACTTCG AGGCCGACGG ACAAGTGTCG    122700
     CAGGCTCTCC TCCAGACGAG ACAGCGCGCG CGGCGTCTTC AGGGATGCTA GTAGCGTAGG    122760
     GAAATCTTGC GGCTTCATGT CTTGCCTCGG TATGTTGTGC TCGCTTCGTC TAACGAACGC    122820
     ACTGAAGTCG ACGGATCTTG CACGATTCAA GCGTCGGAGT CACGGCTTGC GCTCGGTGTG    122880
     GACCCGCAGA ACCCAATTCA ACTAATGGGC GATCAGCGCA CTCGCCACGC ACATTTTGCA    122940
     CCAAAATAAA ATATGCGAAC CTATCGCGAA CTGCGGATTC AGCTTAAATG ACAATAAATT    123000
     TGTCACGATA TTAGCAGTAA TTTACCATTC GCGGAGCGTC GTGCGCTATC AAGGCATGGC    123060
     AATTCTCGGA CCTATAGAGA GGGCTCACCG TGAACACCCC GACCCATTCC GTTCAGCTTT    123120
     CCCACGAGGA GGTCGCCATG GCGCTGTCGT CGCTCGGGGA AGATCCGACT GCGAGTAGGA    123180
     TCCAAGCAGT TCAGTGTGCA ATTGGCGCCA TGGAAATTCC GGACGGTGCA CGAGATGAAG    123240
     CCGTGAAAGC CGCAGTCATC GCTGCGAGCG TGAAGCTGGC AGCAAGCGAT CAGCGAATGA    123300
     GCCCGATCGA CCGTGCTTTC GATCAGGCCG AAGAGGCCCT CCGATCCGCG CAGCAGCAGC    123360
     ACACCGGCAG CTACTGGAAC GCGGCCGTGT TGCGAGTGCG CGGGTCGTTC ATAGGATGGC    123420
     TTCGCGCGGA GGTGTCACGG GCGACCGGGG AGATACAGCT GAGTGAATTT CTGTCGGAGG    123480
     GAGACCCTGA CGATACGCCG GACGATGAGC GCGAAGTACG CGACCGGGAA ACGGAAGGTA    123540
     TCCATAGCTG TAGTCGCCTG ATTGACGAAC TCGCGGCAGC GGGCGTCCGT ATCGTTGACC    123600
     TGAATGGAGA ACTGCGCGGC GGTATTGACT GCAACGCTGC GACTCACGTG ACCGACGCTG    123660
     ATGAAACGGT CGCTCGCGAT TTCACACCAT AAGTTTTCCT GAGAAGCGCT TCTCCATCGA    123720
     AGCGTGGTCA CGTAGGTATG CAACAAGATT AGGATTACAT AGGTTTGAGA AAATACGGAG    123780
     CTTGAGCGAT GTTGGATAAA AATAATCCGG TTCTGATGCA GGGCGATTGT CTTGAGCTGC    123840
     TGGAGACGAT TCCAGACAAT TCCATCGACA TGGTGTGTTG CGACATGCCG TACGGAACAA    123900
     CCAACTGCCG TTGGGATGCG ACGCTTGATC TACGCCGTCT GTGGGCGCAG TACCGCCGTG    123960
     TAACGACAGA GAACGCTGCA ATTGTGCTCT TCGCGCAAAC CCCATTCGAC AAAGTGCTCG    124020
     GTGTGAGCAA TCTCGAATGG TTGCGGTACG AACTCATCTG GCAAAAGACG CACGCGACGG    124080
     GGCATCTAAA CGCCAAGAAG ATGCCGATGA AGGCACATGA GAACATTCTT GTTTTCTACA    124140
     ACAAGCTGCC AACCTACAAC CCCCAAAAAA CGACCGGCCA CATTAGAAAA ACGTCCGTGA    124200
     AACGCCGCGA CAACACCTCG GTGTATGGGG AGCAGAATTT CGTTGAACTA TCTTACGAAT    124260
     CGACGGACCG GCATCCGCGT AGCGTGCTGA CGTTTCCGAA AGATACACAG CGCATAGCAC    124320
     TACACCCGAC GCAGAAACCT CTGGCCCTCA TCGAATGGTT GGTTTCCACC TTCACGAATG    124380
     AAGGTGACGC GGTCCTCGAC AACTGCATGG GAAGCGGAAC TACCGGAGAG GCTTGCCAAA    124440
     GATTGGGGAG GCGGTTTGTC GGGATGGAGC TGGATGAGTC GCACTTCGCC GTCGCCAGTT    124500
     CGAGAATCCT GTCGGGTGGC GTCCCGGCAT TACGCAATGC AGCCTAGCCG AAGCGGTCCC    124560
     AAAGAACCTT TTCAATAACT GACATGAAAT CTACTGCAAT CACCTTGCTT ACGCGCGACG    124620
     AAGTCGCGAT GGCCCTTGCT GCGCTCGGAG AGGACCCGAC GTTAGGCCGT ACTGATGCGG    124680
     TTCGCTCACT GATCGTTCGC ACATCGTTGT CAGGGGGCGA CCGTGAAAAA TTGATCCGTC    124740
     AAGCGGCTGA CGTCGCTAGG CGAAAGCTCG ATCGGCTTCT CTCCGGCGAC AGTGTTTTTC    124800
     CTGCGGATGT ATTCGTGCGC GAAGCGCAGG TTGAAGCGCG ATTGCGTGAA CACGGATGGC    124860
     GGAGCAGCAG GATGGGCGGC CCGGCAGACG ATCGCGGCAA CTATGTCGCC AAGACGGGGA    124920
     ACAATGCCGG TTCCTTCATC GGACTCTTCA GTAGTGGCAA TCACAACGGT GCCGAGAAAC    124980
     TCTATCCGAT CGCCATGACG GACGAGGAGA TTGCCGGCGC CATCATCGAA CATGTCCGTC    125040
     AAGTCGAGCT GAGCCGTTCT GCGAGCGGGC GTCTCCTCGC CACGGTGGTT GAGTTCGTGA    125100
     ATCAGCATCC GGAGTGGTGG GCGGAACAAG GCCAAAAGCA TGGGTTCGCC CTCGTTCCGT    125160
     GGATCGTCGA CGCGCGCTCG GCCGATAGTT ATTCGAAGGC GACGCACTCG TTGCGGGAAT    125220
     GGGTGCGGCT GATCGACGCT GGTCACCTCG ACTGGCATGC CGGAGACGAT TGGGAGGGGG    125280
     CTACGCTCGA GCAGGCTCGC GATGAGCTGG TTCGACTCGA CCGCATCCAC TCGGAGGTGG    125340
     CATTCGTTAT CGGTGCGATG CCGCGTGACC AGCTTGAAGA AATCGCGGCT GACAATCAAG    125400
     TCGACTTCGA CAAACACGCT ACCGACAGCG AGCTGCGCGC GGAGCTCATC GAGGTCGTGG    125460
     CGCAACGTCG ATCGCATGAG CAAGTGCGCG ACGGAGCGGC GCCCACGCAA GTGAACGGGG    125520
     CGGGTGAGCC ACCGGCTGTC GACATGGCAG AGCGAATCGT CGTACCGATC GCCGTCGAAG    125580
     GTCGCGTCAA GATCGCACTC AATACCTTAC GACGACACGA ATTGAGTCTC CAGAACGTGC    125640
     TCGCAGTGCG CGGCGCCGGA CATTTTCTCG CGCTTACGCT GCGCGAAAGT TACGAAGCGA    125700
     TTCAGCAGGC GCGAGGGACA CTCAAAGAGT TTCGACGATT GGCGCCTCAG AACAATGTCG    125760
     ATGCCGAGGC GTTCATTAAA CAGTGCGGCG GTGAGCCTGA CTTTTCAGTC TTCGGCGAGC    125820
     CGGCTTTGCC TGTGGGATGG ACCGAAGCGA CTCCGGGTGG ATTGGCGACG AATCGAGATC    125880
     CCGACGTCGG CGGGATAGTT GACAGCGAAA TCGGTAGCGG GCTGTGGTTC GCGATCGCGA    125940
     ATCGCGACGG GATTCCGACG CTGGATGGAT ATGGCACGCG GCAGGCCGCA TTTGACGCCT    126000
     TGCACGAGGC GATAAACGAA GCGACGCGCG TTCAGCGCGC GGGGGCTATG CCGAGTCCGA    126060
     GCTCGGGCGA CTTGGCGGCG AAATATCCCG CGCGCGGCAG TATGCCGGCA CGCGTCGTCG    126120
     AGCAGCTGTA TATCACGCGC GAGGCTGAAT ACGCGCTACT CGCTAAGCGA GAGCGGATCG    126180
     ATGTCAGCGA TCTGGCGAGT CTCGATCGCG GCGCTCGGTT CATGGTGGCG GACGGGTTGT    126240
     TTGACAAGTG CAGCGGCGAT GCAAGAGCAG CGCTGCTCAC GGATGCCAGC CACGGGGTGC    126300
     GTAGTACGGC GCGCCTAGCA GGACTCGAGC TCGGAAGCAT CGAGCATGCT CCGGCATCAG    126360
     ATACGGGTCC GAGCATCTAA GCCGGAGTGG CGCCCGTGTC GATGGTGCTA CGTGAACCAC    126420
     ACTAGGAGCA TACAAAAGTG ATGAACGAAA AAGATTCCGG GACTCCCGAT CACTTTGGGG    126480
     ACCTTGCCGA AGCGTTAGGC GTTCCCGTTC ACGAAGGGGC CGCGCCGGTC GACCCCGCTC    126540
     CGAGTCCGTG ACAACTGCCG GCTCAGCTGA ACATCCACAA ACTACGCATC CAGAGCATAA    126600
     TTATGATCAC CACCACACCA TTCAATCCGA TCACTGGGGA AGAAGTGCTG ATCGCGCTGT    126660
     CGTCGCTCGG TGAGGATCCG GACGCAAGCC GCGTCGAGCG CATTCGCTCA AAGATCGATC    126720
     CGATGCAAGT TCACTCTGGC GATCGCGACG AATTTGTCCG GCATGCTGTT GCCGAAGCCC    126780
     GGCAGTTGGT CGACAACGAA AAGGGTTTTG AAGTCGGCGG GGTGAAGTTC TCGGCGGTGC    126840
     GCACGATGAC GCCGCGACCG CACTGGCGTT TGAAAGTCTT GGAGAGTGGC GAGATATACG    126900
     AAGGGGGGAC GGCCGGTATC TCGAACGTCA GTGTTCCGAA GATGCAGGCC GACGTGGAAG    126960
     AGCTGTTTCG GCGCGCGTCG AACAGCGATC CGATTCAGTT CCGGGCCCAC CTCAATCTTG    127020
     CGGAGGCCGG TGCGAGTGCA GATGCGGTCG CATTGGCGGG TGCGTTTCAA GCGCTGTATT    127080
     ACACCGGCAA ACGGCTACCG AATTGTGCCG ATGATCTCGA TGTTCGATGG GGGGCGGACG    127140
     CAGTAGAGGC TATCAAGCGT CACGAATCGG GTGGGGCCGC GCGAGACGCG GGCTCCAGTA    127200
     GCGTCGAAGA GGCGGCCTTG GCGGATGCAT TGGGCAAGAT TCGGAAATCA GTGATCGACG    127260
     GCGCACCGTA CACGAGTAGC GGTTTGCGTG GCGCCGAGTT CAAGCATGCG CGGGCGGCGG    127320
     CCATGCGGTT TGCTCCGAAC TGGAAAGTAT GCGTCGCGTC CTACGAGGGG CGGCAAGCGC    127380
     TGTTGGAGGC AGGGGGCAGC GTCGCGGCGT CGGAAACGAT CGCTGACGGC GCAGCTCCGC    127440
     CCCGACCCGA CGACAAGCGA GAACGCGCGC AAGACGAATT CGAGGCGTAC GACTTCGGCG    127500
     CCGGAGTTAT GGTGCATGAC CATGATCTGT GGGATATGAA CGACGCTACG GATTTCACGA    127560
     AGCTCGTCTA CCTCGGTTAC CCGGAGGACA ATCCCGACAG CGAGCTGCAC AAAGTGACTT    127620
     TCCACGTGGG GTTCCGGCCG GACGCTTCAA TCGATCAAGT GTATGCGCTG GAGGTGCAGT    127680
     CGGGCAACCT GATCGGTCAG CGGCCCGCCA TCGAGCCGAT CGGTGCACCT TCAGTGGCAC    127740
     GCGACGCCAT CGGCAATCTC ATCGGGAGAT TCAGTGCGAC GTCGGCAGAA GAAAGGGCAA    127800
     CGATCGACCA CGCGCTCACG GTGTATGGCT TCCTGATTGC TCGCAACGAG CACATCACGC    127860
     TTTCTCAATT CGCCGACCGT ATCGCGGCTT CGTACGATAC TTCGGTGCCC CAGAATGCCG    127920
     CAGTCGTCGC CGCGCTGCGA GACTGCGCGG CACGCCCTGT CATGGACAAC AGCAAGAAAG    127980
     CAGCGGATCA AGCCCACATG CATGACCTCG ACAGTCCGTC GATGGATTGA TGACTGCGGT    128040
     TGGAAAGTTT GAAGCCGGGG TATTCGGCCC GCCGTTGCGC TGCAGCGGCG GGCTTTTTCG    128100
     TTCTGGCTTG CCGGGCTGCT AAATAATCGT GGCGCGCCAC AATAAATGCT GCTAGAGTCA    128160
     AGTCGTTCTT GAGACGAGGC CGTGGGGCAT AGCGACTTCG CTTCGAAGTG GGCGAATGGC    128220
     GTGGCGCAGC TGATGCGGCG ATGACTTCTC GAGATCGGGC CACAGCTGCG GCCCTTTTCA    128280
     CACACGGAAG AAGCAATGAG CAATGTGAAA CCTGCATGCG TACAGAAGGC GAGCACCGCG    128340
     ACGGCAGGTG GCGCAGAGAA ATCGCAGAAG CGTGGACGTC CTGCAACCGG TGTAGCGATG    128400
     ACGGGCTCCG AGCGTGCAGA GAAGCGTGAG AAGGAGCTGC GCGCGGCGGG TGGTCGAACC    128460
     TTGAATCGGG TGCGTCTTGG CCCTGAAGCT TCGAGTGCGC TCAACGAAAT CGCGCCGAGC    128520
     TATAAATCGG AACGAGAAGC CATAGAAGCG GCGATCATCG GTTGGGCTCG AATGGGGAGC    128580
     CGTTCATCGC GCCGTGATGC ATGAAGCGGC GTCTTGTCAG AAGCCGTGCG GGTCCGGGGC    128640
     GGTTGCCGGT GCGTCGGGCA TGCCGGGTTT GGGCAGCAAG CGGTAGAGTG TCATCGCGTC    128700
     GAATCTCGGC TCGCAGGCCG GAAACCACGA CTTGCCCTCG GCGCTACATT CGACGGGGTA    128760
     GCCGCTCTGC GGTATGACTC ATGCCGGTCA TGCTCGCCAG AGCGAGCAGA AGCATCTTTT    128820
     TTTTCACTTC GTTTCCCTTG GGTTAAAAGG AAAAATTCCT CATATTTTCT AGGCGTTCGA    128880
     GTCAGTGAAT ACTCGATCCC AAAATTGCCG GGCCCGAGCG TTCGTCAAGA TCGTCAGCCA    128940
     CGCAAGTGCG CCTGCCGTGT CCGCAACTGG CACCGGCAAG TCGATGGGGT CAAGCAGACC    129000
     AAAACCACGC ACCACACCCC CTATCAAAAG CGCAAACGTA GCGAGACACG TGTTAGCCGC    129060
     GAACTTTCGA GTAACTGCGC TCATAGCCTT GTTTTCCAAT TTTCCGTGGT CAGGCACTCG    129120
     ACCCGTTTAA CGGCTTGGCC TCCACGTCCA CATCGGTACG CAACCCGATG ATCGCTTCGG    129180
     CATATCGGCA CAGAGTGACG ACAAAGGAAA ACCCGCTTAT TGTCGCGAGC CCGACGACCA    129240
     CCAATAAGCC GACACCCTGA CCGAATCTGA TCGCCATGAG CGACCAAAGG ACGAATAATG    129300
     CAAAATAGGT CGCGGCGTGA TACTTCAAAT TCATTGGTCC CTCACGTTTT CCGATCACTC    129360
     AAGTTGGGCC GCAAATTCAT CCCAAGCCTC GCGGAACGCC GCGACTGCGC CGCTGCTCGC    129420
     GTTTGACGCT CGGAGGTAGC CAAGCCATCC CGTCTTCGAG ACTCGCCCGC TCGGGGCGTT    129480
     GCCATCACGT CTCACATCGC GCGCCAGATC GCCAACCGGG TCATCTCGCT TTGCCTGCTG    129540
     CTTGATCCAC GTGAGGAAAG AGCGGGCTGG TTTCGTCGAC GACGTGGACT CCACGACCTC    129600
     CGCAGTCACC GACGCAATGT AAAGCAGCTC CCCGCTCTCA AGTTCGTGGC TGTTCGACAC    129660
     CACGTTGCGA ATGATCGAAA GCACTTCATC GTCATCCGCA ATCGTATCCA GATCACCCAA    129720
     ATCAAGCAGA ATTTTCATGT CGTATTATCC GTTGCGTGCG AGTCTCAGCG GCGGATGCCG    129780
     CCTTTGATGA TCGTTGTTTT CCTGCTCAGA GCGGTTGCTG CAGCACGGCC GCGCGATACT    129840
     GCGAGCGCAG CAGCAGATCC GGAACCGGAG AGAGCACCTC GGACATGAAC TGCAGCTCAA    129900
     CGCACGCACC GCTACCATGC TTTGCTACGG CACGATGAAA CGCCGCGCGC GCTGCATCAA    129960
     GCTGCGTCTT ATCCTTGGCC GCAACGGCGC GGATCGCAGT GCGTTCGGCA TCGGTCAGAA    130020
     TATCGCTCAT GAGATTGTTT TCGATCTGTT CAACTATGGC GGCGCACCAT CTGCGTCCAC    130080
     GCTTCGATAA CTACGCTGAT TCCGAAAGCC GCGACGAAGC CGAACGCAAC CAGTTCCAAT    130140
     AACAGCATCA GTTGCGCGGC AGAGGGCATC GCGAACAAGG GCATGCCCCA ACCCATGATG    130200
     ATCGTGACAA GTAAGGTCCA CGCCACGAAA AACCACCAAC CGATTTTCTT CGCCTCTGAC    130260
     CAATGCTTCA TGTTTCTTTT TCCGTTGTCA GTTGACCGCT TCGCTGCTCG GGAACAGCAC    130320
     GTCGAAGCCC GGTACCGGAA TCACACGACC ATCATTCAGG CATGCGGCTG CGGCGACAAG    130380
     ATGCTCGGAC GCAGCGCGCT GCGGGTGCGG CTTCCAGCCG AGGTGATCGA GCGCGGCGTT    130440
     GGCTTCTTCC GCAAACACGG CCGCTGCTTC TTCCGGTGTA ATTCCAAGTG ACTTGATTTG    130500
     CGCGTTCACC AGCTCGACCA GCGCCTTTCG AAAAGCTTCT TTCCGTTCAA TGTTGGGCAC    130560
     GCTGTTTTCC TATTTCGAAT CGGCGAGCGG GTAAAGCCGT GGACCGCCTT TGGGCGGCTG    130620
     ATAACCCTTC TCGCCCGCAG CCATAACGAG CTTGAAGCAC TCCGGACCGA TAAAAACGAT    130680
     CTGGCTGTCC CGCGTATCGA CCTGATATGG CGCCTTGCGA CGAATCACAC GATCGCAGGC    130740
     GAAGCACCTC AACTTGGCCA CGGTCATCGT CTTTTCCGAC CCGTCTCAAT CGATCTTGAT    130800
     CACTTCGAGG TCATACTTCG CCATCCAATC GGCCCCAGCG CCCCCATCGC TCGTCACGAC    130860
     GCCATTGTCG AGTTGGTTGC GAATCTGCTC CTCGAACTCT TCGAGCGAGT CACATTCCAT    130920
     CGCTTCAAGG TCTGCATCCG AAACTTCAAT CCTAATTATC ATTCTTCGTC CTTTCTATGA    130980
     TCGCTCCGCG CTCGCGGTGT TTCCCTGCTC TGTCCTACAG CTTGAAAAAG GCCCGGACTT    131040
     GACGGCAGCC ATCCGAGCCC GGCATAAACT CCCGGCACAC GGCCGGACGA TGCTCATAGA    131100
     TCAAGCACGA AACCTGCTCG CCGATTTTGC CGATCAGCGC GACGCAGCGA TCGCCGTCGC    131160
     ACTTCATCCG GCCGGTCTCA CAATCGCACA TCTCCTCGGG AATGCCGTCG CACGTGTCCT    131220
     CTTCGAGGAA CTCGGGCCAC GTGTGCGAGT ATGCACAGCA GCCACCGCAG GATTGGCAAT    131280
     CTAAGGACTG CATGTTTTCC TATCGCACTG TGCCGTTCTT GCAGTGACTG CACCACATCC    131340
     CTTTGCTCGC GCTGGACAGC GCCGGGCGTC CGCAATGCGC GCAGCGGATC GTGATCGCTC    131400
     CGAGGTTCAT CATGTTTTAC ATCCTTATTC GTCGTCGCCA TCCGGCGAGC CAAAAAGCGC    131460
     GCCCTTGATT GCAGCCGTGA ATGCGCAGGC CGTGCAGGTA TGGTGATAGC CCGGAACACC    131520
     CGTCGGCCAC ACGCTACCGT TGAACTTCAT GACGCCCTCG CAGCCGGTCG TCGGGCAATG    131580
     CCAAACGACC TCACGATCAA CGATGCCAAC GGACGGAACG CCTTCAAACC ATCGCGACCC    131640
     CCCAATGGTT TCGCCATGCC GAGGCCATTC CTTGAGCGCG TCCGACGCTT TCGTCGTTGC    131700
     GCCACTTACG ACCTGCTGTA CGGCTCGATT CGCCTTGTCC ATCATCGCGT TTTCCGAGTC    131760
     ATAGTCGCGT GGCCCTTGCC GCCCGAGTCG AGCGGCAAGG GTAAGCGCGC TTGGTCCAAT    131820
     TGAGGCGCGC GTCAGGGCTT CTTGGGGGCC AGTTCTTTGC CGGTCAAATC GCCCTCGTAA    131880
     CACACGCCCG TAAGAAACCG TTGGAGGCTT CGTTCGTCGG CCGAATGCAG ATATCCCGCC    131940
     TTGATCGCGT CCGAAGCGAG AAGTGAGAGC TTGATATCGA GGACGGGCGG GCGTTCATAT    132000
     GTTTCGTTCA CGATTGCTTC GACCGGCCGC TTTTGGTCGA CAGCCTTCTT CGCCATGAGG    132060
     ACTGCACCCA CGCTGTGCGC GTCACACGCA GTGTAGTTCG CCGCGTTGAA GCTGGTCATA    132120
     GGGTCGGCGT TGGCGAGACC AGCGAACGCG AGCATTGCTG CAAATACGAG GGTTTTCTTC    132180
     ATTTTCGTGC TTGATCATTT CCGGCTGCCG GCCGTGCGGG ACGCTCGCGC GTCGAGTGTT    132240
     TTCCTAGACC TTGAAGATCG GTAGCGCCAC AATGAAACGC AGCGTTGCCT CACGAAGCAC    132300
     AGCGGCCTCT GCCTGAGCCA ACGAACTCAG ATCATCAATC CCAGTCTCCG CCTCCAATCG    132360
     CGCTACCAGC TTCCGCAGTT CCCCGTCCGG TAGGGTCCCC GTGTCCTTCC ATCCCAATGC    132420
     TTCCTGTGCG CATGCCGCCA GCGTCCTGTC GGGCAGATAT TTGACGATGG AGCGCACGCT    132480
     CACAAATTTT CCCGATTCAT CCACGTGAGG TATTTCCTTG CCCCGTTTTC CAGTGTCGCG    132540
     CCTTGCGGCG AATTTCCTCT AGCCTTCCAG CGCTGTTCCA CAAGCGGGGC ACTTCCCCGT    132600
     CGTGACTAGC GGTGTCCATT CGTTGCCGCA GTGCGCGCAC TTGCGACGCT GCGTGTTGAT    132660
     CGCGTATCCC TGCTGTTGAA GCGTTGGCGC TTTGGTGAAT TTGCCGCCGC TGCGATGCAG    132720
     CTCACGCCGA TTCCGGTATT TCTCCATCGC GCCTTTCTCC GGTCCTTTAG CTGGTCATCC    132780
     GCTTCGAAGC CGTCACGAGG CTCGCACTTG AGAGAGCGAG GCTGATTCCC ATGATAGCGA    132840
     CCGGTCCAAT GGAGTGCGTA GGACTCGCGA TCGCCAAGCC AGACACGAAT CCAAGGCCCA    132900
     CCAACGAGAA CGCGAACCCA TACAAACTAA AGAGCGGCAC CGTAATTTTG GACTTCACTT    132960
     TTCCCCCTTT GTGTCTCGAT CCACCAACAC TGTTTTCCTA CTCGATTATC GTTTGCAGCC    133020
     GAGCCAGCGC ATCTTCGACC ACCTCGGCCG GAGCCCGCTC GATCTTGCGT GCACCCCGCG    133080
     CGTCCAGATC GAGCATCCGG ACCATGTTCA CCAAGGCCAC GCCCTGCGTC TCGGTGCCCG    133140
     AGCCTGAGAG CGGCACGGCG AATCCTGCGA AGCGCGCACA CTCCCCACCC TGTGTGATCG    133200
     GCGCAACGAG CGCCACCCCC AACGCATTGA ATGCGGCGGG AGACAGCACG AGCGCAGGAC    133260
     GGAAATCGCC CTGCTGCTCG CGGCCGATGG TCGGGTTCAG GCTCACGCGC ACAATGTCGC    133320
     CCCGGTCAAA CTTGACCCGC CTCACCATGC TTCACGACCT ACCGGCTTAA CCTCACCCCA    133380
     TGCAGCCATG TCCGCCGGGA AAGGCGCGTT CGCGTCGCAC TGAGCGACCA GATCGTCCAG    133440
     TGCGTACTTA CGGCGCGCGG GGGTCAGTAA TACGCCGTCC GGGCGCACGT CGGCGTTTAG    133500
     GGAGCCGCCG ACCGAGGCGT GCATCTGCTC GAGCAACACG GCGGGGAGTC GCACCGCCGC    133560
     ACTGTTGCCC CATTTCTGAA TTTTGAGTTC CATCGTGCCT CTCCGAATGT AGATCCATTG    133620
     TAGAAACGGT GTCTCGATAC GTCAAGAAAA ATGTATCTAC TTTGGATCTA CGTGGTGCGA    133680
     GGGGGAGCAC TACGATTGCA TGTCAAGTTA TCGGCTAGGC GAGGCCAATC CTGAATGGCT    133740
     CCAGTGAGGC GATTGCCAGA GGCATTCGCG CGGCAGCCGG ACATTGCTGC AGCGGTCAAA    133800
     TCGCCTCCTC CAAGAGGCGG CTGAGCACCT CTCGATCCAC ATTTACTGCT CTGGACCGTC    133860
     CATCAACCGC ATACAACGGA TGCCAGATTT AATTAACGTG GCGCGCCACG ATAAATGATG    133920
     ATACAGTGGC TTTGTGGTCG ACGCGCGGGT CGACCGTTCA ACCTTGAGGC TGCTGATGAA    133980
     GGTCGTTGAA TACCGAGATA TTTGCGAAGC GGTCCGCCGA AGCAGCATCG ACTATCACGC    134040
     GTGCATCAAT GACGCGGAGA GGGGCGTTTG GCTGCAGTGT GCACGTGCTC GCTTGCGTGA    134100
     GTCGGCGGAG GCCGAGTGCG CCCGAGCGAC CAATGTCGAT CGGGAGCGAA TGAATCTCGC    134160
     TACCCGAGCG CTCCGGGTGC TGATCGCTGA CGTGGAAGTA GGGGACGCAC TGGCATCCGC    134220
     AGTGAAGTCG TCTGCGGCCA CGGTAGGAGG GCGAGAAAGC CTTGCAAGCA AGTACAATCG    134280
     CTCACCCGGT CGTGCCGTTC GGCTGCGTCG AGCCGCTAGA TCCGCCATGC GACGCGGCTA    134340
     TTTCTGAACA CTCGCGTCAC GAGGCTCATG CACATGACTG TTCAACTCAT TCCGGAATCG    134400
     ACGGCCATCG ATATGATCGG CCCGTATCTT GCGGCGAAGG CCGTATGCCC CGCCTGCCAG    134460
     TACGAAAACG TGCTGGTGCA CATTGAGGGG CCGACGAGCC CGGTGAAACC CGTCTCGATT    134520
     TGTCAGCACA TCACCGCGCA CATCGTCGAC GACGGTATCA GTCACTTCGA GTTCCAGTGT    134580
     TGATGATTGG GGAAGGATGT GACGGTCATG CATGCAAAGC TGTTGCCCGC AATCGTCCGA    134640
     GTTGCGCTTG CGGGCGTTGG CGTGGGGGAA AGAGTCTTTG TGGGTGGTGC GCAGCGTGGT    134700
     CGGCGCGATG TCTATCGCGA TGCCGAAGGA CGCGAGTTCC TTGGCGTGTG CATTCAAAGT    134760
     GAAATTGAGA TGTCGAATGA ACGATCGAAT GACGATCCCG CAAGAGATTG ACGACGATGT    134820
     CGCATGCGGC CATGAAGTTG TGGTCTCCGC TGCGGGCGAC ACGGTGTGGG TAAACGGAGG    134880
     CGACGGATCC TGCGTCGGTC GTTTCAGCAA ACGCTTTGGT ATCGATGTCC ACCGCACGGT    134940
     CGCCGAGATG CTCGCGGGCG CCGATCAGTG CTTGTTCTGT ACCCACGAGC CGGCAGACGC    135000
     AGCAGCGTGG GCAACGTTTC GTGCCGATAT GGCGAAACAT CACGGCGTTG TCGTTCCAGA    135060
     GCGTTTGATT ACGTTCTCGA CGTAACGGCG TGCCCGATTA CCCGGAGGAG GGGTGATAGC    135120
     GATTGCGCAT CCTTCGGCAC CATACATCGA TAATGATGGA TGCGGATCAT GACTTGGCGG    135180
     TGTCAAGCAC CAAGTGCAAC GGTGGAATCA CTGAAGGGAG TGGCTGGCTT GGGTGACTTT    135240
     CTCCAGCATG GCCTGGTAGA CGGCGATCGG GGGGTAGAAG CCGTGGATGG CGCGCGGGCG    135300
     GCTGTTGAGC CGGTCGGCGA TCGCATCGAG CTCCTCCTGG CTGTAGACCG ACAGGTCCGT    135360
     ACCCTTGGGC AGGTACTGGC GCAGCAGGCC GTTGATATTC TCGCAACTGC CCCGCTGCCA    135420
     CGGACTGCGC GGGTCGCAGA AGTAGACCCG GATGCCGGTG GCCTCAGACA GCTCGGGGTG    135480
     GCGCGCCATT TCCTTGCCGC GGTCGTAGGT GAGGGTCTTT CGCATCGGCT CGGCAATGCT    135540
     GCGCAGCTTG GCGGTGAAGC CCTCCAAGGC CGAGGCTGCG GTGGCGTCCT TGAGCTTGGC    135600
     CAGCAGCACC AGACGCGAGC TGCGCTCCAC CAACACGCCC ACCGCCGAGC GGTTGGCCGC    135660
     CCCCTTGAGG AGGTCGCCTT CCCAGTGCCC GGGGAAGGCC CGCTCGTTGG CCTCGGGCGG    135720
     ACGCAGGTGG ATGCTCACAG CGTCGGGCAG CTGACCACGC CGGTCCTGGC CACGCGAGCG    135780
     CGGCATGCGC TTGGCTTGCG CACGCCTCAG ACAGGCGATG AGTTCCTTGC GCAGCTCGCC    135840
     GCGCGGCATC GCGTAGATGC AGTTGTAGAT GGTCTCGTGC GAGACGCGGC GATCCAGATC    135900
     GTCGGGCCAC ATGCGCTTGA GTGTGCCGGC AATCTGGGAC GGCGACCAGC CCTCCAGCAA    135960
     GAAGTGGTGC ACCACGCCGA AGAGCACGCC GTCTTCGGCC AGCTTGGGGT GGCGTCGGCG    136020
     CTTGAGGCGC ATCGCGCAAG CACGCGCGCC GGCTGCCCGC GCATCGTAGG TGCAGCCGCC    136080
     GCTGCCTGCC GGCACGAAGG CCGTGCGCTG CGGCCACTGC AGCGCTCGCC GGATCTCGCG    136140
     CGTGATCGTC GACGGCGAGC GTCGCAGCGT GCGGGCAATG CCGCGTGCCG AGCAGCCCTG    136200
     CTGCAGCAGG ATCATGATGG TGGCGCGCTC CTCGGCGCTC AGGTGCTGGT AGTGCGTTCC    136260
     CATGAGAAGG TGGCAGGCTC AAGTGCAAGG CAGATCAGGG ATGTTGCACT TGATTATTGA    136320
     CTCCGCCCTT CAAAATATAT GGCTGGGCTC GATACGATTC ATGATCGAGC GAAAGCGCTG    136380
     ATTGATGCCA ACACAAACAG AGGTCGCAGA TTTCAAGAGC TGTTTGACCT TACTGGGATA    136440
     CCTCGCGAAT CTTGGAAGAC CTATTGGAAT CGTGGCACGC GAATCAGTGG TGAAATGGTC    136500
     GAGGCGCTAG GGAAGGTGTG GCCACAATAC GCTTTCTGGC TTGCAACTGG AATTACTGAC    136560
     TCCGAGCGCG GGCACTATGG TCTTCCTTCC GTTATGCATC GCGATGATCG CGGGACCGAG    136620
     CGTGCGAGCG TTTGCGACTC TTGATGTTCC TCTCGGAATT TCGACTGCTC GAGCGTTGAG    136680
     CCTGATCTCG ATCGGCTCTA CTGCATCGCC GTACGTCGGC CGGTAGCCGG CAAACTGGAT    136740
     GGAGAAAATG TCCGTATTTG CAACCGCGCA GCAAGAGCTG AGCGAGATGC TCAAAGTACA    136800
     GGTCGCGATC ACCCAATGGG ACGACGCGAT CGCCCATGGC AAGGTTAAGA TCGAGGACGT    136860
     GTCTGAGGAG GCGCTTGAAG GGCATCGCGC CCGGATTCGC CGCCTCGAGG CGATCAAGGA    136920
     CAAGTACGAC CTGTGAACAA GAGAGGACGC GCGTGGTTCA GCTGAGCAGC TAGCCCGCAC    136980
     GACTACCCTC AAGTCACTGG TAAGAATTCC GTTAACTCGG TCGGGCATGC GGAGCCTAAC    137040
     TGGTGCATTG GCGCATCGGT CGTCCGGCCC GTAGGGCCGG TGGGATGCGG CATGACCGCG    137100
     AAGCGCATGC CGGCGCGATT TGATCGATCT GGGGGGGCGG AGTGCAACAG GGTTCCGAAG    137160
     TCGTTCGGTG TCGGAAGGCC AGCTCCCGGG GCGACACTGT CGGCGCTGCA GCAGAACGGG    137220
     CACGCCTGAA GGCGTCGGTC GCTGGGGCGG CTATCGACTT GAGCGCGGCA GCCCACTTGC    137280
     CGGCGGTCCT GCGCCGCGCC CTGAAGGTTC TCAAGCGATT GGAAGAGGGG GCGCACCCGC    137340
     TGTCGTTGGG CGCCCAGATT CTGGTTCGGC GCGGGGGTGA CTTCTCGGTG CCGATCGGTT    137400
     ACAGCTATCG CTTGTTGGTC GACGCGTGCA CGCTCCGCCC AACACTATTC ATCAGCCACG    137460
     AAACTTATAA CGGGCTTGTT TGAGGCCCCG AGATCACGTC CTTGGTACAT GGAATAAGAA    137520
     AGAAAATTTC GGTCGGCCTG TTTCATCTCT TCGCGCTGGC GCTTTCGATG TTCGCGCTGG    137580
     GGGTGGCCAT TACCCTGTCG TTCGTCCTTC GGGAGGTGCT CGTGGTGCCG CTGCTCTCCG    137640
     CAATCGCAAC GGTCCTGTTT GCCATCGGCG CCATCGTCTC GGGCGCTAAA GAATCCACTG    137700
     CCGGTGCAAT ATCGGGGAAA TGACACAATG AGCGCAATCG CAAAGCTGAT TTGTCGGATA    137760
     TTCGGACATG TCTGGGTCGA TACCCATACG GTACAGGGCA ATGACGTTGA CATCGTGTAC    137820
     ATGGAATGTG AGCGGTGTGG GGCAGAGACG TCCAGAATGA AGGGGTAATC GAATATGGCG    137880
     CTGAAAAACG AGGAAATGCT GATCCGGGCC AGACCGGATT CGACGGCGGC AACATGCCGC    137940
     ATTTGCCGCA TGACGTTCGT CACCGATGAT GTGGATGATG TTCGCGCGCA CGGTGATGAG    138000
     CACAAGAAGC TCGCGAAGGG CGCGATGCCG CGCGTGATAC GCGAGATGTT GAAGGGCTTC    138060
     GGATATGCGA TCGCCCACAA CGATGGCGGA CTGGAGCGGC TCAAGGATCG CTACACGGCC    138120
     GAGGATGGTA CGCTGGCCGT TGCGTATTCG TGGTGGTCGC GCGCCTTGAT GCATGGCGTC    138180
     CCGACAGCCG ACTTTGATGA CTACATGGCC GCCCACATCC ATTACGCAGA TGCTTTGGCA    138240
     GGTCGTACCG GAGTACCGAT CGAAGAGGCG GGACGGGCGA TCAAGCGCTG GGAGCGCTAC    138300
     GCCGGCTAAC GGGAGGCATG ATCATGGCAA CGGTGAATCG ACAGGATGTT TTGACGCGAC    138360
     TCGGCGCGGC CGCCGTCGAT ATCGTGCTCG GCGCGCTCCG GCACGCTGAT CACGGGGGCA    138420
     CGTTCAAGGG GCTGTTCACG CTGAACGTAG ACGGCTCGTC GAAACCGGTG CTGCTGATCG    138480
     GAGCCGCGCA CGGCACGCAC GAGGATGGTC AGGTCATTGC GATCCTGAAT CCGGACGAGG    138540
     AGTTGAGCGC CCGCGTGCAC GCAGGCGTTA GCTATACGGG CGGCCTGTTG AAGGAAATTA    138600
     TCGCCGGCAA ATGCGACGCG ATGGTACACC TATGGATCGA GGCCTATCGC AAGGATCCAG    138660
     CCTCGGTCAT CGACACATAT CAGCCCCGCA CGGACCCGGA GGCCGCCAAG TTCGAGGTGC    138720
     GGTAATGAAT CAGAGCGACA TTTGCGAAAT CGCCTGATAC TGCTCGTGGC CACCCTTGTC    138780
     GATATAGATC GACGTCGTCT CGATCGACGC ATGCCCGAGC TGAGCTTGAA TGGTTGTGAT    138840
     GGATACGCCG AGGCCGTCCA GCATGGACGC GAACGTATGC CGGAACCAAT GAGGACTTGC    138900
     CGCCTTGAGC AGGAGTGATT CGTCTAGGTA AGATGCCGCA AGCGCGTCGG CGGCGTCCTC    138960
     GAGTGCTTTG GCCACGTCCT TGTAGATTGA CTGACCGTCC AGCGGGCGCG CATTGGGTTG    139020
     CTCACCCCAT AGCGGCAAAT AAATTGGACA ATCGTTTTGA GTATGGTGTG TGCTCGCCTT    139080
     GAAGAATGAC CGATAGCGCT GTAACGCGTT CCGTGCGGTC TCGTTCAGTG CGATCGTTCG    139140
     GACAACGCCA CCTTTTCCGA TGACCTGCAT TGTCCAGTAA TACTGTGCGC TGGCATTGTC    139200
     GTACCGGCGA TAAATGTCCG ACATGCGCGC GCTTGCGAGC TCGTCTCGAC GCAATCCGGT    139260
     GTTGAGTAGA AAGCGGACCA CAAAAAGCTT CCGCTCGGCA TGCCGCTTTG CGCGTCGCCC    139320
     CTCGGCCTCG TCTGCTTGTC GCTCGAGGAA TTGGAGAAGC AGCCGCGCGG TCGGGGCGGG    139380
     CAGATATCGA TCGCTTTGCT CCGCTTGTCC GGTTTTGTGC TCCTCGCGCT TTTCCTGCGC    139440
     GCTTAACTTC GCTTTCCGGC GTCGAATGCT GAACGGGTTG CCTGCGAGAT AACGCGCGTC    139500
     GACGAGCCAC GAAAACAACG AGCCGACGAT CACGATCGCT TGTTTGCACG ATGCATCCGA    139560
     CAATGGGCCA GTAAACGGCT GAAACCCATC GTCGTCGCGC CTTGGGCGGC CACTTTTCTG    139620
     ACGTACCCAA TCGCTTGGTG GATTTTTGAC GAACGCGATG TAGCGATCGA TGTCATCTCG    139680
     AACCACCGAG CCCAGATCTT TGCGCAAATA GACGCTCAGC CAGTTGTAGA AGCGCTCGAT    139740
     TTCCTTTCGG TAGGAGCGGT GAGTGTGCGG GGAGCCCGCG AACTCTGCCA GCCACGCCCA    139800
     GATCGCGGGA AGATCATCGG TCACGCCGAT CAGATTGGCG ACACCGCGTG TGCGGTTGTA    139860
     GCCGGGCTCG CCGTACACCG GGACGTTGGC TCTGCCGGCA ATGATGTCGT CAAATGAAAT    139920
     CGCGCGCGGC AGGATGCTGT TGGCCGGGTC GACGAGCTCA GTCATGTTGG TCAGGGTTCG    139980
     AAAGATTATT TGCGGAATCG ATGACGGCCG GCATGGTCGC GCGCACCTGC TCGAAATCCA    140040
     GTGCTCCAGT AACGTAGCCA ATCCGCATCC ATTTGCTCGA CATTCCGGTC TTCTGCAGGA    140100
     ACGCCGTTGC GCCTGCGCAA TGCGCTTCCT TCCCGGAAGG GTGATAGTCG CCCGTCTCGT    140160
     CGTCCCATGT GCCGCCGAAT TTCTCGCTGT GCACAGTCTC GTGGCATTGG AAGCTGTTTT    140220
     CGTCCGATGC GTACAGGTGG TTGACGATAT CTTCCATCCG ACCGGGGGCC AGCTCGATAC    140280
     CGCCGTCCTT CAGGAACGGG CAGTTCTTGC AGGGCCGTTT CAGCCGGAAG TACTCGGCGA    140340
     GGTCGTACTC GCCGCGTGCT GGTTGGGGGG TGTTTGCCAT AGCAGTATTT TCAGTTCGCA    140400
     GCCGGATCGT CAAGCACGAA AAAGCGCTCG ATGCCCTCAG GCGGTTGTGG TGCCTCGGCG    140460
     ATCTGCGTCG CCGGCACGGC GCGAAATCGT GCGCCATACT CCGCCGCAAC GTGACGAGCA    140520
     ATGAACTCGC GTGCGTCACG TGGCGAGTGC GCCTTATGGG TTCTTCGGCT GTAGCCGTTG    140580
     TAGCGCGCCT TGGGGGTGCT GGCGAGCAGC TGCTTCATCT CCGGCGAGTC CCCCATGTGC    140640
     CAGCGGTCCC GCACAGTCTC CTCGCCCCGG CAAATGTCGA TCCAGCGGCC GTACGGCGGT    140700
     GGGTGCTGAT CCGAGGGGGA CGTCAGTGTG ATTTCGAGCA TCCGGACCGG CTCATAGTCG    140760
     GCCGGCAGCG CGATGCCGAG CAGCGGGTCG AGCGCGAGCC GCCCGTCAGC CGTAATCGCG    140820
     CCGGGTGCGA CCCAAACCGA TCCGCTCTTT TCAACGCGGG TACGCCAGTT GTCGAACCAG    140880
     TCGGCGAGCA GCGGGCTATT GCCCTGACCG TCGAGCTCGT GCGCGTAGTC GACGAACGGC    140940
     TCGTGATCCG GTTTCACCGC CGAGATCGAT ACGTCGAACA GCGCCCACGG TGCGTCGACC    141000
     TGCAGCGCCT TCTGCATCTC CTGAGCGGCC CTTTCCTTGC GTGCGTACGG GCGGACGAAG    141060
     GCGCTGTGCA CCGACTGCTG CGCGGCGTCG TTTGGTGCGA GCCGGTGCAG GAACGCGTGC    141120
     GGCAGGGCTG TCCCAATGCA GAGGAACCGG ACGGCACGGG CTCGTTCGTT GTAGACGATG    141180
     CCGAAGGGGA TCGCGAGTAC CGGGTTTTGA ACGCTTGACG CTCCGTCCAG CATCGCGGCA    141240
     CGCAGGCGCT TCCAGCGTTC AAACAGATCT TCGTGCGCGA GCTCGGTCAG CGGCTGCGTG    141300
     AATTGCGCCA GCTCGGCACC GAACGACTCG GTGGCGGCGA ACAGCTCCGC CTTGTGTTCA    141360
     AATGATGCGA AAACCGAGGT GCGCGTCGCC CACTCGCTCG CTTCGTTCCA CTCGTGCAGC    141420
     GTCGTTTCGG ACGCGGCATG CTTGGGCAAT GCCACCCAGC GCCGGCTTTT CTCGACGTAC    141480
     TTGGTCTTGC CGCGCTCGAC GGTGATCCGG TGGACCCACG CATGCCGCTC GAGGCGGTCG    141540
     TCGCATTCGT CGGCGCGCGG GGCCGCGTAG ACGATGCATT TCGCCGCGCC AGACAGGACC    141600
     AGCCGCAACG GCCGGTAGCC CAGCGCGAGC ACGAACGATT CGATCTCGGC GACGCGGCGC    141660
     TTGCCTTCGC CAGCCAACAT GTACATCTGG TCCAGCAGCG CGGTCCATGC CGCAGGCGCG    141720
     TGATCGCCGT CGAATCTCGG CAGCGGCTTG CCCCGGTTCG CCGCGCGCCA TGCGAGCACG    141780
     GTCTGATCGA TGATCGCGTC GTGGTCGGCC GGGTCGGCGA CGTTGCCGTC GACCAATGCC    141840
     TGCATCAGCT GATTGCGGGT GTCGCGGTCC TCGTCGCGCT CGCGCTCGAC GTGCTTGAGC    141900
     GCCTGCTTGA AGAACCGGAT GTAGGCGAGG TGATTGCTGC GCGAGCCCCG ATGATGGATG    141960
     TACCAGCGCA GATCCATCGG ATCGACCGCG TCGAGGCAGA GAAACGGCAG GTCGACGTAA    142020
     TCCCACGCCC CGGGCCGGAA TTTGGACAGG TTGACCTTGC AATTGAACGT GCGGTCGCCA    142080
     TGGCTGCTGT ACGAATAGCC GGAGACCTCG ACGTCCACGC AGATCGACTT GCCGTCGCGA    142140
     TAGGCGATCG CGACAGTCAG CCGGTCTTGC GGCGTGTATC TCGCGTCGAA GCCTCGGCCG    142200
     CTGGTGCTGC CATTAGATTT GCACGCCCCC GGTGCGGTGT CGGGATTCAT CACTTCACGC    142260
     CAGTTGCACA GCACGCGCGA GCCCGATCGC AGATACGCGT TCTTCTCTTC GATCCAGTCG    142320
     GTCAGGGATT GTCGCTCACC GCCCGGCAGC TGCGTGCTCG CGTCGTCGTC GTGCAGAAAG    142380
     CGGCAGTGCT GCTCCTGAAA CGCGAGCGAC ACGAAGTCCA GCGACGGCGC GCCTTCGTAG    142440
     AAGTGGCCGA ACAGCTTCAG CCGGTGATCG AGCCCACATG CGAGCAGCAG GAAGCGCTTG    142500
     TAATGCAGCG CGAACAGCTC GTGCTTCGCA AGCTTGTCGG TGAAGGCGAC GTCCTCGAAC    142560
     TTGATCTGGC TGCCGTCCAG TCCGCGAAAC ACCGCGTCCT GATCGCTCTG GGTCGGAAAC    142620
     AGCCGATTGG CGCCCAAGTG GCTCTCGACC GGAGATAGGA CGCGATGGAT GTTCATGCCG    142680
     TTGCGCACCA GCAGGAACAC CTTGGCGTTC TCTTCGTTGC GCGCGACGTT GGTCCGCGCG    142740
     TCGCCGTAAT CGATGAAGCG ACGGGTGGTC GCCATCACGA GCACGCACCG CTCGGTCGGG    142800
     AAGATCTGGT CGATCAGGCC GTCGTGCGCG CGCAGCGCCT CGAAGAATTT GTCTTCGTGC    142860
     TGGAAATCGA ACCACTCGTC AATGTCGGTC CACACCGCCA GCTCTTCATC CATCACCAGC    142920
     TTCTTCTGGA CGAACGTCAG CGGGACATCA GGCGCGGCGG GCGTGCCTTC GCGGATCGTA    142980
     TCTACCGTGA CGCCCTTGCC GACGTACAGA TCCAGCGACT CGATGCCCTG CAGGAGCTTG    143040
     GCCACATAGG TGCGCACGTC TTCGGTCTGC GCCAGCGCGG CGGCCGCCTG CTCCTCGTAA    143100
     TACGGCGTGA GTTCGGTGAT GGTGTCGGCG ATCGCCTTGG TTTTGCTCTG AATCCAGTTC    143160
     GCCTTGATGG TGGCGATCTG GTGTTCGCGG GACGCGGCCG CCTTCATCGC GGCGATGCGC    143220
     TCGGCGGTGA TGCCCGAGCC GATCGCATTG GCCACGGTGC CGGTCGTGAG CGAAACGATG    143280
     CCGCTGTCGG CGGCCGCAGG CGCAGCCGGC AGCGAAGGGC GGGGCGTGCT CGTCGACTCG    143340
     GCGTCTGCGG CACTCGCGTC CTGCGGCGCG GCTTGCTCGG CCTGTGCGCG CAGGCCTGCG    143400
     TCGACGACGC TGGCGAGCAG CGCCGGGTTG CTTTGCGTCT CGATCAGTTC AGCCTGAAGG    143460
     GCATTGACGC GGTTCTGCAC GGCGCGCACT TCGCTGTTGC GGATCGGCTG ATGGTCGGGC    143520
     TCGTATTCGA ACCGGTTGAG GAAGTCATCG AGCAGAAACC GGTGCTCGTC GTAGCGGAAC    143580
     CACTTTGTGC GGGAGCTGCC GTCGTCCTGC GGGATCGCCA GCTTGACCTC ACGGCCAATT    143640
     TTTGACGGGT GCGGGCGCAG GATCACCGTG TGCGGTTTGT CGTCCACCCA GCGGATCGAC    143700
     TGAATCAGCA ACACGGTGCC TTGCTCGATG CCTTGCTCGA TGACGGCGAC GGCCGCGCGC    143760
     CAGTACTGGC CGGACTGCAG CGACTGGAAG CGCGCGACGC GGTCGACGGT TGCATCGTCG    143820
     CGGGCGCTGC TGGTGGTCAA GGCGGTGCTC GGCGTGCCGG CGGTCGAATC GTTCATGGTG    143880
     AGCTCGTGTG GTGTTCAGGA TGGTAGCAGG TGCCAACGGG CCGTCCGAGC GCCGTGGTGG    143940
     CGGCTTCGGG CGTGACGCCG AGGCGGTGCC GAAATAGCCG CAAAACCGCG CTTTTTCGAT    144000
     CCGGCCCTAC GTTCATGCAA AAGAACGATT ATGAGGATAA TCATTACAGG ACGATCCCGC    144060
     AAGACAATTT TATACGCAGA TACGCACAGA TATTTATCTT GACACGTAGA AATCGCCCTC    144120
     CTAAGATTTG GCACATCCCG CTGTAAAAAA AGATTCTTTC TTTTATCCGA AACGAAACGT    144180
     AGTACACGGG GTCCCCTTGA TTTTCATGCA GTTTACCGGT GTAGGTCCAC CTAGCTGCGA    144240
     CAAGGGTTAG CGCTCCGCCC CCAAAATAAT AATCAATAAA ATCAGCCGCT TCCTGACTGG    144300
     TCTTTCTGCT CCTCCTCAAC ACCTCTTCGC CGAGCCCCGG CGGGCGTAGA CATGCATTCG    144360
     CCGGCGCGGT CGGGTCTGCA TAGCAGCGAT AATGAAAATT ATCTTGGATC ACTATCTTTA    144420
     TATCGTCCTA AAAGGGGTTA TCTAACGTTA GATATATGTG GAATAATTGA GCCAATTTGA    144480
     CTCGATTAGT CCGTCATGTC CCGCCCAGCC GCCGTCACCG CCGATCAGAT CCGCACCGCC    144540
     GTGCTCGCGA TGCTCGCCGA GGCCGGCGAC GCCGCGCCGG CCAGCGGGAC CCGCTTTCGC    144600
     CAGATCGTGT CGGTCCGCAA GCTTCGCGCG CGCCTCGGCG CGGGCGACCC CGCGACGCTC    144660
     GCCCGCGCGC TGAATGCGAT CGAGGCGGAG GTCGTCCGAG CAGGACTGAC TGAAGTCGCC    144720
     ATTCCGGATC TGCCGCCCGA CATTGCCGAT CTCATGCGCG CACTTTGGCA GACCGCCGTC    144780
     GCGGTGCAGC TCGATGACGT CGTCCGGCTT AAACAGGCGG CCGACGCCAA CGTCGTCGCA    144840
     GCCGAAGCGG CCCGTACCGA TGCCGAGCTG CGCGTCGAAT TGCTCCGGCA GGAAGTCCAG    144900
     ACCCTCCGCA CGACGCTCGT CACGCGCGAC GCCGAGCTGG CCGATCTGCG CGCCCAACAC    144960
     GGAGTGCAGC GGGACCGCTG CGCCTCCCTT GAAGCGCAAG CCGACGAGCG TCAGGTCGCC    145020
     CTCGACGCGC TGACAACCGA GCAGGCTTCC CGGGACCACG CACACACGAC CGCGCTCGAG    145080
     GCCGCCCAGC ACCGGTATGA AGCGCTGTCG AAGCAATTGC TGCAGGAAAC CGCGCATCAG    145140
     CGCGAGGCGC TGAAAAAAGA GCACACGCAT GCGGTGACGC AACTGAAATT CGCCGAGCGC    145200
     CGGATCGCTG CGCTGGAAGG CGAACGCGAT CGGCTCGACA GCGAGGTCGT GCGTGAACGC    145260
     GAGGCGCGCC AACAAGCGGT CGGCGAGGCA CTGGCGCTGA AAGCGGTCAA TGCGCAGCAA    145320
     CACGCCCAGC TCGGCGACCT GCTGCGCGAC ATCGCGCCGA AACCAGCGCA GACCGCCCGC    145380
     GCAGGCCTTG CAACGGCAAA ACGCGCCACG GGTAGCGCAT CGACGAAGCG CAAGGGAAAA    145440
     TGACCCGGCC CGCCGCTTGC CCGATCGCTG ACCTCTCATG AACTTCGCCG ACTGGATCGA    145500
     TACCGGTGCG ACGCCACCGC AGCGTCTGCC CAACGGTCTC GATGCCGCCA TCGCTTACGT    145560
     GAGCGATGTG CTCGGCCAAG TCGTCTATCT GCGCTGGACG CTGACGCTCG TCAAGCGGCG    145620
     CTTTCCGTCG CTCGCCGATG CGAAGGTCGC AAAGCCGGCC GTGATGCGGC TATTGCTCGA    145680
     TCAGTCGACC GCGGTCGAAT ACTGGGATCG CGGTCGCGCA CGGGTCGTGT CGGTCGACGA    145740
     CGCGCCGGCA TCCGAAGCCG TGCTGACACG CGTGCTGCAC GCGCATGGGC GGCGCTTCAA    145800
     GTTCGGCGAG GTGGCATTAC TGGCGATCAC GAGCGGTGAG TGGTTTCGGG AGTCGGCGCC    145860
     GCTGGTTGGC GGCGTCCCGC TTGCGTTACG GCCATGGTTC GCGCGCGCGG GGCGCTTTGC    145920
     CGCCGTCGCG AGCGCAACCA ACACGCTCGG CGTCGGCGAT GACGCCCAGG CGACCGCGCT    145980
     GTTCCTGCGC GACCGGGCCA GTCGGTCGCC CCATACGGCA CGCGCCTACC TGACCGAGAT    146040
     TCGCCGCCTT GCGGCGTGGT GCATCGCGCA CGAGCTCGGG CCGTTGTCCG ACCTGACGCG    146100
     ACACGATTTG CTCGAATACA AACGCATGCT GCACCGTCCT TCGCAGGACG TTGCTGACGA    146160
     TGCGCAACCT GAAGGCCGAC TGTCCGAGGC GACACAGGCT CGAGCGCTCG CGGTCGTCGC    146220
     CAGCCTGTTC CAGTACTGGA CCGAAACCGG TTACCTGACG GCGAACCCGG CCGCTGGCCT    146280
     GGTGCGAGGA CAACGGCGGC ATGCCGGTTT CGCCCCGACC CGCATGCTGT CAGCTGCGCA    146340
     GTTGGGCGCT TGCGATGCCG AGGTTGACGC GGTCGATCGC GACGTCGAGC CGCTGATCGC    146400
     GGCGCGACGC CGGGCGATCT GGAGCCTGTA CCGCTTTGCG GGCGTACGGC TGGTCGAGTT    146460
     GGCCTGGTCC GACGCACGAC AACTACCCGT ACTCGACGTC GACTCCAATG GATGCTGGAC    146520
     CTTGCACGTG TGCGGCAAAG GACAGAAACC GCGAGCGATT CCGTTGCCCG CGGGTTGCGT    146580
     CTCGCGTCTG CAAACCTATC GACGGTTGCG GGGACTGCCT GAGCAGCCGG AACCAAGCGA    146640
     ACACGTGGCG CTGGTGCATG GCCTCAAGGG CGGGACGCTG CAGAGTTCGG GGCTGTATGA    146700
     CGAGGTCAAG GCGATCTTTC GGGCGGCGGC CGCGCGACTC GACCCGACCG ATCCGCCGAG    146760
     TGCCGCCACG TTGCGGCGGG CGTCGCCGCA CTGGTTGCGC CATGCCTATG CCCGCACGCT    146820
     GGTCGTCGAC CGGCAGGTGC CGCTGCCGGC CGCGCAGGCA CTGCTCGGCC ATGCGTCGAT    146880
     TCAGACCACG GCCGGCTACG CAAAAACGGA TCTGTCGCAG TTGCGCGCGT TCGTTGATCG    146940
     CGCGTTCGAT ACCGATTAGG GTTCGGTCGC CAACGGAGGA ATCGGCGATT GCAATCCTTC    147000
     TACGGCGAAG CGATTCAGTT TGTCGAGCGC CGTCAGGTAA CAATGCGTCG GTATGCTCGC    147060
     CAGTTGCTCG TCGTGAAGCA CCAGGATCCG CTCGATCACG ACTTTGTCTC GATCGAGCAT    147120
     GACCCAGGTT TCACCGCGCT CGGCGCGCGC GATGCACCGA GCCAGCGCAG CTTCCGCGCG    147180
     CTGGAATTCG GCATCGTCAC CGGTCGCCGG CGTTTCCTTG CGCAGATAGA ACGCCGTATA    147240
     GACGGCCTTC AGCAAGCAGA CCATCAAGTC GACATTGGCA TGGCCCTTTG CGATGGTGGC    147300
     CAGCGCGAGA TGATGTTCGA GCGACAACGC GCGGGTCCGT GCGAGCGGGA GCGGCAACAA    147360
     CATTTCTTTG CTCAACGGAC GGTGTCCCGA ACGCCGGGCG GACTTTCGAC TCATGGCGGC    147420
     ATAGCAAAAG ACAGGAGCCG CGTATTATGC CCCGACCATT TACGCGGACT CCTGCCAATT    147480
     TCATCCGCGT GCCTCGCGTC CCGCCATCGG CATGCCGATC GCAAGACTGG GCATCAGGCG    147540
     ATGCGCGTAG TCAGCGACCG GGAATTCGAA CGTGCCGCGC AGGTTGATGC CTTCCAGATA    147600
     CGTCGGCGCG ATGCGCCGCA GATAGTCGGG TAGCACTGGC GTTTGTCCGA GTGTCTCGAT    147660
     GCGTTCGATC GCCTGCTGCA TGTGCATCGT GTTCCACGCC AGCACGGAAT TGGTCAGCAA    147720
     ACTCAACGAC GACGACACGG CCATGAGCGT ATGGCGGTGC CGCGTGAGCT CGACGGGAAT    147780
     CTTGCCCTGA TGAATCGCAC GCTGCACGGT GTGCACCGCT TCGCCGCGAT TGAGCACATG    147840
     CTGCAGTTCG GCACGGAACG CCGGCAGCGT GAAATAGTCG ATCAGGTAGA TCGACCGGAA    147900
     CAAACGTCCC AGCGCGACGC CGCCGTCGTA CAACGGCAGG CCGCGTGCGG CAGCCCCGAA    147960
     CCGCGTCAGC GCCTGCACGG CCGTACAGTG CCCGCTTTGG ATCGAGGCCA CCAGCCGCAC    148020
     GAAGTCATCC CAGATTACCT CGATGGCTTC CAGTTGGACG TCGCGATCGA CGACGGCGGC    148080
     CAGCGCTTCG GGCACGCTCA TGCTGACCGG AACATGCAAA CGCCGGTCAC GCAAATGCGC    148140
     CAGCCGCGGG CACAGATCGA ATCCCAACCC GCGGGCCACC GCCATCCCGA AATCCGTATA    148200
     TCCGTGCGTG TCGACGGCCA ACTGAGAGAC GTCGTCGGTG CCTTCCTGGC GGATGGCGCC    148260
     TTCGATGGCC ACGCCGGCCT GCCGCTCGTT CAGCACGATC GGCTGGTCGT AGAAGATACC    148320
     CCACCGATCG CGCACGTGGG TGTAGACGCC GATCGACGCC GTGCGCCGCC GCGGATCGGC    148380
     ACGTGCCTGC CAGACCGTAC GGGTCGTCTC GAGCGACATC ATGTCGGACG ACGCGAGATC    148440
     CGCGCGCCCC CAGTGCGCTG CGATCGGGTG GCGGTGCATG AAACCAAGCA CGGCATCTGC    148500
     CGCCTCTCGC AGCACGCGCT CGTCGGCGAC GCGATGCATC ATCTGACGGA TCGCGCCGGC    148560
     CGACAATTCC GGCACCATGC GCGCGACTTC GGCGGCCGAC ATCGACGTGC CGTGCGCGAG    148620
     CACGGCCGCG TAGACCATCA GTAGCTCGCT GCGCGCACGA GGTTCGCGGC CCAGCAGCAA    148680
     CCAACTGAAC CGCGTCTCGC TATCGATCTC CAGGAGGATG CGCGGCAACT GGCCGTCCGG    148740
     ATGAACATTG AAGATCGCGC GGCGCAGCGC TTCGACAGCA GGTTCGGCCC GCTGCGCCGA    148800
     GGCGGGATCG AGGTGGATCG CCGTGTCGAC CCGAACCTCA CCACGCGACA CGGCTTGCGT    148860
     CAACCGTTCA AGGCCCTCGC TCAGGTGCGC GCAAATCGGC TCGATATACT CTTTGGGGTC    148920
     CTGCGACAGT TTCAGATGAC CATAAAAGTG GTTGCGCTGC GCCTTCCAGG TGTCGTCGGG    148980
     AATCAGCAGC GTGGCCTGGC TGCGGAACGC GAAACTGTGC TCGACGAAGA CTGAGCCGTT    149040
     GCGCAGCGCG ACCCGCAACG CGGACAAGGT CGCCCATTCG AACGCAAGCA GTGCCTGCAC    149100
     GCGGTCCTCG CCGGCCACGG TCCGTTGCCA GGCGCGCCCG ACCGGCACGG ATACATCCGC    149160
     CGGCAGTTCA CGTTCGCCGC AAACGTAGAT CGTTCGCAGT ACCTCCAGCG CGTCAATGAC    149220
     GGGATGCGGG GTTTGCGACG CGAACGGCAG CGTCAACAAC TTCGCCAGCA TCGCGCGGGC    149280
     GACGCGTTGT TTGGTCAGCA ATTGCGCGCG CACCAGGCTC GCGCGGCTCG GGCCGCTTTG    149340
     GGCGAGCGTC GTGTCGGCCA GTTGCACTAG ACGCGCGACT AGCGCGTCGT GCGCCAGGGT    149400
     GGCGTCGGTC GCGAGCGCTT TCACGGCCGT CGCAAATTCG CGCAGTTGCG CTTTCAGGTC    149460
     CGGGCGCGTT GCGTCGACCT TGCGGCCGGC TTCATTGACC ATCTTGCGCT GCCAGCGGGC    149520
     AAGCATCCAC AGCAGCTGAT CCGTGGCGAC GCAGAGCGCG TAACGCATGA AGCATGCGGC    149580
     CTCAAGCTGA CGGACAGGCT GACGGATGCG CTTGCTCACC GACGGCGGAC GGTTCGCGCA    149640
     GCGTCGCGCG TAGTGTCGCA CCGTCGCTTC GTTGCACTCG ACTGGCCAGT CACGATGTAC    149700
     ACCGAGCTTG GTCAGGCGCT CGATCTTTCG AAACAACTCG CCCATCTGAT TCGTCGAGTT    149760
     CCGTAATGGC ACGGACCAGA CCCACTGCTG TAGGCTGGCT CCGCCCGATT CCGGTCGCGG    149820
     CAACAACATG CCCCATTGAT CGAGCGCCGC GGCGCCGAAC GCTACCTCGA GACGGTGGAT    149880
     TAGCGCGGCT TCGACGTCCT GCACTGCCTG CACGATCAGT TGCTGCAGTG CGCGGTCGTG    149940
     AACGATCAGG ACCCGGTGCT CGTAAAGCCA TTGCTTGAGG TCGAACAGCG CCGTGCTGCG    150000
     ATCCTGCCGG CCCGACAGCC GTTCCTTAAG CCAGCGCACG ACGTAGCGCC GCTGGTGCTC    150060
     GGCCATGGGC TTGAATCCGA GCGCATCGTA GGCAAGCCTC TGGTGATCGG CGAGCGTGTC    150120
     GGTGCGGTCA TCGTACAGTG CGCGCAACGT CCCCAGATCC GGCGAGTCGA TGCCGAGTTG    150180
     CTCGCCGAGA TGCTGCCACA AACGATTTGG AACCTGTTTG TAAGCATCGA GCGTGCGGCC    150240
     GGTCATCCGC ACGAAGCCTA GGTGGAGCGC GACCGCCAGG CGGTAAAGAT GCGAGCGGCG    150300
     GCCGTCGATC AGGGCGCGCT CGCGGGCGGA GAACGTGAAG AAGGTGTTGA GCTCGAACTC    150360
     AGTCAACTCA TGCGGGAAGT GCCGCACGCC GAGGTAGGCG AGGCGCCAGT GGTCCATCGT    150420
     GCGCATCCCG AAGCGGAAGA CGGGCTGTGC AGCATAGCGA GAAATTTGGT GACGGACAAT    150480
     CGCGGGCCGA ATATGACATA TTCGTAGCGT TGTCGTGTGC CGTCCAACGA ATCGGCCGCG    150540
     GAAATCGGGC TTGTCAGGTT TCGGATAGGC GACTATGTGA GAGTGCCGGC ATGCACGAAA    150600
     ACTGAAAGCC GATCTTGAGC AGCCTGAACG AGGTCGTCTA CGCCGAAATC AACCCAAGGC    150660
     GACGACGCCT TGATAACCGA CAAACAGCCC AACGAGCATG ATCAGCGCGC CAGAGAAGTA    150720
     CGGCGCCTTC CGCGCGAAAT CGCCGAACCC GCTCCAGCGC TTCGACACGT GCTTCAAGCT    150780
     GATCGCAGCC AACGTCCCCG AGACGACCAT CGTCAGCGCC AGCCCGATAC TGAAGCACAG    150840
     CACCAGCGTG GCACCGAGCG CGATCTTCTT GAGTTGCAGG CAGAGCAGCA ACACCGTGAT    150900
     GGACGCGGGG CACGGAATCA GCCCGCCTGT CAGCCCGAAC ATCACGATTT GACCCGTCGT    150960
     GACTTCGCGG TTGGCAAACC GCCGACGAAT ATCGTTGGCG TGCGCGAGTT CGTGCGCATC    151020
     CTGATAGCCG GCGTCCGATA TGTTGAGCCC GTCTTGGTCG GCGCCGGCGT GGTGATGGTG    151080
     ACCGTGCTCG ACGAACTCGA CGTCATAGTC ATGGCTGTGG TTGCCATGGC CGAGACTCAG    151140
     TCGAGCAACA AACTCGTGCG GCTCCGGAAT CTCCTGCACC GATTCCACGA ATCCGTCTCC    151200
     CATCCTGAAC GTGAAGGCCT GCCGGCTGCC GTCCTGACGT TCGGTTTCGA TCCGGACCTC    151260
     ATCGGAGCTC CACACGTGAC TGTGCCGGCC TTGTCGATAC AGACGGAAGC GAGGCGGCAC    151320
     GCCGTCCTCG AACACTTCGA GACGCACGAC GCCATGCCCG GTATCGATCA GCTTGGCTTC    151380
     ATCGCCGTGA TCGTGGTGGT CATGGTCGTG ATGATCGTGA GCGTGTGCGA GTCGCTGCTG    151440
     ACGCCAGGTC CGCCAGATCA TCCACGCGGC AACGCCGACG ATCAGTACCG CCGACGCGAC    151500
     CTGGAAGTAG GGTTCGCTGG TCTCGGCATT CCAGTTGCGC CCGAAGTACA TCCCGGCCAG    151560
     CGCGACGGCC CATACGACAG CAGTGTGCGA AATCGTCGCG GACAACCCGA GCAGCACTGC    151620
     CTGACCGACG GTCCCGCGGA TCGCGACGAT GAATGCCGCC ATCATCGTTT TCGAGTGGCC    151680
     CGGCTCGAGG CCGTGCAAGG CACCCAGCAG GATCGCGCTG GGAATGAACA GCCAGGCGTT    151740
     GGACGCGCCT TGCTGAAGAA GCGTGGAAAA TTCCGTCATG GCGGACTCTT ACAGGTATTT    151800
     GGTAATTGCC TTCAGCTCGG TCAGCGCCGC GTCTGCCGAA CCGCCTTCAT GAATGGCGTG    151860
     GTCGATGCAG TGATCGATGT GGTCGCGAAC GAGCGCCTGC TTTGCATTAC CGACCGCGCT    151920
     CTCAACCGCC TGAAGTTGCT GCGCGACTTC CACGCAGGGG CGGCCTTCCT CGAGCATGGC    151980
     GATCACGCTT TTCAGGTGTC CTTCGGCACG TTTGAGCCGC TTGATGATGT CCGGGTGTGA    152040
     TGCGTGGATG GTCACGGTTG CCCCACTTCC AAGAGAGATA GCGACGACGA ATGTGTGCGT    152100
     CGATCGCGAT GGTGCGACGT CGAGGTTGCG AATTATATCC TATCCTCCTG GATAGGATAT    152160
     AGGCAAAGCA TCCATGCTGG TGCCAATGAT GGATATCTGG GGACCACGAA TGCGAGATGC    152220
     GCGGTGCGTT CATGTCGCTT CGGACCCCAC AATCCAAACT GAGACGCCGT CCGGATCCAC    152280
     CGCAAAATGG CAAGCATGTC GCTCGACTAG GCTGCTATCC CCGATTGCAA GGTCGAAGTG    152340
     AACACGGGCG ATTTCGACAC GTGCGAAGCG CTCGCCGTTG CGTAGCTCGA TCGAGTCGAC    152400
     GACCGCCTCG AACGATCCCG GTCCGCCGAC TGGGCGAATC GCGCGGGCGG CCACACGCCA    152460
     CATGACGCGC TGCCTCACGC CGATCGATCG GTTGGCGGTC TCGATGAACA ATTCGTCGTT    152520
     CACCCGGATC AGCCCGGGGG CATGAATCAC GCCGCTGCCG ACGTTTCTCA GGCCGAGCAA    152580
     TTCCGCGACG CGCATGCTTG CCGGTTGCTT GAATACCTGC TCGATTGCGC CGGTCTGAAG    152640
     GACCCGGCCC TGATCAATGA CGAGCACTTC ATCGGCGAGC AGCGAAGCCT CGTCCGGGTC    152700
     GTGCGTAACA ATGATCGTCA CGGCGGAAAT CTCTCGCTGA AGCTCCCTGA GCGATCGTTG    152760
     CAGTCGGCGA CGGCGAGGCG TGTCGAGCGC CGAAAACGGT TCGTCGAAAA GCAGCAGGTG    152820
     ACTGTGGCGC GTCAGCGCCC GAGCGACTGC GACGCGTTGG CGCTGGCCAA ACGACAACTG    152880
     GTGCGGCAAT CGATTCAGCA GCGCCGTCAG GCCGAGGTGG TCCACCCAGT AACGTGCGCT    152940
     CGCCGCATCG GCATCGACCG GAAACGCCAA CTGCTGAGCC ACAGTCAGGG GTTCTACGCC    153000
     GGAACCCCAG AAAATTCCGT CATTCCACAT TGTGAACGTC AATCGGTTTG TTGCCTGACG    153060
     TGCCGAGCGA GTAACTCAGT CGGTAAATGC CTGCCCGAAC TGCCGTGCCC GCTTTACATC    153120
     GTCGGTATGC AAGTAAATCG ACGTGGTCGA AATCGACGCG TGACGCAGGT TATCTCGTAC    153180
     GGCGCTCAGC TCAACCCCTC TGGCGATCGC GTGGGTCGCA TGGGTGTGCC GCATCCAGTG    153240
     CGGAGAGGCC CGATGCAGCT TTTCAGCCAG CACCGGATGG TCGTTCTTGA TAATCTGCGC    153300
     GACGAGCCGA AAAAACCGGC GCATGACTTC CCACAGCCGC AAGGGCTTGA TGCCGGCATC    153360
     GGCGTCGTCA AGGCTGCCAA TCAGGGACGT GGTCGGATTC CAGTGAGCAC GGCTGACAGG    153420
     AAGCCCCCGC TCCTGCAGAT ATCGGTCCAG CGCTGTGCGC GCTAGGGGTG TCAGGGTAAC    153480
     GCGGGCTGGC TTGCCGCCCT TGCCGACCAC GTGCAGCCAG TGATCACCGG CTGCGTCGAC    153540
     TTCGATGCTG CGCAGTGTGG CGTCAGCCAG TTCGCTGATC CGCAGTCCCG TTGCGTAGCC    153600
     GAAATCCAGC ATGAACCGCA ACCGTTGCGC AGCGGGCGCC TGCCAGCCGT ACGACCACTC    153660
     GAGCCCGTTG GCGATGGTGC GCGTCAGCAT CCATTCTCCT TCGGTGAAAG CGTGCGAGGT    153720
     TTCAAGAGCC ATGGCGCGCT TGCTGCCGCG TACCTTGATG CCGGAGAATG GGTTGGCCAC    153780
     GACGTAGCGC TGCTCGACCA GCCAGCGGAA CATGGCGCTG AGCACGGCAA GCGCATGCGC    153840
     AATCGAACGG GCCGAGAGGT TGTCGACAAA CGGGCGCCAG TCCGTTGATG TGCGCGGCCG    153900
     CGGTGGCCCG ACCCAGCGTT CTCGCGGTGT AGGTCTGCGC AGAAACGCCC TGTAGTCGGT    153960
     GGCATCCCGG GTGGTCAGCG AAGACAGCGC CTTGCCGCGA GCAACGATGC CCCAGAGAAT    154020
     CAGCCGTTCG GCTTCCTTGC GGTAGGCCCG CTGCGTGGCC GGGGATTCGT GCAACGCGAG    154080
     CCATGCCTGG ATAGCGTCGT AATCGTTGTC GACGCCGAGG ATGCAGGCCG ACACCGGTGC    154140
     GCGGAAGGCG CCGGCGGATC CGTCGATCTC GTGCGGTAGC CGTAGTTGCT CCCAAGGCGT    154200
     CACGACTGAC TGCCGATCCG CGATGATCAG TGCGCGGGCC CGCTCCGTGA GCGCCGGGTA    154260
     CGCGGCAAAG AAGGCCTCGA TCCTTCTTGC ACTGGCCGGC CCGAGACCCG GAATGACGGT    154320
     CCACCACTGC CGGCGACGCG GAATCCGTAC CGTGAGATCG GCCAGGGTCC GGATGCCGGC    154380
     CGCGTGCAGG GTGCGGGCAG CGCGATTCGG CAGCCAGTGC GCAATGTCGT CGCCGATCTG    154440
     CGGAGCTGGC GCAGGCATGA TGCGCAGTAG CTCGACAGCC TGCGTGGTGG CGCGCGCATG    154500
     ATGCATACGC TTTTGGGCCG GGCATTCGAA CAGCGTGGCC AGATCTGCCC GCTGTCGGTT    154560
     ACGGGCATAA AGTGCCAGTT GCCGGCGGAT CTGGCCGATG ACGCCGCGGG CTGACTGGCT    154620
     GTGGCTGAGC CGATCTTGCA TGTACCGGTG TGCCGCCTCA CGCGAGGATG CGCCCTCGTA    154680
     CCAGGCACGC AGCGCTGCCA GTGCATCAGC ATCAGGAAAG TCGGTCGGGA TGTCGGCGGC    154740
     GGACGGGCTC GTGGGGCGCG TTTTCATGTC ATCGAGTTTA ATATGGAAAC AATGCCACAG    154800
     AGATAATAAA GCTTATCTCT GTAGAATGCG GGAGTTCAAT ATTTCTGTCG TACCCCATGT    154860
     CGTGATATCA CAAAATTGAA GGATCTGACG TTGCGTGGAG AGGATGGTCG ATGATCAACA    154920
     AGAATAAGCT GCTCAGCGTC TTTTCCGACG CCGAACAGGA AGCCCTGTAT GGCCTGCCTG    154980
     ATTTCGACGA TGCGCAGCGG CTGGAATACC TGGCATTGAC CGAATCCGAA CTGGCGCTCG    155040
     CCAGTAGCCG GCCCTCCATA CCCGCGCAGG TCTATTGCAT CTTGCAGATT GGCTACTTCA    155100
     AGTCCAAGCA CGCCTTCTTC CGCTTCGATT GGGACGAGGT TGAGGACGAT TACGATTTCG    155160
     TGTTGAGCCG CTATTTCCAC GGCGAGCCGT TCGAACGCAA GCCGATCACC CGGCACGAGT    155220
     ACTACGCCCA GCGCGAACAG ATCGCTGAAC TGTACGGCTA TCGACCGTGG GTGGCCGCCT    155280
     TCCTGCCGCA ACTCATGCAG CAGGCCGCGC AGATCGTACG TCGCGACGTG ACACCGGGAT    155340
     TCGTCGCCGC CGAGCTCATC GTGTGGCTCA ATGAGCACAA GATGATCCGG CCCGGCTACA    155400
     CGACCTTGCA AGAGCTAGTC AGCGAAGCCC TGTCCGTCGA ACGTCGGCGG CTGGGCGACC    155460
     TGCTCACCGG CGTATTGGAC GAATTGACCC AAACCGCGCT AGACCAACTT CTGGTGCGCG    155520
     ATGATACTCT GTCGAAACTG GCGGCGCTGA AACAGGATGC CAAGAATTTC GGCTGGCGTC    155580
     AGATGGTCCG CGAACGCGAA AAGCGCGGCA CGCTGCAGCC GTTGCACGAA ATCGCCAGGA    155640
     CGCTGCTGCC CCGGCTGGAT ATCTCGCAGC AGAACGTGCT GTACTACGCA AGCCTGGCGA    155700
     ACTTCTATAC CGTCCACGAC CTGCGCAACC TGAAGGCGGA TCAGGCGCAG CTCTACCTGC    155760
     TGTGTTACGC CTGGGTGCGC TTCCGACAGC TCACCGACAA CCTGGTCGAT GCGATGGCCT    155820
     TCCACATGAA GCAGCTCGAG GAAGAAAGCA GCGCGGGCGC GAAACAGTCA CTCATCGCCG    155880
     AGCAAGTAAA ACGCCATCGG GAAACGCCGC AGATCGGCCG CCTGTTGTCG CTCTATGTGG    155940
     ACGACAGCGT AGCCGATCCG ACGCCGTTCG GCGAGGTGCG TCAGCGCGCC TATAAAATCA    156000
     TGGCCAAAGA TGTGCTACAA AACACGGCGC AACGCATGAC GGTCAAGCCG CTGAGTCAAC    156060
     TGGCACTACA CTGGTTGGCG GTGGACGGCC TAGCCAAACG TATTCGCCGT CACCTGCGCC    156120
     CCTTGTACGT CGAGCTCGAC TTCGTCGGCA CCTCCCCAGA CAACCCGTGG CTCGCGGCGC    156180
     TGGCTTGGGT CAAGGGGGCC TTCGCCAAAC AGCAGCGCCT GTCACAACGA CCGCTCGCCG    156240
     AATGTCCCGC GGCCACGCTG CCGAAGCGCC TGCGACCGTA CCTGCTGATC TTCGGCGCTG    156300
     ATGGTCAGCC GACCGGTTTG CACGCCGATC GCTACGAATT CTGGTTGTAC CGCCAGATCC    156360
     GGAAGCGCTT CCAGTCGGGA GAGATCTATC TCGACGACAG TCTGCAACAT CGTCACTTCT    156420
     CCGACGAGCT TGTTTCGATG AACGAGAAGG CCGACGCGCT GGCGCAGATG GAGATCCCGT    156480
     TCCTGCAGCA GCCAATCGAT GCCCAACTCG ATGCGTTAGC GGCCGAGTTG CATGCACAAT    156540
     GGCTGGCCTT CAACCGAGAG CTGAAACAGG GCAAGCTTAC GCACCTGGAA TACGACAAGG    156600
     ATACGCAGAA GCTGATTTGG CGCAAACCGA AAACCGAGAA CCAGAAGGTG CGTGAGCAGG    156660
     CATTCTACGA GCAACTGCCA TTCTGCGATG TTGCCGACGT GTTCCGCTTC GTCAACGGCC    156720
     AGTGCCAGTT CCTGTCGGCG CTGACGCCAT TGCAGCCGCG CTACGCGAAG AAGGTAGCGG    156780
     ACGCCGATAG CCTGATGGCG GTTATCATCG CTCAGGCAAT GAACCATGGC AACCATGTCA    156840
     TGGCGCGCAC CAGCGACATT CCGTACCACG TTCTGGATAG CACCTACCAG CAGTATCTGC    156900
     GTCAGGCGAC GCTGCATGCG GCCAACGACT GCATCAGCAA CGCCATCGCC GCGCTGCCGA    156960
     TCTTCCCGTA CTACTCGTTC GATCTCGATG CGCTGTACAG CGCCGTCGAT GGGCAGAAAT    157020
     TCGGCGTCGA GCGACCGACT GTGAAGGCGC GTTACTCGCG CAAATACTTC GGACGAGGCA    157080
     AAGGCGTCGT CGCCTACACG CTGCTGTGCA ATCATGTCCC GTTGAACGGC TACCTAATCG    157140
     GCGCGCACGA GTACGAGGCG CATCACGTGT TCGACATCTG GTATCGCAAC ACGTCGGATA    157200
     TAGTGCCGAC TGCGATCACC GGCGACATGC ACAGCATCAA CAAAGCCAAC TTCGCTATCC    157260
     TGTATTGGTT CGGGTTGCGC TTCGAGCCTC GCTTCACAAA CCTCGATGAC CAGTTGCAGG    157320
     AATTGTATTG TATCGACGAC CCGGCGCTGT ACGAGAAATG CCTGATTCAG CCGATCGGAC    157380
     AAATCGATCG GCAGCTCATC ACCAGTGAGA AGACAAATAT CGATCAGATC GTCGCCACGC    157440
     TGGGCCTCAA AGAGATCACG CAGGGCTCGC TGATCCGCAA ACTATGTACG TACTCGCAGG    157500
     AAAACCCGAC ACGTCGCGCG ATTTTTGAGT TCGATAAGCT CATTCGTACC ATCTACACGT    157560
     TGCGTTACCT GCGCGACCCG CAGCTCGAGC GAAACGTGCA TCGCTCCCAA AACCGCCTCG    157620
     AGTCTTACCA TCAGCTTCGT TCGACCATCG CCCAGGTCGG CGGCAAGAAG GAATTGACCG    157680
     GCCGCACCGA CATCGAAATC GAGATCAGCA ACCAGTGCGC CCGGCTGATC GCCAACGTCA    157740
     TCATTTTTTA CAACTCGGCG ATTCTGTCGC ATCTACTGAC GAAATGGGAG GCCAGTGGCA    157800
     ACGCCAAGGC GCTGGCGCGG CTTACGCAGA TATCACCGGC AGCCTGGCGG CATATCCTTT    157860
     TGAACGGGCA CTACACTTTT CAAAGCGACA ACAAAATCGA CCTGGACGCG CTCATTGCAG    157920
     GGCTCGAATT GGAGTGATCG AATTTTCGGC GGTTCTGGCT TGGAATCCCT TATTCCTGTT    157980
     ACGGTGGAAT ACGATGCCAC AACCAGGTAA TCCTTTACCC CCAGCCGTGG TCAACACCTG    158040
     GCGACTGAGC GTCGGCACGT CGCTGTTCGT GATCGATATC CTGGCCGACG GCAGCTGGCG    158100
     ACCGGCGTAT ATTGCGCCAA AGCGGCTGGG TGGCTGGACG ATGGATGTGT TGCCGAACAT    158160
     GCCGCCGACG TTAGTCGATA TCGCTCCCTC GGTACGCACC TGGGCGCGAC AGTACGGCGC    158220
     GAATGTAACG AACCGGCGCA CGCCGGCGCG CCGGTTTCCC GCGCAAACCG CTTCTTCGAA    158280
     CAGGACGCCA GAATGAACAT GCTGAAACGT CGTCTCGATG CGACAGACGA AAAGCTGCAG    158340
     GAGCTGAAAA CAGCCCGCAA AGCGGCAGCT AAGGCGCAGC GCCAGCAGGT CAAGCAAACG    158400
     CGCGCGGATC GCGAGCGAAA GATCATGCTG GCCGGCGAGG CGTTGCTGCG GCGTGTCGAT    158460
     CGCGGCGAGT GGGATGAAGC CGATTTCCGC GCGATGATGG ACGATTATCT GTCGCGGCCC    158520
     GCCGATCGCG CGCTGTTCGA GCTCGACGAT GTATAGCCTT TGATGTTCGA CGTCGACGCA    158580
     CCGCACAGCC AGGTCGGCAA ATGTTGATTT GATTCACGAT GAAGGATGCC CGATGCTGCC    158640
     AACGCTCCGC ATGAACCGGA ATTTTGTCGA GGCCTTGCTG GCCGAGCGCG CGCCCTGCTT    158700
     TGCGATGGGA CTCGTGGCCG AGGGCCAGAC GCACTATGCT TGCCTGGCAC TGCGGCCGGT    158760
     GGATGACATT CCGAACGACG TAACACGCAG CGGTTTCAAC TTTGGCCACT CGATACGCGG    158820
     CACCGACGAC TTCGAGGTCG TACACTTCGG CTTAGAGTTT TACGGCTACC GCATCTTCAA    158880
     TGCGCTGATC AATCCGAGCA ACTTCATCGC CAGGACAATC CTGTCGCACA TGGTCGACAC    158940
     GAAGGCGTTT TTCTTCTTCG CGGTCAACCC GTCAGGCGGT GTGACGGTGT TCAAGTCCGG    159000
     CATCGGTGAA TGCAGCCTGG ACAGCATCGA GTCTAATCTC GAGCGGATAC TGCGCTCGAG    159060
     CACGTCCGAT GCTCAGTACG ACGCGGCGCT GACAACGTTC AGCGACCATC CAGATCCGGT    159120
     CGGGCCGATG CTGCACTGGG TTTGCCGGGA CTGCGAAGAT TGTCTCGACC TGTCCCACAA    159180
     TGTAATCGAA CTGGGCCCCG CGTAACGGTC CTGATGGTCC GTGTGACCGA GACCGTCATG    159240
     TCACTCACCG GACGTCGCTC CAACATTCTT CGGCTGGAAT AAGCCGATTA ATGTTCACAA    159300
     TGTGGAACGA CGGAATTTTC TGGGGTTCCG GCGTAGATCC CCAGTCATGT GCGGGAACAG    159360
     CCCGTAGTCC TGCGGCGTAT AGCCGATCTG CCGTCGCTCG GGCGGCAACG CGCCGAGATC    159420
     CAGCTGGCCG AGCATGACTG TACCGCCTTC ATTTTGCTCG AGTCCCGCGA TCAGCCGCAA    159480
     TGCGAGTGAC TTGCCGGAAC CCGATGGTCC GATGATTGCG AGCCGCTTCG TGGATGGGGT    159540
     CCAATTGAGA TCGAGACTGA ACGTGCCGAG GCGCTTCGTC AGTTGAACGG CGAGGCACGG    159600
     GTTCGGTAAA GCGTCAGCGA TCACGGCACG CGGCGGTGCA AATGGTGGTT CGTCACCATT    159660
     GACGGGGGGC GCCGCCGCGT CGATCCGCGC GCCGCGGCTG TATACCGACA ACATGGCGCA    159720
     GATGACGGCA ATGGCCAGCG TGGGCAGCAA CAGCGGCATC ATCGCCGGCA GTCCCTGCCC    159780
     GCCAAATACG ACATAGGTGT ACACGGGCAA TGAATAGGGG TGATAGGCGA CCATCACCGT    159840
     CGCACCGAAC TCACCGAACG CGCGTAACCA GGCAAGCGCG AGGCCGGCGC GGATCGCGGG    159900
     CCATGCCGCA GGCAACGCAA CCCGAAAGAA CCGATTGCCC GCGTGATGCC CGAGCGTGGC    159960
     GGCGACGTCT TCGAACACCG GGTCGATCGA AGCAAACGCC GAGCGGGCCG CAACGATCAG    160020
     GAAGGGCGCG GCGACGAACG TTTCCGCGAG CACGATGCCT GCGAACGAGT CGGTGAGTGC    160080
     CCCACCTGTC ACGCGGCCGA CCCAGCTGTA AGGGCCCACC AGAAAGAGCA GCAGCACCCC    160140
     GCTCGTCAAC GGCGGCAACG CAAGCGGCAA TTGCACGACA AAGCCGAGCA GCGCCATCGC    160200
     CCGGGAAGAT GACCGCGCCA GCCAGTACCC GAGCGGCACG CCACCGACCA GAATGAGTAG    160260
     CGCGGCGACA CTCGCACTGC CAGCCGAAAC GGCAACCGCC GACCAGGTCG TGCCCCAGTC    160320
     GACGCCGGCC CAGTCGGCTT GCCCGATCTG TGGAATGCTC GCGACGAAAG GCGCGCACAG    160380
     ATACACCGCG AGCAACCCCG CGAGCGCGAC GAGGGGCCGC GCCGTTGAAC GCTTCATTGT    160440
     GCCGCGTCGA TGACAGCCTG CAGCGACGGC GGCACCGCCT GCGCGTTGCC GGCGACCGTC    160500
     GGTTTGACCA CGTCGACGCC GTGCTCCTTG AGCAGCGCGC GCCCCTTTGC GCTCAACAGG    160560
     AAATCGACGA ACCGGGCTGC ACCGGCCGGG TTGGGCGCAT CTCCGAGGAT GGTCAGTGTG    160620
     TAACGCGCCT TTGCCTGCAG CTCGGGCGCC GGCCGTACTG CAGGAATCTT CAGATCAGAC    160680
     GTTTCCGTCG AGTAAAAGAA TCCAGCGTCG AGCTGGCCCG ACTGCAGACG GCCGACCAGT    160740
     GTCTCCTCGG GCAGCACCTG TTCGGGATTC TCCGGTGCGC CAAGCGTCTT TTCGACGAGA    160800
     TCCGGCTGAT GGTAGAAGTC CGCGGCCTTC TTCATCATGT CGACGGTAAA TGCACCTTTG    160860
     GGATCGAGCT TCGGGTCCGT CCGACCGATG CGAATGCCCG GCTCCCGCAG CACCTGATCC    160920
     CACCGTTTCG ACTTGAATTC CCCCGCAAAG TGGCTCCGCG AGTTATAGCC GATCAACAAC    160980
     GGCGACTCGG CAAAGTTCAC GTACCACGTC ACGTGATCAC CGTTTGCGGC CCCCATCAGA    161040
     CCATCGTTGA CCTTCGGGCT CGCGCTGATG AACACGTCGC CGCGCCGCAG CTTGCCCTTG    161100
     ATCTCGTTGG CAATCTTGTT CGATCCGGCC GCGTACCCGT GGAATCGCAG GCCTGTGTCC    161160
     TTTTCGAATG CGGGACCGAC GCTGCGCTCC ATCACGTTGA CGAGGGAGCC TGCATAGAGC    161220
     ACATCGACGG TACCTTCGTA GGCGACACTG GTTTTTGCGA TCAACACTCC CGCCAACATC    161280
     GCGCAGCAGG CAAGCAGCTT GCGCCCCATC TCCATCCCCC ATACGCCGTT ATGAAGTTAC    161340
     GTATATTACG GCTAATTGGG GGCGTTCATT GGCGGTCCCT GTTCCCGCCA CCCAATCCGC    161400
     TTGGAACTTT GCGGCATCTC GCTCGTGATG TGGGTGACGG GACGGGACCG TTGGCGACAG    161460
     GCGGCACTTC GTTTCATGAC GAAGTTTCCG GATCGTGAGC AGCGATCCGG AAGCCATCAG    161520
     TGATCCACAG TGCAATGTCT CCGTTCAGGT AGCGCGCAAT GAAGCCCGAC TGCGCAAGCA    161580
     TCACTGTACA CATTTGACTT CGCTGCTCAC CGTGCGCGCA CTACACGGCC ACAGGACGTG    161640
     ATTTGTCGAG ATTGCTCATT CAGTTGCCGA TGTCCTCAGG AGGCATACCA TCGCGCAGCG    161700
     GATCGAACGG CTTGAATCCT TGTTGAGTGA GCGATATTCG AAGTCAGGCG AGGGTCGTGT    161760
     CGGAAACCGT CGCCGCCAGC GGGTGGCGCG AGATCTTGAT GCTGGTCACG CCCAGCATCC    161820
     TGGGGAGCTG ATCGCTCGCC ACTGTCAGCG GGACGGGTCC AGGACCATTG CCGGCCGTTG    161880
     GTATCGGAAA GGCGGTCGAG CGCGCGGTAT GGAACGTGAC ATTCCCCTCC ACCTTGGAAA    161940
     CGATCTGATG GATATGTCCA TTCAGGACGG TGACCGAGCC GAACCGCTTC AGATAGCTCA    162000
     TCGCCTGGCC AGCATCGCCG GTGCCCCAAC CCCACGGGGC GTAAATCGTC CACATCGGCA    162060
     TGTGGGCAAA GACGACGATC GGCGTGCTGG ACGAACGCGC TTTCAAGTCG CTTTCCAGCC    162120
     AGGAAAGCTG GTCCTCGCCC AGACTGCCCA GCGCGTTTGG CGCGAAATGC AGCACGTTGA    162180
     CGAGCCCGAT GAAGTGCACG CCATTGTGGT CGAAGCTGTA ATAGCCCCGG TTGTCCGAGG    162240
     CTTTGCCGAA GCGTTTGAAG TATTCGCCCT GCGGTCCGTC TGTCACATCG TGTTCGCCGG    162300
     GCACGGTATG CAACTCGGTG ATTGGATTGA GCCCCGACAA CAATTGGGCC GCGAGGTCGA    162360
     ACTCTTCCGG CTTTGAAAGA TGGGTGATAT CGCCCGTATG AATCGCCAGC GCCGGCTTGA    162420
     TCGGCATGGC GTTGACGTAA TCAATCGTCT GTTTGAGTGT ACCTGCGACG TCTGGATTGG    162480
     CTTCCTTGTT GAAGCCAATA TGCGAGTCGC TGATCTGCAG GAACAGCGGC ACGACCGAGG    162540
     CCGCCGCCTT GTCCTTGCTA CTGGCGGCGA GCGCTAATTC CACGGGCGTG AGGACGCCTC    162600
     CGGACAGGAC AAACAGGGTG CCCGCACCAC CGAAGGCGAG GCATTTCAAG GCGCTGCGGC    162660
     GCGACGGCCG GGAAGGAAGA TCTGACGACA TGGTGACCTC TCGAATGGAA TCCGGAGGTA    162720
     AACCGCCGGT TCGCCCGGTG GGCCTCCAGA GCTGGTTTCA AGAGCAATAC CGCAGAGCCG    162780
     TCCGTTTTAT TCCCAGCTCG GAAAACGCAT AGCTGGACGA CTCGCGGCTC GTGTCGCATT    162840
     TCCTTGGAAC TCAGCAATCG ACGGACCATC GACCGCTGCC GACGTCCAAC ACCTCGACCA    162900
     AGAGGAGGGC CACACCGAGA TCAGCATCTC ATTGCGCCCT TCGCTGGGAT CGCTATAGTC    162960
     GACCATAGGA GTGCAGGCCG GCAAGAAACA TATTGACCCC AAGGAAGGCG AAAGTCGTGA    163020
     CCAATAGCCC ACCAAGTGCC CACCAGGCCG CGATCCGGCC GCGCAAACCC TTCACCAGAC    163080
     GAAGGTGGAG CCATGCGGCG TAGTTAAGCC AAACGATCAA TGCCCACGTC TCCTTCGGGT    163140
     CCCAGCTCCA ATACCCACCC CACGCATCGA CCGCCCATAA AGCCCCCAGA ATTGTCGCAA    163200
     TCGTGAAGAA CAAGAAGCCA AGCGCGATTG ACTTATACAT CACGTCGTCC AGCAGTTCCA    163260
     AGCTGGGAAG CCGGTCAACA ATGAGTCCTC GGTCCTTCAA CAGATAACTG ACGGCCACCA    163320
     TGGAAGCCAA TGCAAATCCT CCATAGCCAA TAAAATTGGC TGGCACGTGA ATCTTCATCC    163380
     ACCAGCTTTG CAGCGCGGGC ACCAAAGGCT CAATCTGATC TGCTTGACGT GAAAATGTAT    163440
     ACCACAGCAA AAATCCGATA GACGCCGATA TCACCAACAA AACGAATGGA CCGACCGCGC    163500
     GAGTCTCATA TCGCTCTTCG TAGTAAAGAT AGAGCATCGC CGTGATGAGG CTGAACAAAA    163560
     CAAAGACTTC GTACAAGTTG GACACCGGGA TGTGTCCGAT GTCCGGGCCG AGCAGGTACG    163620
     ATTCGTACCA ACGAACCATC AGTCCCGCTG AACCGAGAAC GGTCGCACTC CAGCATAGCT    163680
     TGCTTCCGAG GCTGAAACCC AGTTCGGATT TGAACACAAG CCCGCCCCAG AAAAAAGCGG    163740
     TCGACAGGAA AAATAACGTG CACATCCACA ATATCGCAGT GGGGCTTGAA AGCAGGTACT    163800
     TGAGAAAGAA ATTGCTTGCA CTGTGAGAAC TGTCACCTGC ATAAAGAAGA ATCGCTGAAA    163860
     GCGAGAGAAT AGCGATGAGC ATCAACGTCC ATCGTGCCGC TTTCCAATGC CAGCCCAGCA    163920
     AGATAGACGT GGGGGCGGTC AAAATCAGAA TTGTTTCCTC ATACACATTC ATGTATTCGT    163980
     GATAGCGCAT CAGGGCAAAT ACTGCGCCGC CGACTATCAG TATGGCGTAA AACCAATCAA    164040
     ACGCGGATCG CCCTGTGAGA AGTGATCCCG AATTGTCGTT CGATATATAT TCCATGCTAT    164100
     CAGATTCCGA TATTGACAGT TCGTTGAAAC GGATTGGGGT GCCATCGATC TCACAATTTC    164160
     TCCATTTTTA GCTCTGCCGC TTTTTTGCCG TCATATGAGA GATAAAATGA CTTATTGACG    164220
     ATGGGTGGGT GATGCTGTCC GTCTCATGAT GGATTGCCTG GGGTGTGGGA AGTGACGGGA    164280
     AGGCCGTCAG CAAGCCACTG TGCAAAGCCC CCCTCCAGGT AACTGGCAGC GAAGCCTAAC    164340
     TGCGCAAGCG TGGCTGCGCA CATTTGACTT CGTTCTTGAC CGTGGGCGCA GTACACAACT    164400
     ACCGTACGAG ATTGCTCGAG ATCACCCATC CAGTTACCGA CGTCTTCAGG GGCATACCAT    164460
     GACGCGCCGA TGATTATTTT CCCGCTCTCA TTGAATGCGG ACTTTCGCCT TACGTCAACA    164520
     ATCTGCGGTG GCTGGTTACT TTCCAGTGCT GCCAGCAGAT CGCGCGAAGA TACTGCGATT    164580
     GCGGTCGTCA TGATTTTGCA CTCCTATAGT TCAAAGTAAG GCATACGAGA CACAATTGAG    164640
     ACTTAGTTCA GGCCAATCGA TATGCGGAAT CGCTGGTACT AACCGCGCGC GTCAGTTGCT    164700
     GTGATTGCCG GGACGGGCGA CGTATACTCC TGCCAGCCGC GATCACCAAT CAATGGCTCC    164760
     GGTCCGGACT GCTTCGGATA CTGCCAGCGG CAATGACTTG CCCCTTGTCG CGATACTCGA    164820
     CCTCACGCCC CTGAGCATAA ATATCGAGGC ATTCTGGTTC CGATATTCTC TCGGACCGTA    164880
     CCAGGCATAG TTGACCGTTC CTGACGAACC AACGCCCGGT TTTTTCTCGC CCCCTTTCCA    164940
     CCAAGACAAG ACGCCCGTCC GGTAGATAGT GATGCAGCCA GTGCGCGTTG TCGGAGACGT    165000
     ACTTGTTGGT CAGCTTGGCG CGAATTTGCG CGGCGCTCAG CAGCTTGAAC GAGGCATTCT    165060
     GCGCGATGGC CTCGCTCGAT CCGATGGCAA ACAACGCCAA CGCCAGAGTC AACGGCGACA    165120
     TCCATCGCTT TCGCACCATC GCGAACGGGG CTGTCTCGCC AACTTTCACT GCGTCGTTCG    165180
     AATTCACACG CAAAAACAAT CGTCGGCTTC GGACAAGCGA TGCAGCGATG CGGCCGTGCG    165240
     AGACGCCCGA TCGGGACAGG CGTGCACGTT CATCAGATGT TTGCATGGGC GACATTTCCT    165300
     GTTTTCGTAT CCACCGTACA TGGATAGTTC TCGTTGCCGC CAATCATCGT CTAGAGGGCG    165360
     AGGCCGGCAC ACGGCGGGTC GCCACTGACT CGTTTGCAGC GGTTGCCATG GATTCTACTT    165420
     GTAGATTTCG GTACATGCCA GTAGCATACG TGACATGACA TCAATTTCGA CATGGTCGCT    165480
     CCTTGTTCTG ACCCTGCCCA CGGAAAACGC AACGGCCCGG ATGCGTTTCT GGCGCGCGCT    165540
     CAAGGCAAAG GGCGCGGCGG TGCTGCGCGA CGGCATTTAT CTGTTACCCC ACACGGAAGA    165600
     ACGCGAGCAG ATGCTGCGCG AGTTGGCCGT CGCGATTGCC GACAGCGGCG GCACTGCGCA    165660
     TCTCCTGCGG GCGCCCAGCC TCGATGCGTC GCAGGAAGCG GAATTCCGCG CACTGTTCGA    165720
     TCGCAGCGAC GACTACGCGA CGTTCATCAA TTCGCTGGCG GACGCGCGCA AGACGGTCTC    165780
     CGGCCAATCT GCGACCGACC TGACCCGGCT GTTGCGACGT TTGCGCAAGG ACTATGAGGC    165840
     GCTCGTCGCG ACCGACTATT TTCCCGGCGA CGCGGCGACG CGCGCCGAGG TCGCGTTGCA    165900
     GGACTTAACC GCGCTCGTCG ACACCGTGCT GTCGCCCGGA GAGCCGCATC CCGCGGAGCG    165960
     AGTCATCCGC CTGCTGTCAT GCGACGCGTA TCAGGGCCGC ACATGGGCGA CGCGCGAGCG    166020
     CATGTGGGTC GACCGCGTCG CCAGCGCATG GCTGATCCGC CGCTTCATCG ACGCCGACGC    166080
     CCGCTTCGTC TGGCTCGCGT CCCCCGGCGA CTGCCCGCCG GACGCGCTCG GCTTCGACTT    166140
     CGACGGCGCG GCGTTCACCC ATGTCGGCGA ACGTGTGACG TTCGAGGTAC TGCTGGCAAG    166200
     TTTTGGGCTC GACAAGGATC AGGCGTTAGT ACGGCTCGGC GAGATCGTGC ACGCACTCGA    166260
     CGTGGGCGGT CCCGCCGCAC CCGAAACGGT CGGCTTCGAG GCCGTGATGG CCGGCACGCG    166320
     CCGACGCGCG GAAAACGACG ATCAGTTGCT CGAACAGATG GGCGCGGTGC TCGACTCGCT    166380
     GTATGCGCAC TTCGCCTCGA ACGGAAAGAA CGAAACCGGG GGACGGTCAT GACCACGACG    166440
     GTAGCGACAA ACGCGCCGAC CTATTCATTG GGCCAACTGG TCGGCTACAT GCTGCGCCTC    166500
     GGCGCGCTCG GCTTCGGCGG CCCGGTCGCT CTCGCCGGCT ACATGCGCCG CGATCTCGTC    166560
     GATCAGCGCG GCTGGATCAC GGAAGCGGAC TACAAGGAAG GAATGACGCT GGCCCAGATG    166620
     GCACCGGGTC CGATGGCGGC GCAGCTCGCG ATCTATCTCG GTTTCGTTCA CTACCGGCTC    166680
     CTTGGTGCCA CGCTCGTCGG CTTTGCGTTC GTACTGCCGT CGTTCCTGAT GGTGGTCGCG    166740
     CTCGGCTTCG CGTATGCGCA CTTCGGCGGG CTGTCGTGGA TGCAGGCCGT GTTCTACGGC    166800
     GTCGGGGCCG CGGTGGTCGG CATCATCGCG ATGAGCGCGT ACAAGCTCAC GACGAAGACC    166860
     ATCGGCAAGG ACAAACTGCT TTGGACAATC TTTCTGACGC TCGCGGCCGT GACGTTCATC    166920
     ACGGAGTCGG AAATCGCGTG GCTCTTCATC GTCGCCGGAT TGATTTGCTG GTTCTGGCGG    166980
     GCACCGCCCA AGTGGCTAAA CAGGGGCGGC CTGAACGCGA TTGCGGCCGC CAACCTGCCG    167040
     ATCGCGAGCA ACCTGCTGAG CGGCGTCGAC CTCTCCGTGC TCACGCAGAT CGGCATCTTC    167100
     TTTACCAAGG CCGGCGCGTT CGTCTTCGGG TCCGGCCTTG CGATCGTGCC GTTCCTGTAT    167160
     GGCGGTGTCG TCACCGAACA TCACTGGCTA AACGACAAGC AGTTCGTCGA TGCCGTGGCC    167220
     GTCGCGATGA TCACGCCCGG CCCGGTCGTG ATTACGGTCG GCTTCATCGG GTATCTGGTC    167280
     GCGGGCTTTT CGGGCGCGCT CGTTGCCGCG CTCGGCACGT TCCTGCCTTG CTATCTGTTC    167340
     ACCGTGATCC CTGCACCCTA CGTCAAGAAG TACGGCCACC GTCCCGACGT CAAGGCGTTC    167400
     GTCGACGGCA TCACGGCGGC GGCGATCGGC GCGATCACGG GCTCGGTTCT CGTGATCGCG    167460
     AAGCGCTCGA TCGTCGACAT CCCGACCGCC ATCCTCGCAC TTGCAACGGT CGTGCTGCTC    167520
     TGGCGTTTCA AGAAGCTGCA GGAACCGGTG ATCGTCACGG CCGCGGCGCT GATCGGCCTC    167580
     GTCGCGTATC CGCTTATTCA TTCGCACGCC ATTTGACTGC GCGTGCGTGC AACTTGTGAG    167640
     GAAAGTGATC GTGGCAATAC CTTGGATCGT TCTGCACAAC ACCACCGCTG CGGTTGCTTG    167700
     CGTCTTCTGG ACCGGGCGAG TACTGCACGG GCCGCGTTGA TTGACCAAAG GCAATGGAAA    167760
     CGGTCATGCG GCTTCAGCTC AAATCGACAT TACTTGCCAC CGTCAACACG AGCGGCGCGC    167820
     AATGGATCGT GCCAACCAGG CTGGCATTAG CCGTCCTCCT GCTTTTCCCG ATCGACGGAA    167880
     GTATCCAGCA CCTGTTCGCC TTCCGCGTTG CCGATCTTTC GGCGCTGTCG TTCAGTTCGG    167940
     CTGCCCTCGG CAAGGCGCTT CGCGCCATTG AGATTCTCGC CGGACTGAGC TTCGTCGCAG    168000
     GACTCGGTGC CAGATTGGCC GCTTATCCAA CTGTGGTCAT TTTCGCCGTG CGAGCGCTCG    168060
     CCAATTCTGC GAACTCGTTC CCCTGGTTAC GAGACGCCAT GAACGGCGTG ATCGTACCTC    168120
     ACGGCGACTG GGGCTATGGC GCGATGTATT TCGGCGTTGC GCTGCTTCTC GGCGAATTCC    168180
     TGGATGTGGG CAGCGGCCGA TGGTCGATCG ACTACTGGCT TTCCCGGAAA CTCAAGGAAT    168240
     CCGGCGAGCC CCGCTCAGGG CGTTGAAAAG ACGCAATCAC GTTTAACTTG AAAGGAGGTA    168300
     CCCATGAACT GCGAGATGAA ACAGCTTGCC TGCGATCCCT CCCGGCTGGC AGGTCTGTCG    168360
     GAAAAGCTCA TCGTCAGTCA CTACGAGAAC AACTACGGCG GCGCCGTGAA ACGCCTGAAC    168420
     GCGATCACTG CGCAACTTGC CAGCGTCGAC GTAGCCAGTG CGCCCGTCTT CGTCGTCAAC    168480
     GGACTCAAGC GTGAAGAACT CATCGCTGCG AATTCCGTGA TCCTGCATGA GATCTACTTC    168540
     GACTGTCTTG GCGCCAGCGG CAAGCCGGCC GGCGATCTCG AAGCGGCACT CACGCGCGAT    168600
     TTCGGCAGCG TCGAGCGCTG GGCGGCGGAG TTTTCCGCGA TGGGCAAGGC GCTCGGCGGC    168660
     GGTTCCGGCT GGGTGCTGCT CACGTGGTCG CCGAGGCTCG GCCGACTCGT CAACCAGTGG    168720
     GCGTCCGACC ACACCCATAC GCTCGCGGAC GGCGCGCCCG TTCTCGCGCT GGACATGTAC    168780
     GAGCATTCCT ATCACATCGA TTTCGGTGCG AAGGCGGCAG CGTACGTGGA CGCGTTCATG    168840
     GAGAACATCA ACTGGACAAA CGTCGCAGAC CGCTTCGCTT CAGTGAGCGG CTGAGCGTCG    168900
     CGCTGCACAT CACCGATCAA CTAATCCAAT CAATCAATTC GATGGAAATG AATTCTGTTG    168960
     GGCCGCCGCG ATCCGATGTT CCGGTTTTTG AAGCCCCCGC GCATGAACGG CATGGCGTCT    169020
     CGTTCCGTGA GGCATTCTGG GTGTGGGTTC GCGTTGCCGC GCTCAGTTTT GGCGGCCCCG    169080
     CGGGGCAGAT CGCCGTGATG CACCGGATCC TGGTCGAGGA AAAGCGCTGG ATCAGCGAAA    169140
     CGCGCTTTCT CCATGCGCTG AACTATTGCA CGCTCGTACC CGGCCCGGAA GCTCACAAAC    169200
     TCGCGGTTTA CGTCGGCTGG CTGCTGCACC GGACACGCGG CGGCCTCGTG GCCGGCATCC    169260
     TGTTCATCCT GCCCGGTCTC GTCGCGCTTG GCGTCCTGAG CTGGATCTAC GCGACCTATG    169320
     GAGACGTCGG TTACGTTCAG GCCTTGTTCT TCGGCCTGAA GGCAGCCGTG CTTGCGGTCG    169380
     TCCTGGAGGC GGTGGTGCGC GTCGGCCGGC GTGCGTTGAA AACCCGCACG ATGGTCGCCG    169440
     TCGCGGCGCT ATCGTTCATC GCGATCTTCT TTTTCGCGGT ACCGTTCCCG GCCATCATCG    169500
     TCGCGGCGGC AGCAGTCGGC CTCATTGGCC GCGCGACCGG CGCCATGTCG CCGCGTGGCA    169560
     CTGCCGCACA ACGCGAGACC GAGCACGACG ACGGCCCGCT GCCCGCCATT GACGCCGCGT    169620
     TCGCCGTGGA GATTCCCGAA CACGTGCGGC CGTCGCATGC CCGTGCGCTG AAGGTGACAG    169680
     CGATCGGCCT GCTGCTCTGG CTCGGGCCGC TGTTTGCCTT TCTGGCGACG ATCGGACCGG    169740
     ACAGCGTGTT CACGCACATC GCCACCTTCT TCAGCAAGAT GGCGGTGCTC ACCTTCGGCG    169800
     GCGCCTATGC AATCCTGACC TACGTTGCAC AACAGGCCGT CGATCACTAT CACTGGCTCG    169860
     CCCCCGGCGA GATGCTCGCC GGTCTGGGCA TGGCCGAGAC GACGCCAGGG CCGCTCATCA    169920
     GCGTCGTGCA GTTCGTCGGC TTCATGGCGG CGTTTCGGCA ACCCGGCGCG CTGGACCCGG    169980
     CGATTGCCGG CACGCTCGGC GGCATCCTCG CCAAGTGGGC AACCTTTGCA CCGTCGTTTC    170040
     TGTTCATTTT CATCGGTGCG CCGTATGTCG AGGCGCTGCG CCACAACAAG GCGCTGAATG    170100
     CCGTGCTCTC GACCATCATG GCAGCCGTGG TCGGCGTGAT CCTGAATCTG GCGATCTGGT    170160
     TTGCGATTCA TACGCTGTTT GCGCAGGTGG ACGTCAAACA GGCATTGGGC ATGACGCTGC    170220
     AGATTCCCGT GCTGTCGAGT CTCGATCTTT GGTCTCTAGT CCTTTCGGCA GCAGCCATGG    170280
     TGGCGCTGTT CCGCTTCAAG CTCGGCATGA TGACCACGCT TGCGGGATGC TGCGTCGCCG    170340
     GGATCGTCAT TCACATGATC GGGTAATTCG ATGAATGGCT TTGCCGGAGC GTGCGTTGCC    170400
     GGTATTCAAC AGGTGGCGGC CGTACGTTCC GGCGCGAACC AGGGGCAAGT TAAGCCCCGC    170460
     AAGGAGTAGG TTATGAAACC ACTATTCAGA TTCCTGTCTG CTACCTCGCT CGTCGCGCTG    170520
     TGCATTGCAC TGGTGGGATG CGAAAAGAGC CCGTTCGAAA AGCAACCCGG CGAAACGGTT    170580
     GCGATTGCGC AGGTACCCGC CGCGGTGAAA GCAACGATCG ATCGGCAATC GCAGGGCGGC    170640
     AGCGTCAAGG AAATCGAGAA ACTGACCCGG AACGGGAAGA CGTTCTATCG GGCGTCGGTC    170700
     CTGCAGAACG GCCAGGAGCA GAAATTCGTC GTCGCCGAGG ATGGTGCGCT GATGGCCACG    170760
     CGCGCGGGTG ACGACGAAGA AGACGATGAC TGACTGGAAA TTCGGTATTT CACCCCTCAG    170820
     GACAAGGAGT CCATCATGAA ATGGGTTACC CGTGAACGGC CGAAGATCGA CCGCATTGCC    170880
     TGCCCGTGGC TCATCGCCCG GTTTATCGAC AAGCAGCCGG AATTTCTCTA CGTGCCCAAC    170940
     CGGGACGTGC TGCGGGTGGC CGAGGAGACC GGTGCGATTC CCTACGACAT CCCAGGCGTC    171000
     GAACTATCGC ATGTCGACGA TCTGTGCAGT TTCGATGCGT TTCTGAAGAA ATACGGTCTG    171060
     GAGGACTCAG CGCTGCATCA GCTTGCGACC ATCATTCGAG GCGCGGACAC GTCGCGCCTC    171120
     GATCTGACGC CCCAGTCACC CGGGTTGTTC GCGATTTCGC TCGGGCTGTC ACAAACCTTT    171180
     TCAGACGACC ATGAGATGCT CCGGCACGGC ATGGTGATGT ACGACGCCTT ATATGCCTGG    171240
     TGCCAGCTCT GCCAGGCAGA GAAGCACAAC TGGCCGCCTC AGATGAACTG AGATCCCTTA    171300
     CTTTTATCAG GAATGCTAAT GCTAAAAAGA TCGCTTTTTC GTCGAACCGT CCTCGCCTCC    171360
     CTGTTTGCGC TCGTTGCGGT AAATGCCAGC GCAGCGGCCG GTTCGCCCGC CATGGACACC    171420
     ACCAGCATCG AGCAGGTCAC TGGCCTGAAA GGGACATTTT CCAAAGACGA GAACGTCTTC    171480
     AAGGTGACCA AGCCGCGCAA CGACATCAAG ATTCAGGTCG ACAACTGGAC CATGCCGCCG    171540
     TTCATGGGGC TGACGTCGTG GGCCGCGTTT ACGCCGGGTC ATCATGGACA GACCATGATG    171600
     ATGGGCGACA CCGTGTTGTT CGACGATGAA GTCAATCCGG CGATGAGCGC GGCGCTCGAT    171660
     GCGGGGCTCG AAGTGACCGC GCTGCACAAT CACTTCTTCT TCGATCACCC GCGGGTCTAC    171720
     TTCATGCATA TCGGGGGGAG CGGCGACGCG AAAACCCTCG CCGAAGGCGT CCGGAAGATT    171780
     TACGACAGGA TCGCCGAGGT ACGCGCTGCG CACGCCGAAC CGGCAAATGC GTTCCCTGGA    171840
     CGGATTGCGG ACGCCAGCAG CATTACCTCG GCTCCCCTCG AGGCGATTCT CGGCAGGAAG    171900
     GGCCAGACGA ACAGCGGCAT GTTCAAGGTT TCCATCGGCA AGCCGATCAG CATGCACGGC    171960
     GTGTCGGTCG GCAACGAGAT GGGGGTGAAC ACGTGGGCGG CATTCGCCGG TACCGACGAC    172020
     GAAGCCGTGG TCGACGGCGA TTTCGCGATG CGTGAAAGTG AATTGCAGAC CGTGCTGAAA    172080
     AGCATGCGCG CATCCGGCAT CAACATCGTC GCGATTCATG AGCATATGAC GGGCGAGACG    172140
     CCGCGCGTCC TGTTTCTCCA CTACTGGGGC AAGGGCAAGG CCGTGGATCT CGCCAAAGCG    172200
     GTCAAAGGCG CGCTGGTCGC TCAGGCCGGC GTCGAGAAAT AATCATGCTC AACCGGCGGT    172260
     GGCGGGCTGT TGTAATGGTC GCCTGATAAC CGCCGGACTA CCGGTCGATC ACGGTACGTT    172320
     AGCCAGATGA GGTCCATCAT GGGCTCGCTA TCGTTCCACG ACGAGCGCCG TTCCAGCAGC    172380
     GCGGCCAGCC ACGCGCTGCT GGAAGTCACC GCGCTCGCGA AGCATTTCGG CCAGACTGCC    172440
     GCGCTGGCTG ACGTTGGCTT CACTGTCGAC GAGCATGAAA TCCTCGGCAT CATTGGCCCA    172500
     AACGGTTCCG GCAAAACCAC CCTGATGGAA TGCCTCGCGG GCTTGCTCCC CGTCGACCGT    172560
     GGCACGGTGA AGTGGGCGGG GAAGTGCGCT GCCCCCGGCG CACCGCAAGG AGCGGCTGTT    172620
     CTACGTGCCG GACGGCGTGT TGCCATACGG CGAGCAAACG GTCGGGACCG TGCTTGGGTT    172680
     CTACCGCGAG ACCTTTCGCG CATCCGTTTC GCGGCTACAT GACGTGGTCC GGCAACTGGC    172740
     GCTCGACGAG ATGCTGGCCA GGCGTGGTAC CACGCTATCC AAGGGCTACC GGCGCCGTCT    172800
     GCTGCTCGCC ATCGGGATGC TGTCGCCGCA GCCATTGTTG TGTCTGGATG AGCCATTCGA    172860
     TGGCCTTGAC CTGCGCCAGA CGCAGGCGGT GATGGCCTTG CTGCGCGACG AAGTGCGAGC    172920
     GGGGCGTGCC TTGCTCGTCG CGATTCATCA GCTTGTCGAT GCGGAGCGCC TGTGCGACCG    172980
     GCTCCTGCTC CTGTCCGGTG GCCGTGTCCT GGGCGAAGGG ACGCTGGAAA CGTTGCGGGA    173040
     ACTGGCAGGT GTCGATGGCT GTGGCCTCGA GGAGGTGTTC CTTGCGCTCA CCTGATCCTC    173100
     GCTCGACCGC CGCGATACTT CCGGCGCTAT TTCGCAACGA GGTACGCAAT CTGCTGACCT    173160
     CGCGCGCGTT ATGGATCCTC CTGCTCATTC TGTCGCCGCT GGTTGGTTAT AGCTTCATTC    173220
     AGGCTGTGAG CCTGTTCGGC GAAGCGAGCC GATCGGCGCT TCAATCCGCT GAGCTGGCGC    173280
     GCGGCATGAC ACCGCTCGAC GGCATCCTGG TGCCAACCTT CGGCGGGTTC TATCTGGTTG    173340
     TGACCCTGCT GTTTCCGTTT GTCGCGATCC GCGCCGTCGG TCAGGAGAAG CAAAGCGGCG    173400
     CCCTGAAGCT GGCCCTCCAG TCACCGGTCC GTGTCCCCAC CCTGGTGGCC ACGAAAGTGC    173460
     TGGCGGTCGG TCTGGTGTGG CTCATCGTGT TGCTTCCGGC CGCTTCGGCA GTCGCAGCGT    173520
     GGCGGCTGCT GGGCGGCCAT CTGTACGGCC CGGAAGTGGC GGGTCTGCTA TTCGGGCATG    173580
     CGCTGTACGG ACTGGCGGTC ACCGCGATCG CGTTTTTTGC TGCGGCCGTC ACGGAGTCGA    173640
     TCGCGACCGG TGCAATCGTC ACGCTCGCGT TCACGATTGG CTCCTGGGTG CTGGATTTTG    173700
     CCGCGTCCGG GCAAGTCGGG TGGCTCGCGA AATTGGCGCC GCTTTCGCTC ACCGCGACGC    173760
     TGCGCGAATT CGAGCACGGC CTCTTTGCTT CTGCGGGGGC GCTTCGAACG CTGACATTCA    173820
     GCCTTGCCTT GCTGGCCCTG AGCGTTGTCT GGCTACCGCC CGGAACCCGC CTGCGGGCGA    173880
     AGCTCGCAAT CAGTATCGCG ATGCTGTTTG CCGCCGCGCT GCTCGTTGCT GGTGCCGGTG    173940
     AGACCAGGTG GTACGTCGAA CTCAGTGAGG ACCAGCGTAA TTCATTTGAT CCTGAGGATG    174000
     AAGCGGCCTT GCGCAAGATA ATGGCGCCTC TGGCGATCAC GCTATATCTG TCCCCCGACG    174060
     ACAGTCGGGC GCGCGAGATG GAAAGTGATG TGCTCGCGAA ACTGCGCCGC GCAGTACCTC    174120
     GGCTCACGAT CCGGTATGCA TCGGTGAAGG CCGGGCCGTT CGGTGCATCG GGCGACGACC    174180
     GCTACGGTGT GATCGTCTAT GAATATGCGG GCAAGCACGA GGAGAGCCGT TCGAACAGTC    174240
     CGCGCGAGAT TCTGCCGATC CTCTACGGTC TGGCCGATGT GACCGTGAAA CCGGGAGCGG    174300
     TGACGATCTA TCCGGGATAT CCGCTTGTCG CAGAACCGGC CGCGGCCGCG TGGTGGTTTT    174360
     ACGGCGCGTT GCCGGGACTG ATTCTGTATG GCTGGTGGCG AACACGAGGC GCTGCACCTG    174420
     CGCCACGTCG ATCCGGCCAG TCGCAACCGA GGGAGAAACA GTCATGAAGC TCCACGCAAT    174480
     AGCCTTGGCA TGCACGCTGG GCATGGTCGT CGCGCCAGCC GTCACGGCGG AAGATCAAGT    174540
     ACCGGCCCAA TCCGTGTCAA TCGATCTTGC TGCGGAAACA GTGGGTGCCG AGCCGGTCAA    174600
     TTTCATTGCC GCCGTGGGCA ACTGGCGGAT CGGCGCAGAC GGCAACCGCA AGGTGTTGAC    174660
     CGTCGATGGC AGCAAGTGGC AAAGGGGGCA GCCATCAGCC GGTCTGGCGG ACAAAGCACG    174720
     GGCGCTGTAC GGCGAACGGT ACGCGGAGTT CCTGGACAAC GTCACGGCAT ACGCCTACTT    174780
     CCCGATCGCC GTCGTGAAGC GTATCGATGA TTTTCGCGAT GGCGAGATTT CACTGCGCTT    174840
     CAAGGGCATC GCGGGACGAA TCGACCAGGG TGCCGGCATC GTCTTTAATC TGAAGCCGAA    174900
     CGGCGACTAT CTGGTTCTGC GGGCGAACTG TCTCGAGAAC AATCTCGTGC TTTTCAAATA    174960
     CGTGCATGGC GTGCGTAGCC CCGTCAAATG GATCCGCAAT ACCCCCACGG ACACCGGTCG    175020
     ATGGCACGAC CTTAAACTCG AAGTGAACGG TGTCAGCGTG AAGGGTTACC TCGACGGCAA    175080
     GCTGTATCTC GAGGACACGT TGGCTGCGCC GATCAGCGGC AGGATCGGCG TATGGTCGAA    175140
     GGCCGACAGC GTGATGTATT TCGACGATTT TCGGATGATC ACCGCGACGC GCCGACCCGT    175200
     ATCGTGATCA TGGTTCTTGG TCTTCTGCCT GTCGGTCGCC GGGCTATGGT CGGCGAAAGG    175260
     ATCAGCCAAG ACAAGAAGCA ATCAGGAAGT CGTTGAATTG ATTGAAAATT ATTTCGGGGG    175320
     CAGACCGCAA GCCATTGTCG GATCTAGATC GAGCAACACC GGTAAAACGC AACGAAATCA    175380
     AGAGGAGGCC TACACTTTCG TCATCACGAA GGAGCCGAAA ATGTCAATGA AGAAGCTTGC    175440
     CGCCAGCGGC GCAATCAAAA AGGTCGACAA ATTCCGTGCG CCGATCGGCA TGATCCACGT    175500
     GCGAGAGGAC AACATCCGCC GCGCCGACGC GCAGGAGAAC ATCGAACACG TCCGCTCGAT    175560
     CTACAAGGCG CTCGGGGAGC AGTTCAAGAC GGACCTCGAG CTCTGCACGG AAGAAGGCCC    175620
     GCGCAAAGGC AGCATGCAGC TCAAAAAGGG CCACTCGCTC TGCGTGCACG ACATCGTGGT    175680
     GGCGGTGGAC GAGAACGATC ACATCTCCTC GATCGACGGC AACTCCAGCA CGCGCGCACT    175740
     GAAGATGCAC GCGGAGGAAG GCATCTATAT CGACGATCGG TTCTTGGTCG ACGTGGTAAC    175800
     GCGAAATGTT GAGTCGCGTC AGCAAGTCAT CGTCATGATG ATCCGGAGCG GGATGGCGAA    175860
     GAATCCGAGC CCGCTCGAAT TCGGCCTCGC GTTCAAGGAA CTCCGCGACG GCGTTGATGG    175920
     CGGCGATAAG TGGTCGATCA AAGAGATTGC TGAGGAATTC GATCGCAGCG AAGTCAGCGT    175980
     GCGCACGCTG TTGAAGCTGG CCGACGCCGA CCCGCGTATT CACGCGCTGA TCGACGCAGG    176040
     GACCGTGTCG TCGAGTGTCG CGCTCGACGC GGTGCTCAAG CATGGCGACG ACGCGTACAG    176100
     CGTGCTCTCG GCCGACCAAC AGGAAGTGCT CGCGACGCAG GGTCGAAGCC GCGTCACGCA    176160
     GGGGGCGGTG AAAGGTCGGG CTCTGCCGGG CAAGCTCGTC ACGAGCGCCA TCGAATCGAT    176220
     CGAGGCGCTG AACGAGCGGC TGGACCACCG GACGCGTGTC GAGCTCGCGA AGCTGGAAAA    176280
     GCTGGATCCG GCGCAAATCA AAGGCAAGAA GATCGAACTG GACGCCGATC TGGTGCTCGC    176340
     CTTGGTGAAT GCCGGCGGCC AGATCAAGGA CCAACGTGAT CGTCAGGCTG AGCTCGCGCG    176400
     CGAAAAGCAA GCGGCCGCCG GGCAAACCAC GATCGAGCAG GACGGCTCGT CGGACGAAGA    176460
     GCGCGCTGCG GCGTGAACTG CATGCGAGCC AATCCAGTTG GGAGGCGAGA CGTTGACGCT    176520
     GACTGCGCGT GATTGCGCCG CCCGAGCTGC GGCCTATGAG CGATGCGCTG AGCATCTTGA    176580
     GGGCTGCGTT GCTGTCGACG ACCATGAGGC CCATGCCAAT GCATGGCTTG CTCGACAGCT    176640
     TCGCGCCGAG GGTAATGTGT GGAGGGAGCT CTCGAAAGCG CAGCTTATGA TTCGAGGCCA    176700
     TCTCGACTCG GCCGGTCCGG CCGTGGAGTC CACTCCGAAA GTAGGCAAAC CGTTGACCGA    176760
     CAGGATGCTT GAGACCTTGG TCGAGTTGGC GCGCGGCACC CGCGTCGAGA GCGAGGAGTT    176820
     CTTCGCTTGG CCACGGTGGA CGTTCCAGTC ATCGATCAAT ATGCGCACGT CGCTGGGTTG    176880
     TCCAACGCGA GTCATGCTGA AAGGCTTGCA TGAGCGCGGG CTGCTGGAGG TTCGCAAGGG    176940
     TAAGACGTGG CTGATCCAGA TCAATGACGC CGGTCGACAG GCCCTGATTG CCCACGATCT    177000
     GGTCAAGAAG TCGAAGAAAG CGTCGCCGTT CAAGCGCTAC AGCATCAGCT ATAGCATCAC    177060
     CCAACTCGGC TCAATGCGGA CAGCGGCGCA GCCTGTCACC GCAAGAACTG AAAAGGAAGC    177120
     GTTTGCGAAG CTGACGAAAT CGTTGAAGGC TCGAAACTCC CACTATGAGT ACACCGACTT    177180
     CAAGACGGAA TGGGTGAGCG CCAATGGCTG ACAACATCCT TCGCGAACTG CTGCGCAACG    177240
     AACCGAACCC GGTCGAGAAG TTGGCAAGCG AGCAGCAACA GCTCAAGATC CACAGTGGAT    177300
     GGTTTGGGGA GCTCGAGCAG CGAACTGCCC ATTTCTTGAA AACCGGGAAA CGGATCGTCG    177360
     CGCTGGAGTG CGGTCACTAT GTCCTGTCCA AGTCGCTTCA TCGCGCCGCG TGTCCCCGTT    177420
     GCGGCGAAAT GATCCGATCA GGCTATGACT ACGACGGATT CCGCAGGCTG GGTATGCCTG    177480
     ACGAGTTTCA CTGGCCGGAG GACCCGCTTC TCGTCGTCAA TGAGGGGGAG CGCCGTGACG    177540
     GGCATGACAC CATCACGCGG CGCCCCGTCA TTTAGCTTCT ACATTCGGCG CTGGCGCCTC    177600
     GCTTCACCCC CTCCTATTTT GCGCGACAAT GCGGGCATCG CTTCTTTGAC GGAGGGTCCG    177660
     ATGACGAAGG TAATTCGCGA GCCGGTTGAC GGCTGGTTGA TCCTGATGAA CGACGAAGTG    177720
     GGTAAGCGCG CCGCGCCGGG GTGCCTGTTC CGGTTTGGCC GTACGGCGTC GGACGGCATG    177780
     CATCCGCTCG TGGAAATGCT CCAGCCGGGC TGGGCGGCCG GCACGCGTTA CTTCGTCCCG    177840
     TTCAGAGATG AGGCGGGGGT GCGCGAGTTT CTGCTCGGCC TTGGCTTCAC GGAGATGCCG    177900
     CGCGTGATCC CCGGCGAAAG CACGCCCTAT TGGAATCTGG ACGGCAAGTC CTGAGCCAGA    177960
     TCACTCATCA CCTTTTGCCG TATCATCCGG TCCGCCACCT TCCCTGTCTG CGCCCACTGC    178020
     CGCCCGCCTC TTTGACTCGA CGGCTGATCC ACTGCCGAAA TCGCCGCCCA CGCGCCATCG    178080
     TTCCTTTTGG AGCAAGCAGC GCAGCACATT CATTGCCACG AGCGCGTCCT TGTACTCGTT    178140
     CCGAATGGCG CGATACAGAT CTTCTATCTC GCCCATCACG CGCCGCGCTC GTACCACCTC    178200
     AAGAATCACC CGCCGAACAT CAGGATCCCG CTCGCGCCGA TACAGTGCCA CCAGTTCGGC    178260
     ATGCATGGGT GAATCGAACT CCGGTAGTGG CTTGATCCCT TTCGGCTCGA CCTTGTATGC    178320
     CTCCCGCCAT GCCGGCGGCC CGATCCGCTC GCGCCGCGTG TGCTGCAGCC GGCGTCCGAA    178380
     GTCGTTCTCG AGGAGCGTAT GGCATCGCCC GGCCTCCGCC GGTGTCAGCC AAAACGGATA    178440
     GAGCTTTACC TCCCCGTCGT CGAGGTCGGT GTATTCGTAT CGATACTCCC AAACCGTCCC    178500
     CATTTTCATT GCCGAAACCT GTACAAATAT ACAGTATATG CGCATGTGAA AGCGGCGGAA    178560
     GACGCCGCGC CCAGACGTAA CGACACGCGG GAGCGAATCC CGGTCCAATT GCCCTCCTCG    178620
     GCCGCGTGTG TGGCTTCTTC TGCCCGGGGT AACGCGGTTG CGTGGTCGTG CCCCCGACTG    178680
     GCGCCGTCCG GTTGCTCCGA CTGACTTTCC AAGATTGTCG CCAGATCTAT CTATGTACGC    178740
     GTTTTCTCGT CTCAAAAAGA TTAAAAAAAG ATATGAAATT ATATCGACAT GTGATCGTCA    178800
     GACCCATATA ATCAGTCGAA ATTGCTTCAC CTTGGTTGTT TGCTTCCGGA GCGTCGTGTC    178860
     GCGACGTCTC ATGGGGGCGA TCCGTTCTAA CCGTCAACGG GGCATGTGCA GATGAAAGTG    178920
     ATCTCGGCGA GCGAAGCGCA TCTGCTGCTT CGTGCGGCAT TCGCGAATGG CAAGCATGGT    178980
     GGTCGCTGCG CGCAGTGGGC GCCGCCGGCT GATGGCGGAC GCGACTGGGT GCTCATCAAT    179040
     CTTCCGCTCG ACTGGGTGGC GCCGAATGCG GCCGCCGAGC GGTACGACAG CACTGTGGAT    179100
     GTGGATCGCG CACGCACCTA CGCAGCCAGC GTGGGCCAGT TCGCGCCGGT GCATCTGCTC    179160
     TACGGGGCGC GACTGCAGCG TCGGAACGTA CTCACCGCAG CGGTCATGGA CGGCGGCCAT    179220
     CGGGTGAGCG CGGCACGCAT GCGCGGCGAT ACGCGCATCC TCGCGCTGCT CGAGCAGCGC    179280
     CACATGGAGC AGCTTCTCGA AGCGCGCGCG GCGCTTTTGC AGGATCCAAT GGCCGTGCCT    179340
     CGTGCGACGG AACCTGCCAT CGACAGCTGT ACTGCTTGAT CCGCGCGAAG GTAGCCACAT    179400
     GAGCTTCGAA TACATCCGCA ACTACTACGG TGTACCGGCT GAACGTGGCC GCGCCGTCAT    179460
     CTGTTCTGGC AAGGCCGGCG TCATCGTGGG GGCGCACGAG CAGTACATCC GCGTCGTGCT    179520
     CAATGACGAC AAATCCGAAT GCGAACGCAT CTACCACCCG ACCGACGCGG TGGTCTATGG    179580
     CGAACTGGTC GACGTGCCGG CACTGCGGGA ATGGCGATGT CTTGCGCCGT GGCGCGATGA    179640
     GTGGGAATGG GAGGCATGGT TCACCGTCAC CGCGAGCACG CGCAGCAAGG CGCGCTACAA    179700
     GGCATTTCAA CACCTCTCCG ACGTGTGCGA CATGGACGGC AAGGCGCTGA TCGGGATCCG    179760
     CGTTCGCGCT GCGATACCGC ATCGACGCGC AAAGCGTTAG ACCTCTCCTC GTCTAACGAA    179820
     GGAATTCACA GGCTCTCGGC GTCGCGCACG GCCCTCGGAA AAAGCGCGAC GTTTCTTGGC    179880
     GGGTGGCTCG TACAGCACCC CTTTTTTTCG GATTCGAGGT CAAGCGATGA GCGAAAACAA    179940
     TCTTTCCCCT GCTGCCGCCC ACACGACGGC GTCTGCCGAT CGGCAGACCG CAGCTGATGC    180000
     CGGCCCGCTG GAGCGTCCGT TCAGTGTTGT CGTCGGGGAG CTCGCTGCGG TGCGACCGAT    180060
     GGTCGAGGCG TTCATTCAGG CGCGCGGCGG CAACGTCAGC GGCGCGGCCT ATGCGGAGAT    180120
     GCTGTCGTTT GCCGCGACCA TTTATCGTGA ATCAGTAATG CAACCCGCAC CCTCGTCGGC    180180
     TGACGAGCGG GCGGCTGACG AGCCCATCAG GATTCACAAG CTCTGGTCGT CGGGAGGCTG    180240
     CACCGGCATC AACGACTATC TGATGACGGA TTACAGCATC CGCACGCTCA AGGTGAGCGA    180300
     GACGGGCCGT GACAAGGTGT TCCCACCCAA CGACGGCAGC TACGACGTCA TTTCGCCCGA    180360
     CAACCCGTAT GCCCGCACGT TGACGGCTCT GAAATCCCGC GCGGCAGCAT CGCCCGCTGC    180420
     GGATGACGTG GGTAACTGGC TTTGGTCAGA GTTGATGGAG TACTGCCGCG AACGCGGAAT    180480
     CGCGCCGGCG ACGGCCGGAC GCCTTTTTCA GCTCGTACCG AGAGCACGCG ACAAGTTCGC    180540
     CCCGCAACCC GCACAGGCAG ACGCACCGGC AGCTATCGGC AGAATCGAGA CGTTCAGCGG    180600
     TAAGCATGGC ATGACATGGC TCGTCGAACC GAGTTCGCTG CCCGAAAGCG CGTTGGTGTA    180660
     CGCGGGCAAC GCCGACGCAC CGACAGAGGA GCGCGAGCCA ATGAACGATG TCCTGTTCGG    180720
     TAACGGCGAG TCGCTGGAAA TGGCCGCTGA CGCGCTGGAC AGGATCGGAC AGGACAGTGC    180780
     TGCTGCTGGC GTCCGCGCCG TCGCCTATGA ACTGCGCATG CTGGCGCACA AGATGCGTTG    180840
     CGCCTCCGAC GCTGCGGGCG AGCCCATCGG CGCTCACGAT TTGAGTACAA GCGCGGGCGG    180900
     CCGCAGCTAC GTGGCCGAGT TCTTCGCGAA GCGCCTGCGG AGGCACGATT TCGGCCGCTA    180960
     CATCAACGAG CTGCTGGCTG CCGATTTCGC GTGCACGCTA GCGCAATATC TGCGCGATAA    181020
     AGACGCCGCC CTGCAGCCAC CCACGCAGAC AGAAGTACCT GCGGAGATCC ATCCGCCACA    181080
     GGCTGGCGGC AACAAGGAAA AGCTACCTGC TCTTGCTCGC ACGCGTGAAG GCCACAACCT    181140
     CTATTCGCTT GGATATAACC GAGGGCTCAA GAAGGGGCGC GGGCAGATCA AACCGTCAGA    181200
     CGCTTGGGAG GGGCTGACCG AAGAGCAAAT CGATACGCTC AAGCTAGCGA TCGGCTATAT    181260
     CGGTAGTTCG GAACGCGCAG ATCGCGGCGA TCACGTCGCG CGTCTCCGCG ACCTTCTCGC    181320
     CCTCCATCCG GGCCAGCCGG AACCGCGCGC CGAGGTGACG GACGACGACA TCATCAGTGC    181380
     CTGCGACGCG CACGGGATCA CTCTTCCCGT CGAAGCGCTC GAAGCGGCGA CCGCGCTCGT    181440
     AAATCACTTT ACAGCCCGCG CAGGAGGCGC TCGATGACCA CCGATGTGAG CCATGCTGTT    181500
     GCGCTGACGG ACGGCCAGCT TTGCGCCGTT CAATTCGCCA CTGAAGCGTT GCGCGCGATC    181560
     GCCGAGCGCC GCGAACAGGC CGACGACGTA ATCCGGCCGC TCAACGATAT TCGCACCGCG    181620
     TCCCGACGTG CTGCTGCGGC GCTGAAGAGG TTCGAGCCCG TCGCCAACGC CCTACTCGCC    181680
     GCATCCTCTG TCGAACAGCC CGCAGTAGCG CCGTGGCGCG GCGCGTGCGA CCACACAACT    181740
     GCGAACATTG CGTGCCGCAT CTGCCGCGAG GAGCACGGTG ACGATTATGA CAGCCGCGAC    181800
     GCACCCGCGT CGGCGGACGT CGCGCGGGCC GGAGCAGCGT CGATCAATGA ATTCAATGGC    181860
     GATACGAACA CCCTGATCCG TTCGATCATG ACGCTGCTCG AAATGGACGC TGCTGGCGCG    181920
     CTCGGAGCGC ACGGTGTCGG CGACCACGCG CGCAATCTGC TGGGTGCTGC GGCGGCCAGA    181980
     CTTGCCGCTG TTCCGCCGTA CGAGCCGGGC CCCAAGCAGC CGAGCCGGCT TGTTGCGCAG    182040
     TCGGCTGCGC CAGCTGAGGC GCGGGCGGCG ACGTGCGAGG CAATCGACGG CGCGATCGCC    182100
     TTCGGCTATC AGAACACGAA CGTGCCGCCG AGCGATGATC ACTGGCTCGC GAAGTACTGG    182160
     CACATGGGGC AGAAACTGGC CCAGCTCGAT GCACTGCCCG CTTCCGCGCG CTATCCGATA    182220
     GCGTGGGTTC GCTTCCGCAG CGACGGCGGA TTCGAAGGCC CGATCATGGA CAGCGACGAA    182280
     CGTATGTGCG ACACGCGGCG GAAGTCTGGC GCATGGTCGC CGCTCTTCCT CGGCCCAGCG    182340
     CAGGCGACGG AACCGGTGGC CTATCGCTTG TTGCGACGGA ATATCGTGAG TGGTGAGTGG    182400
     GTGTCAGACA GTCGCGGCTG GGTTGACGGA GCGCCTAGCG TCGACCTACT CGCGGAGACG    182460
     GCCGCGCGTT CGTCTGAATG GCGTGTACAG GTCGCCTTTG CAGGCCCAAT GCCTGCCGCA    182520
     CTGGCAACAT TCCAGCAGCG TGTCCAGCCA TGGATGCTCG CCTGTTTTGG AGCCGAAATA    182580
     TCGACAGATG TGCCCGAGCG CAATCACCGC TTCTTCGAAG AGGCTGGCGA ATTGGTGCAG    182640
     TCGCGCGGGA TGACGCGCGA GGAAGCGCAC GCGCTGGTCG ATTACACGTG GTCGCGACCG    182700
     GTCGGCGAAC CGACGCAGGA AGTCGGAGGC GTCATGGTCA CGCTCGCCGC ACTCTGTCTC    182760
     GCCAACGGGC TCGATATGCA CGCAGCCGGC GAGAGGGAAC TCGCACGCGT CAATGAGCCA    182820
     TCGACGATCG AGCGGATCCG TGCGAAGCAA GCTACGAAGC CGAGGCACTC GCCGCTACCG    182880
     GGCGTCGCAG CAAGGATCGG ATTTCACGGG AGCAACGCAT GACGACTTCC GACCAAAGCC    182940
     TTGTCGACGC GCTGGTGAAG CGAATCAAAT CGATGTTCGT GTCGAACCCG CAGGGGGAAA    183000
     TCGGTCCGTC GGACGAGCCG GATTCGCAAT ACCGATTCGG CTACAACACG GCGCTCGAGG    183060
     ACGTGCTCGC GGCACTCGGC GAGCATCAGG TCGAACCGGC TTCCGCTACC CAATGGCGCT    183120
     GCTTCCATTG TGGCGAAGTG TTTGACGAAC GCGACGCGGC GGCGCTTCAT TTCGGCACGA    183180
     CAGAGCGTCA AGTGCCGGCG TGCACGATCG ACGTCGCGGA GTATCGCGCG ATGGAGCAGC    183240
     GAATGAGCCG CTACAACGAG GAGGACACCG ATCTGCACCG TGAAATCTAC ACGCTGCAGG    183300
     CGCGGCATCA ATCCGCACTT CGCCGAGAGG AAGAAAAGGG GTATGCGCGC GGTTTGGCCG    183360
     ACGGCGCGGC GCATGTGCAA CCCGATCTCG ACCCTGCCCC GGATGGCTGG GTGCTCGTGC    183420
     CGAAGGATCG TGCAGCACCC ACGCCCGATT ACGACGAGTG TGCGCGTCAG GCAACGCTTG    183480
     CTAGCGGGCT TCCGTCGCTT CGACACGCGC CGTGGATGTC GACCTTCATT CGGGAAATCA    183540
     ACCGCTGGTG CCAGCATCGC TACTCCAACA CGATCGGCGG ACTGGCGGGA TTGGTCGGTG    183600
     GCTGGAACCA AATCGGTGGG ACGCTGTACC GGGCTGATCA CGAGGGTGGT GGCAATCGTG    183660
     ACGAAATTCG CATTTCCGTG GCAGAAGGCT CTCGCGATGA GCGCGTGCTT GCGGCGCGGG    183720
     CAGCCGAGCT GCGGGAGCAA CTGAATCGCA TCGGTCCGGT CGAGCCGATG ACGGAGTTGG    183780
     TAGCGGAACT CGAGTGGTGC ATCGCTGAAG GATCGGGTGG TTTGCGTACG CGTGCTGCGC    183840
     TTCTGCAGGC GCGAACCGCG CTTCAAGGCT GTAGCTTTGT ACCGACCAAA ATGCCGCGAT    183900
     AAATCTCCAC ACTTGTTGGC ACTCCACGAT CGGAAGCAAT TCGAAGAGCG AGATCGGATC    183960
     TGTGCCGGCA AAGCAATGAC CCAGACTTTT ATCCCGTAGG AGACCATGAT GACTCAGCAA    184020
     GCTGGAAACT ACACCGTTCT CGAAGCCGGT TTTGGGGGTG TCCGCCCCAC TCCTCACGCC    184080
     GTCATGGAAG CCTTTCTGTC GAAGTGCTAT CCGGGTAGCC GCCGCGATGG TCCTTCGGAA    184140
     GAAGCTCAGG AGGGTGGCTA CGCGTTGCAG CAGGCATTCA CGACGGTTCA CGGCGAGCGC    184200
     ATGCTTGCCT TCCTGAACCC TGCCGCGTCG GGGGGCTGGC GCGTCGCCGC AAAGGCTCGC    184260
     GTCGTGGCAG CCACCGTCCG ATCCGCACCG TGGGATTTGA CGAATGTCTA GCCGCTCGTT    184320
     TTTGTATGCG CTCCAGAAGA CCGGCGTGTA CCTGAATGGC CGATCGTGGA TCGAGGAGCA    184380
     ATTGCTCGAC GTCCAAGGCT GGCAAAGATT GTTCGTTGAG ATGGTGGTCG CGGACCACGC    184440
     TCGACTGTTG CTGCGGCCCG CGACGTATGG CGTGGAAAAA TGGTCTGACG CGCTGAATAA    184500
     GATCGTGGCC GTCCTCCGCG AGTATGCGTT CGACGATGCC GATATCGATC GAGTGATCGG    184560
     CGCAATCCAT GCAGACAGCG AAATCGCGCT CGTTGAAATC GAGATCGTGA GGATTAAAGG    184620
     CGCGAGCGAT CCCAATTTGC CCAGCCACCT CTTTCCGGGA TGCGGGAGCG ATTACGTGCT    184680
     GTTTCAGCTC GAGGTTTCGG ACTCCGAGTT GGTCATTTCA CCGAACGCCG TCGCAGACGC    184740
     GATCGTTGAC CTCGAGATGG ACGCAGGGCT GAACGAGTTC GACCCGGACA CGCGCACCGG    184800
     CAGCTATTAC ATTGTCGACG GCGCGTCCGA GTTCGCGGCG GGCACACGCT TTCTGCTGGG    184860
     CCTGAACTTG AGTGATCCCG TAACGTTGCT GACCGACTAC GTGCTTCGAG ACTATCCCCG    184920
     GTTCGATGAG CGAGACTTGG CGATGCCGGA GGTCGCTGTC ACTCAAGGCA CCTCGCATGA    184980
     GATTGCAGAG ACGCCAGTGG TCGGAGAACG GCATGCTACC GTGGATCAGT CCCCACGCGT    185040
     GAGCGTTGAA AAGCTCTCGG GAGAACGGAC CATTCTCATT CGGGAGAGCA ACGCGTTTGC    185100
     GCTGCTGCGC TGGCCGGACT ATCGCTTGGT GCGACGTCTG TCGGTGCGCA AGGCCCTCGA    185160
     TCACGGAGAG GCGGGGTTCA ATATCTGGCT TGACCGCAGC ACGACGGAGT TGCCCGGAGC    185220
     AGGTGATCTC GTTGCCAGTT GTCGCTCGCA TAGCGAAGCG CTCGGCTTAC TCGCAGCGAT    185280
     CGAAGCGGCG ATTCTAGCGG AATCAGATCC TAGCGAGACG CTGCACGGTA GCGCGGAAGC    185340
     CAATGCGCAA GGTACAGTGG CTGCCCCTGA TCGCGCGGCG TCGCCCCATT GGGCAGTCGT    185400
     GGTGCTGCTG GGCTGTGCGG CCGTATGCGG GGCGATCGTC GCGATGCCGA TCCTTTTCGG    185460
     GGCAGGTGAT GCAGTCGCTA AACGATTGTT TCCGGATCCG CGTCCTGCTC AGGCACTTCA    185520
     CTCGTTCCCG CCGGCTTTGC AAGGCCCCGG ATTTCTGGCA CCGCCTCTTC AACCGCTTCC    185580
     GACTGTGCCA AGGGGGCGCG TCAATGGATA ATAGTGCTTT CTGGACGGTG GAGTTGCCCG    185640
     AGTGAAGCGA AAGGAAGAGA CCGCGATTCT TGCCGAGGAG GCCTTCTGGA CCATTCTCGC    185700
     AAACGGGAAG CCACCGACCG TGGACCTCAT CAACGCTCGG TTGCTGGAGC TCGGGCACGG    185760
     TAAGCGCGAC CGGAACGTCG TCAATGGCGT CGCGAAAGAG TGCTGGGATA AGGTCGCAGG    185820
     GCGCGTGAAA GACAGTTTCG CCCTACCCGG CATCCCGGCC GAGACGGTCG GACTGTTCGT    185880
     CAAACTGCGC GAGGATCTGC TGGCCGTCGC CCGTGCAGAA CTCAACGCAG AACGGGCCGA    185940
     AGTCGAAAGC ACTGCGCGGG CCGCGATCGA GGCGGCACAG CAGGAGGCGA TCGCAGCCCG    186000
     CCTCGAGCGG GACGAAGCAC TGGCCGCCCG TCGTGAAACG GCGGCGGCGT TCGAAGCGGT    186060
     GGCGGCAGAG CGCGACGGCC TTCGCAACGA GTTACTGGCC GCGCGACAAT CGAATGAGGC    186120
     CGAGCGCGAG CGTAGCATCC GGGCGGAAAA GGCTCTCGAA GTACTTTCTG CGCGCATGGA    186180
     GGCGGAATCC CTGCGCTTCG TGGCGGAGCG AGAAGCCGCC GAGGTCGATC GCAAGCGCCA    186240
     GTTGCTCGAA ATTGATGGGC TACGCGTCGA GCTCCGTGCA ACGAAGGAAG CCGAGAAGGA    186300
     TGCGCAGGCG AAGCTCAGTG ACACCGTGGC GCGAGAGCGC GAGTTGACCG CCCGTGCGGC    186360
     GGAGCTGGTC GAGCAGCTGG GTGCCGCGAA CGGTGCTGAG CGAGTCTTGA AGGCACACGT    186420
     TGGCGACATG TCGCGTGATG TCGAGCGACT TCGTGCCGAG CTGGCCTCTG CGGTGGAGCG    186480
     GGCTGTTCGC GCGACCGATC AGATCGAGCG ACTTGAAGGC GACGCACGCG CGCTTAGAGC    186540
     CGCGCTGGAG GGGCGCGCGG CCATTACCGA GGAGCAGCTG AATGCTGCGC TCATACAGGC    186600
     ATGGCTCAAC GGCGCGACGA GTGCGCCGAA GACGTCGCGC GGCGATGATC CGACCGCTTC    186660
     GTTGACGCCT CGGGCGACGC GATACGCAAC GTCAGCAATG CAGATGCTGG GAAAGACAAC    186720
     GAATAAGTAA GTGGCTTCGG ATTGCAGACG CGAAGCTTAA CAACGACACG CGTCGGCAGG    186780
     CGCAAAGGAG AACCATGCTC ATCCGCTTCA TCCGATATCT CCCGGGCCTT CTGGCGGGAC    186840
     TGATCGTGTT TTTCCTCGCG TACACGCGGT GCAACAGTAT TTGGCCGTAT ATCGGCGCAC    186900
     TCGCATTTGG TATGGCCGTG TGGGCGCTCG TCGAGCGCGG CCTGTCGCGT CGCTCACCCG    186960
     CTCAAGTCGA CGACTGAGCT CGGCGAGATG CGAAAACAAG TTTCAATGGG GCATTGATGA    187020
     ACACACTCAC CCGACTCAAT CTCTACCCGG GCGCGTTCGC TTCCGTCGGC GTGACCTCGG    187080
     AAGACATTCC TGAAATCGTT GACTGTGTGC TCGCCTCCTC GCCCGACTAC GTCACCGTCG    187140
     AAGGCTTTGA TCAGGACACG GCGGCCGCGA TCGCGGATCG GCTCTCGTGT ATGGGGATTT    187200
     CGGTACACGT GGCGGGTTCG GGCGAGCGTC AGTGGCGTAC GCCGCTGACG ATTTTTAACG    187260
     GACTGCTGGA CAGGATCCGG TCGACGCCGC CGCGCGGAGA TCGCGGATGA TCAGGTTGCC    187320
     CGGTCTCGTT CTCGACGCGG CACTCTCTGA ACGTCGATGG TTCGCGTTGT CGTCGATCGA    187380
     GGCTAGACGC GCACTCTTCT GCCTCGAGCT GGTCATCCAT GCAACGAGCG CGTCGCTCGC    187440
     TCTATGCGCC GCGCTGCTGC TGCATCGAGA CGGTGCACTT TGGTCAGTTG CACTGCTGAC    187500
     AGCGGTCGCT GTCGCACTCG AGTGCGGTCT GGGCTTGCCG ATCGGTCAAT TCCTCCGCAT    187560
     AGAGCGCACG CGTGACCGCG CGCGTGTGGC CTATCTCAAT CTCGCGAAGC AGGAAACCGA    187620
     TCGCAGTGAC CTGTGGCCCG ATCTGGCAGT AGCACACGCA CTTGAAATGC GAGATGCCGC    187680
     AACGGCGCTG ATCATGATCT CGCGCTGGCA AGGCGCCGAT TTTGACGATG CAAAAGCCGA    187740
     GCTCGCGCGG CGCTCGCGGT ACCTATCCGA AGAGACCGTG GCGGACCCAG ACGAGGCTGC    187800
     TGTTCAGGCC GATCGGCCGA TCTTCTAAAC CACCACGTCG GGCCACGTGG CGGCTTGACA    187860
     AGGTGCACAA GTGCGCTCTA CTGTGCATCG CAGCCGACGT GCCAGTCTCG GCGCCGCAGT    187920
     TCGAGGAAAA GTGTGCCATG AGGAAAGCAG GCAAGTCACT GCAGGACGGC AAGTATCGCG    187980
     CTGTCTGTCG AGAGAAGAAC GCGCTCGCGG CCGCGATCAA CGGCCACTCG CTGATTTATC    188040
     CGGAGGCAGA CGTTGAGCTG AAGGACGGCA CAGCGATTTT CCGGAAGGAC GGAAAGATCG    188100
     TTTGGCGCTG CAATGCAGCC TATGCCGAGC TCCATTTTTC GCTCGAACCA CAATAGCCTG    188160
     TGACGCGAAC GTCCCGCGCT CGAGCGGAAG CGACGCAGGG TCACGCGTGA GCGTCCGGTT    188220
     CGAGCGCACC CTACCCGTTC CGTCGCTCAC GCGTCACTCG CTCGAGTCCT GCACGGGCGA    188280
     CCAGCGCCAG ATCGTCTTAC CCCACTGATT GCCATCGAAT GTCGGCATTA TCTCGCCGGC    188340
     ACTGAAATAA CGCCGACTGC CCGGTTTCGC GGGCGTGTCC CACCATCCCG ACTCGGGACA    188400
     AGGCTGGCCT CCACGGACGC TGTTCCGCGA GTGCTCGTGG CGCGCGGTGG TCGGCACGAC    188460
     TGTCGGTGGA GCGGGAATGG CCTGCGCGCC CGGCAGATCG AAGCGTGCGT ACCAACCCTT    188520
     CGCGTTGCCC TTGTCAGCAC TCGGAAGATC GGGAATGTAT GTGTGCAGGC CATCCGAATC    188580
     CGGATCGCGG AGCTGGCGCA ATACCGTGTT GACGAACACG TAAGGTTCCG GCAGGCCTTC    188640
     CTCGGGCGCG CCAAGGCGCG GAAAGCTGCC CGCCCGAATC AACAGGCACT CGCCGACGCG    188700
     CTCGATCCGG ATATCCGCGC GATCCAGTGC GGAGCGAATC GCCCCTTCTC CGCCCAGCCG    188760
     CTCGACGTAT AGCTCGCCGA GAATCGTGTA CCAGTTCACA CCCTTGATGA ACCCCCAGCG    188820
     GCCGACCTTG GCGCCCGGAT GCAGGTAGTC GTAGACGGCC GTCATGTCGT CTTTGGATTC    188880
     GCCTTCGTAC GAGACGGGAT CGTATCTGTC CCGAATCAAG TGCGCGGTGC TGTCAATCTC    188940
     GAGCCCGGAG AATCTCGACG CAAGCGCCCA TTCCTGAGGC ATGTATCGAT GTCCGCTATA    189000
     TGGCAGGATC GGCGATAGCC CGCCGTAGCC TCCACGCACG CTCAGACGGC TGCAGAGATA    189060
     CCGGAGAAAC GTCTCGTATT GGGCGATGCC TTCGTCGGAC GCCATCAGGC TCATGGGAAC    189120
     GTTGAATTTC AGGTACGACA GGCCTGACTC CTTGCCCTTC GGAACACGCA GTCGCCCCGT    189180
     CGGGGAGACG TATTCTGCTG GGAGTGACGT ACCAGTCAAC ACCTTGATAC CGTATTCTCC    189240
     GGCCGTGTCT TGATCGATTG CGCTCGAGCG GACCACGCTG AGTTCGGTGT ACGACGGCGT    189300
     GTCGATGATC GCGCGTCGGA TCTTCTGCAC GCCCGCAGCG GTTCGCTTCG TGAATTTGCC    189360
     CAGATCGCTA TCCTTGCCGC CGCGAAGATG CTCGCCGAAC ATTTCGTCGA ACAGGTCGAA    189420
     GCATTCGAGA ATTGCCTCCC GCACTTCCGG TTGAGAGCCG CGCGCAAAGA AGACGGTGCC    189480
     GATGACGCCC GGCACGATCC CCATGCGGTT GTCATCCAAC CGCAAGCTCA AGTCTTCCTG    189540
     ATAGCGCGCC AGCGCTTGCA TCGGCGTCAA GATGGGTTTG GAATCAGCGA TCGTCATAGT    189600
     CCAGTCGATT CTATTCGGAG CATGTCAGCC AGCGGTCGCG ACAGCTGACA CACCAAGTGC    189660
     AATTGCGAGG GCGGCCAAGG CCTCGGCGCT CGCTGCCGCA ATAATCGCAC ACAACGCGGC    189720
     AAGGATCGCG ACGAGCGCCT CGGCCAAGAT GATCACAATT GCGACGGCGG CCACGACGAT    189780
     GACGATCGCC GCGATGCCTT TGAGGATCGT TGCACCGACC TGCGCCCAAT CGATCTGCTT    189840
     GAGAACTTCC CACGTGAGAT CCGTCTGCCT CACGATTTCA TCCCAACCCG CTTTGAGCTG    189900
     CGCGGTCGTA TAGCGGTAGA TCTCATTGCC CTTCTCGTCC ACCCATACCC ATGCGCTGTG    189960
     GGCCTTGTCG GAGACCCATT GGCCTGCCGT GAAAATCCAT GGCGCATGCT GATGAAGAAA    190020
     CGCACTCGTT TCCGACGAGA TGTACTCGTA ACCATGCTTT GCAGCATCCC AGATCGGGGC    190080
     GACAGCGTCG CCCACTTCGT TCCCGATTTC CTCACCGTGC CGCGCGGCCC AGTTCCACCA    190140
     GTCCTCGTAC CATGCCGGTT CCGCGATCGG CGTGACGGTT CGCACCGGAA CGCGCGTCCG    190200
     CTTGAGCTCC TTTTCGGTCT CAGGCGCCGG AACATTTTTC AGCGCGCGCT CGCGAACCTT    190260
     CTCGAGTTCG CGATTACAGT CGGTGACGTC GATGACCGTC ATGCGCTTGA GAAAATCGCC    190320
     GGCGATGCCC TGATACGCGG CCTCCTGCCC TTCCCCCCAT GTATCGCCCG GGAACTTCAC    190380
     TTCTACCAAG CGCAGCATGT TGTCGACGTG GGGCGCCCCG TCGAGGTCGA CGTTACCTCG    190440
     CCCGGGCCAA CGATTTCCCA TATTGCGTAC GATGATGACG TCCGGGCGGC GTATCACGCC    190500
     GAGACTGCCG TCTGGTCGTC TCGGGAACGG GTTCAGACTG TGCCGGCGTC CCGGGCCAAG    190560
     AGTTTTGTCA GCTGCGAGAA ACGGGATCGG CGCGGCAATT TTTCCGGTTG CGATGTAGGG    190620
     CGTCATATCA AAGCTCACTT CCGCCTTGTA GGGCCAGTAG TAGTCGGCTT TGCGTTCGTC    190680
     ATAGCGGATC GCCAGCGTCA TTGCTACCTG CTTGAGGAGG TTGACGGTGG TTCTGCCGTC    190740
     CGGAAGACGG ATATAGACGA TGCGCGGCAT CTTCAGGCCG ATCTCGACCT TTTCCTGCAG    190800
     GTAGCCCTTG GTGACAGGAG GTAAGTCTGC GTAGGCCGGA TCCTCGTTGA CGATCGTACA    190860
     GGTCGAGCCT GCGGGCTGGA GCGTCGATCC CATGATGATG GTCTCCCTTG TGTAATCAGG    190920
     CGCTATCGGC CTCGTCCATA TAGTCAGCGA AGATCTGGGG TTGACCGCCC CCAGCGAAGT    190980
     GCCACGGCTT CGTTTCGACC TTTTCCTGCT CCAATGCACG CAAACTGACA TCCTGCGCGG    191040
     TTGGCGAATA GGCCGTGACG GTTTCGCCGA GATCGTTTGT GTGACCGGTC AACGTACGCC    191100
     CTGAGGGCAG CTTCATTTCG TACGCGTGCC GGATCATTGG GGAGCCGTCC GTCTGATTGC    191160
     GCAGGATGTA GCGTGCTTGA TACCCCGGTT TGAATTGCGG CAACTGGTAC GTCGTACTGG    191220
     CGGGTCCGCT AAATTCGTGC TGACTACCCT TGACGTCGAT CTTGCCGGGC GCGTGCAGCT    191280
     CGATATTGCC GTCCTTCAAG CGTATCGACG CGCCACCAGA CGTGATCAGG ATTTCCTTGC    191340
     TGCTCGCGAT TTCGATGCTG TCCCCTGCCG AGAGGATCCG TACGAGCGCT TGGGCGATCA    191400
     GATCGATGCC CTTGCCATGT GCTTCGATCG CGAGGGCACC TTTGGCGGCG GTCACACGAA    191460
     GATCGTCGCC GGCAAAGAGA CTCGCGGATT TCGCGGCGGC CGCGATTAAC GACTCGCCGA    191520
     CCGCGAGGTG TGTGCTCTTG CCGCTGGCCA CGTTCATCTG CATATCGGCT GCAAGGTGAA    191580
     TCGAGTCGGG CGTCGACGCT GCAATACCCG CTGGACTGCC GAGCAGCAGG ACCGGGTCCT    191640
     TGAAGCCATT GGCCGAGCCG GTACCGCCAC CCGCTGTTCG ACCGCCCGAC GTGTTGGGCG    191700
     TCACGTCGTT CTGCGTTGCG CTCGAAAATC GCTGGAGTGC TGCTTGTCCT TCGCTCAACG    191760
     GCGGCACCTT GTGCTGCGTG CTCAAGTCGG AAAGCGACTG CATCATGCTG CTTGCATTGG    191820
     CCAGCTGCTT GCGCGCCTCG GTGACATCGA GCTGCTCGCC GTTGTAGCTC ACGTGATGAG    191880
     TGCCGATGTA CAAGCCGCGA TTCGCGCGTA TCGCGCCGAA GTGATCGGCA TGCAGCAGGT    191940
     ACCCCATGCC AAGGTAGCGG CCCCGCGTGT TGCCCTCCTG CGCGATGAGA TAACCCTGAT    192000
     GCAAAAGGCT GTAGCTGCTG CCCTCGCCGC CTGAGTACGA CGTCAAACGA ATGGCGCCCT    192060
     GATTGGTTGC GTCGTCGTGC ACAAACGCGT TGAAGGCGCC CGTATTTCCG AATCCGCGCG    192120
     ACTGGAAGCC CGAGAACAGG ACGGTCGTAT TCCACGGTGG CTGTGTTTCG CCGCCCGGCA    192180
     GGCGGCCGAT TATGAACGGG CGATCGCAAT CGCCACCGAA GTGATCGATC GCCACCCATT    192240
     CGTTCGCACG CGGCACGTGT ACGGCCCCAT AGCCGCTACC GGTGTCGGAC TGCATCGAGA    192300
     GCAGCAACGG CGACGTGTTC ACCGCATCCT GCGCGCTCTG GCGGTCCCAC GCAAAGCGCA    192360
     CGCGGACCCG GTTGAGCTTG TCAGCCCACG CCTCCTCACC CTTCGGCGCG TTGACGCGCG    192420
     CGTGCTCGAC ACGCAGCACC GGCTTGGAAT GCTCGAGCGG ACTGCGGTAC TGGACGTTCG    192480
     CTCGCTGCAC CTCGACGTCG ACCACGAAAT AGCCGACCGA TCCGTCGACC TCGTGGCCTT    192540
     CGCATGCGAA GCGGCTGCCG TAGGCCGATT TTGCGTTCTC GAGAATCGGC CGCAGGCTCA    192600
     GGGGCAACGA GTCGATATGC CGCCCGATCG GGACGTTGTT TTCGATGAGC CAGCTGACCT    192660
     CGATAGCGAC GAACTCGCGG TCTTTCGCTG GGCCACTGTA GCGAGGATGG TGCTCCAATG    192720
     TGAACCGAGC GCCCGCGTCG ATCCATCGAA CTCCTCCTAC GCCACGTGAG CGGTTCGCTT    192780
     GCGAGTCCCA CACTTCGCTG CGGACCCGCG CGCGGGACTC GCCGTCGTCC GTGCTGGAAT    192840
     AGCCATACGA GGTTTGCTCG AAGACAGTCA GTGGCGCGAA CGGGATGCTT TCCGTGACGC    192900
     AGGATCTTCC GCGATCGTTC TGATAGGTTG TCTCGAGCAG TGCACTGTTC GCCTTGAAGT    192960
     CCGAGCGCGG CCGCGTGTAA TCGAACGCGT GGGACGTGTA CTGGAGACTC TGCAGCACCT    193020
     GCAACGACGC CCATTGCGAG AACCCATCGT TTTCGGCGTT GGCGTGCGCT TGGTAGTACT    193080
     CGATTGATCT GGATTCGGGT AACGACATGA CCCGATCCAC GATGACCAGT GTCGCTTCGG    193140
     GCTTGTCGTC GGCGCCGGAT TGGGCCCAGT AGTAATACCA GCCCTCGTCT TCCAGAATGC    193200
     GGCTCACGAA GTTGAGGTCT GTTTCGGCTT GTCGGCAGTA CGACCGGACG CGCGCTTGTT    193260
     TGGACAGATC AAAGCGGAAC CGGCCTTGCA GCTGTGGGTA GCGATTCAGG ACGTCGGAAA    193320
     CGATGTCGGC TGCGGTCTTC TCGAGCCAGA AGCGATCGTC CCTGCTGTAG CCGAGAAAGT    193380
     ACAGTGCTGA GGCGAACTCG ATCTGGTACA CGGCCAAGCC ACCATCCATT CCGAGAAGCG    193440
     CGGCACGATT CACGAAACCT TGAATGGGAC GATATTCGGC ACCCGCATCC GCCGTGGATT    193500
     CCTGAATCCA GAGCGTCACC GGCTGATGCA TCAACGAGAG CAGCGCGAGA TCGTCGCGTG    193560
     TCGACGCCGC CTCGAGCGTC CAGCGATAGT CGCGACCGAT CTTGGCCCAG CCCTGCGCCC    193620
     TGATCGGAAT CAGTGTGTTT GCGCCCAGCG GCGTGTCGAG CTTCAGCAGC CGGCCTTGCT    193680
     GCATCAGACC ACGATGGATC GCTTCGAAGA TCGACGCCGA CTGCGCGTCC TCGGGCGGGC    193740
     GAGGTCGCAT GTCCATTGCT CGAGTTCCTT CTCTCAGGTT CGCAAGACGG GAGGCTGTTC    193800
     GCGTCCCGCG CTATTGGCGG CCGTGGCTCA TATAGCACGA GCTCCGCCAC CATTTGTCGA    193860
     CCTGAGCATA GCAAATCTCC TGACGAAATC CGGAAAAACG AGCCCCTTCC CGGGCGATGG    193920
     CTGATGAGAT CTGACAAAGG TTGACAGATA TTTTCGCGCG CAAAAGAAAT ATGACATCGG    193980
     CCTTGGTATG CGAGCCCGGC GAGCATTGGG GTAAAAAAAG AAATATTGTC GAGAGTCTGA    194040
     ATTCGATGAA ATATGCAATT TGTGCTTTAG TTTTGCGGAA ATATTTGCAT TTTTTCTATA    194100
     ATCCCTCCCA TCTTCTATCC ACATCAGGGG GAGCGGGCTG TCATGAACGC ACAAAAGGAC    194160
     TTTTTCGACG CGCTCGCCGC AGGCGACTCC GCCACGGCAC GGGATCTGCT TCGTCGGAAG    194220
     CGCGTCGGCG TAAACGCGCG ACAAGGGCAT GGGCCGCATC GCGGACGTAC GGCCCTGATG    194280
     GCGGCAATTG CCCACGATGA TCTGGACTTG GTGGCCGCGC TGATTGAATC CGGGGCGGAC    194340
     GTCGATGCTT GCGGTACCGA ACACCATTCG ACTGCGCTGA TGTTGGCCGC CGAGGAAGGC    194400
     AAAGTGCGGG CGCTTCACGC GCTTCTGGGG CACGGGGCGA AGATGGATGT TCCGGACATC    194460
     TACGGCCGAA CTGCAGCGCA CTACGCCGTG TTGAAGCACC CGGAGCAGGC ACTCCACCTC    194520
     TATAAAGCCG GTGCGAGCTT CGATCTCCCG GACGAGGACG GCATGACGGC ACGGGCGTTG    194580
     TTCGAGACAA CGGCTCAGGT GCGCTCGCTC GAGCGGACAA TGCGGGAGCT TGAAGCGCTC    194640
     GTCTCGTCGC CGGGATCGAC CGAACTGGTC ACGCCGGTAG CAGGCAAAGA CGACGTGTTC    194700
     GCGGCTGCCT ATTTCGGGCA TGTTCACTGC GAAAAGAGCG ACGGTGAATT CCTCCAGTCG    194760
     CTTGGACTCG CGACTGGCGA GTACGACCAT GACGTTGGCC GATTTGCGGT ATCGGTGCCG    194820
     GGCCCCCTTT CCGTGGACGT GACGCAATAT CTGACCTCAT TCAAGTACGA CTTCGAATTG    194880
     CTGCCGGTCG ACGCGGCACT GATTTGCTCG GATCCGAACA AGCTTGATAG CAAGGATCGC    194940
     CGCGCACTTC GTGCTTATCT GACGTACGAG CTCGCCACCA CCGACGACAG TGAGCGCATC    195000
     GCGGATCTCG CGGCGCGAAA GGAAGCGCTC GTGGCTGCAG CGTCGATCAC TGCGAGCGCT    195060
     CTCGAATCGC CCGCGACGAT CGACGTGAGC ATCGCGAACA ATGAGCCCTA ATCGGTGCGC    195120
     GTCATCAACT CCTCCCCTCT AACCGCGAAA AACCCTATGC GAAAGCCCCC CGATCGACCC    195180
     GTACAGATCA CCGCCGAAGA CGTTCTTTCC ACCATGGCGC AGTTGGGCCG CGATGCGACC    195240
     GTGTCGGAGG CCGAAGCCCT CGCCTCCAAC ATCAATTCGG CGGGCTTGCC GGACGGTGTC    195300
     GCTCGCGACA TCGCCTTGCG CGAGATGCTT GCTGGAAAGA GCGAGTCCGA CCTGCAGGCG    195360
     CTGAGCGCGC AAGATCATCC GCGTCTCGCT TTCGCGAGAG TCCGAGAGAT CCTTGCGTCC    195420
     CATGGCGAGG CGGCCGCCGA ACATCAAGTC GGTCACTACT CTTCACTGTC TACGCTTGCC    195480
     GAAACCGTCC GGTCGAGCAA ATGCTGGAGC GAGGGCGAGA TCTTCTCGTG CGCGCTCGAT    195540
     GAGACGCGCT TCGTGATCAT GAAGCAAGTC GCGCCGGCAA GCTGCGAGAT GGTGACGGTC    195600
     TCGCATATGG GCTTCCATGA TGTGCTGACC GCGTACCGCT ATGACCAACA GGAGCTGGTC    195660
     GATGCGTTGA ACGGCTATAT CGCCCCCGCT GCTGCAGAGA TCGGGCATGT CGGCGCTGCC    195720
     GCTCGAGACG CAGCCAAGCC TGAATTCCTG TTTGACCTGC AGCTCGACGC ATCGATCCGC    195780
     TTTCGCGCGC AGAGCGAGAC CATTGCGCGT GAAGAACTGC GCCGTCATCT GGACTGCGCG    195840
     AACGCCAACC TCGGCGAAAT TCTCGGCCAG ACGATCGTGT GCGAGGTCAG CCTGAACGGG    195900
     ACGCCGGCTC TTGCAGAAGT CGATGGCGTT GAACCGGACA ATGCGACGCG GCCGGTCCTG    195960
     TTTCAATCGG ACCCGCGCCC GATCGTCAGT CTCGACCCGA ACCGACCGCT GTACGATGAC    196020
     GCTGGCCGCG AACACCAGTT GATTTCCGCA TCACGAACGC AGGTCGTGAC GACAATCCTC    196080
     GGGGTGTATG GCGTGTGGGA TCGAGCGACA GGCGAATGTC TCATGACGAA TGCGGAGGGT    196140
     ACCCGTCTTT CGAATGAGGC GCCGAGTCCG GAATGGGTGG CGGCCCGTCG ACAGGCCGCC    196200
     GGTGAAGTGT TGGCATCAAT GCATGCTGAT GCCGCTATCA AGCGCGCGCG CGGTGACGAT    196260
     TCTGCGTCCA TGGAAATCTA ATAGGAGCCT CCGATATGAA AACTCCTCAC GTTACAGATC    196320
     CGTTGATCGG CACTGATGCG TGGACGACCT CCATCAGTGT TCAAGGGAAA ACGGCCGTCT    196380
     ATCCGTGTTC GATCACGGCG GTGGGCGACT GGAAATTCGA CCGCGCCGGA ACGCCGTGGC    196440
     GGGCGCTGAC CGTCTTTGTC CCCGGCTTCA ACGCAGGCAG CAACATCGTC GTCAGTGCGG    196500
     ACACGGTGTT CGTGGACGAG GAATGCACGC GCAGCGTCGA TGTGGGCGCC GCGCCGGCAC    196560
     CACGTACGTC GAGTGCTATC GCCGCACCGT GCGACGAACA CGATGTCGGC GCAGGGAACC    196620
     TGCCCTTCGC GATTGGGCAG AAGTTCGCGT TCGAGCCCGG TCAGCGCGTC ATCTGCAACG    196680
     GGTATCCGGG CGCGGTGAGG GGCATGTACA CCGAAGGTAT GGTGGAGGTG CGGCTGGATG    196740
     CAGGTCTCGT TTGCGTGCCA GCCAGCTACC CGGATTGCTA CCCCTCCGAT GGCCTGAATC    196800
     CTGCCACGCC GAGCAGCCGA GACCGACTCG AATCCCCTGC CCCGGCGCCT GATATGTAAC    196860
     GTGAATCTGA AATGGTGCAG TGCTATATTA GGCATACGCG CCGGGTCGGA ACCGGCGAGC    196920
     AAGTGCGGAG GAAATGGCGA TGAACGCCCG TGAACTGGAA AACAGCCTGC TGGTTCGTTG    196980
     CGTGGAAGTC GCGCGCGATC CGTCGGCCGT GGCCGGCGAC GCGCGGGAAG CCAACGTCTT    197040
     TCGTCTTGCT GGGATGGTAG TTCGTAGCGA ATTCCCGGTG GCCTATAGCC GTCTGCTCGC    197100
     CAGCAGCCAG CGCTATTTCG ATCGCCATGC GGGCGAGTTG CTCGAACCGG GCGAGGTCGT    197160
     GCGGAAGGGC TGGATTGTCA GCCTGCCGCG ACTGCACGAC ATGCTCGAAA ACCGTCTCCG    197220
     AATGAACCAC GCACGATGAA TCTCGATCCG ACTTTCAAGC TGGAAACCGC GCTCGCCAAG    197280
     GGGCTGCGCG AACTTCTCGA GCTGCTCGAG CAGTCGCTGG ATCTGAAGCA GCCGCTTCAG    197340
     GTCTATTTGG CTGGCGGGAT GGCCGTCCAT CTGTACACCG GTAGTCGCGT AACGAGCGAC    197400
     ATTGACGCTG AGTTTGCCGG CCGCGTGATC CTGCCGAGCG ATCTCGCGGT CGTGGTTCGC    197460
     CTCGAAGACG GCTCCGAGCA GGTCGTCTAT CTCGACACGA ACTACAACCC GACGTTCGCG    197520
     CTGATGCACG AGGACTACCA AGAAGACTCG CGGCGTCTGA ATCTCGGTCT CGGGCAAATT    197580
     AGGGTCAACG TGCTTTCGCC GGTCGATCTC GCCGTCAGCA AGATCGCTCG GCTGGCGGAC    197640
     AATGACCGCG AAGACATCCG TGAGCTCGTT CGCCTCGGCC TGACCAATGC GGACGAGATC    197700
     GAGAAGCGCG CGAACGAGGC GATCGGCGGG TACGTTGGCG GTATGGAAAT GCTGAAGATG    197760
     AACCTGCGGG ATGCTGTTGC ACTTGCTCGC GATGCTGAGA CAGCCTCGCG GCCGTCTTCT    197820
     GGGTCGCCGG AAGATCCCTC GCCGCAGCCG TGATCCCGCG CCGCGCAAGT TTCGTTCACA    197880
     GGGCGCGGCC TCCCCGCCCC TTACTTTTCC TCATGCTCCA TCGCGACACG AGCTGCTGAG    197940
     CGCAGGAGCT CATCCGAAAC TTGCCCGCTG CGCACCGATC GCACGAGTGT CAGGAGCATG    198000
     CGCTCCGCAT TGACCGCCCG CCTGCGGTAC TGATCCAACG TCGTGCCATC GAGATGGCTG    198060
     TCGCAAAGAC ATCCGCAGCC ATCGTAGAGC GACGGGCAAA GCGGATCGTC GACAGTACAT    198120
     CGGGCGCTGC CCTGACTAAC TCCTGCCTTC TTCAGCACAT TCCCCCCTGA CCGCAGAACA    198180
     AAGACCGCAC CATCCGCTGC GCTCCGGCTC GGTTCGCGGT TGTCCGACTC CACGGGAAAC    198240
     GATCGACCGC CATGCAGCCG GGTCGCCAAT GCTCGGGGGT TACAGAGCAT TCACGAAGCC    198300
     GCCCGCCATC ACCCAAAGCT CGTGGTGATT AGTCACCCAC TCAGGCACAG TCGATACTCC    198360
     GCCTCCGGCA CCGTGCGCCA TTTCCCATTT CGAGACTAAC GGTGAAGCTC CGAAGACGGC    198420
     TCCCGCGTCC GCCCGCGATC GCCCCGTGTG ATCCTCAACA GAGTATCTGT GCTGCAATGC    198480
     CGGATGTCCC ACGACGCTGT CGATGTTGTC GACTGGCAAG ACCGATACCA GCAGTCGATG    198540
     CTCGTTAGGG CACTCGGAAT GGCCGCATGG AAACGAAACC AGAAAATCTG GTGTCCAGTC    198600
     ACCAATCGGC GCAGCGTTGG TGTGCCATGT CCATTGCGCT AGATCAAAAA ATGCGGCCCA    198660
     TCTCGCGACC AGCTGCGTCC TGAATTCGAG TCCATCGTAG TTGAAGCTCA TTTAATACCC    198720
     TCCTTTTCCG TGTTTCCCGG TGCGTCAGTC ACAGTTGATG CCGAGAACCA GCAACTGGGC    198780
     TCCGGCAGGG ATATCGGTAT TGTCAAGGCC AAAGATGTTC AACGTCTCGC GATCCAGTCT    198840
     TAGGGGATAG ACAGCCTGCT TCAGCTGGGC CATATCGCCC GGTGCCAAGC CGTTCTTGGC    198900
     GAGCCAAGAA CGGTAGGCCT CCTTGTGCTC CGCCTCTACT CCGTAATCCA TCCGATCAGC    198960
     CGTGCACGTC CGGCAGAATT CCTCATTCGC GACCGCTGTC ATCAGCTGAT GACCACGGGT    199020
     CGGATTGAGT TCGAGTGCGT ACCCCTTGAG TTTATCGACG GAGAAACCGT TGCAGGTGTG    199080
     CGATAGCGCG CCCCAGTCGG TTTCGTTCCT ACTGATCGTG GGTCGCCAAA ACACCAACCA    199140
     AGGCCCGGCA TCGTCAAGAC AGACCTCGTT CGACCGAGCA TCATTTCCCC AATGCTTCAA    199200
     CATATGCCCT TCTCGCTTTC CTATATCCGA TCGGGACAGG ATCCGCGATA AAGCTGCGCG    199260
     ATCGCATCCG TACCGACGTC GCGAAGTTGC TTCATGAGCT CTGTGGTGTC TTCCGGCATC    199320
     GCCACTTCTG CTCAGTCAGT CAATGATCGA CTTGCCGCGC TCGGCTGCAA CCTTGACGAT    199380
     CGCGGCACGG CCCGCTGCTC GCTTGTCGTG GTTTTCGACC TTCTCGAGCT CGTAGATGTC    199440
     GCCGAGCTTG GCCGTCGCGA ACTGGCCGTT GTCCATGAAA TCGAGTCTTA TGTTGTTGCC    199500
     GACCTGCAGG CGAAACGCCA TCGCATCATC CGCTTGCGGA TTGAAGGTCT CGTTGCTGCT    199560
     TGCGATGCGA GGCGCGATAT CTTCATCACT CGACCAAACG AGCTTTTCGC CGATCGACTT    199620
     CGCTGCGTTC TCCAGCATCT CACGCTTCGA CATTTCACCC TTCTTCGATT CCGACTGTCC    199680
     CATTTTCATT TTCCCCGTGG TATTGATTGG TCAACTGAAG CGCGGCGCTC CAGTCACCGC    199740
     GTTAGCGCTT CTTGACCGCC TTCGCGATCG TTTTTTTCGC GTGCTCCAGA ACGTTGTCCG    199800
     GGCAGGTACG CCGCCTCGCG CTATCAGGCG CGGCCAGATA TGCCTTCCAT GTCGACAAAG    199860
     CGATCGGAAA CGCCTGCCCG GCATTGACGA CGTCCAGTGC TTCCGCCTGC GTCATTCCGG    199920
     CCGCCTCAAT CAGCGCGCGC AGCGACGCCC CGTTGTCTGA AACCTCACTC ATGGCTTCCA    199980
     TCTATGGTGT ACAAGTGCAC CAAGCATAGC ACGCATTCGA GTCCGATTTC TTCGGTCTCA    200040
     ACCGCGACTG TTTTGCCGTA TCTGAGGGTC ATTGAGACAC GATGACGGAC ACTCGACTGC    200100
     TCGAGCGCTT CAGAAGCTGA TCTGCTTGCT CGCGCGAAGT TGCACGCGCG AGCCCTTCGG    200160
     GATTGGCCTC GTTGACAACG GAGATCGTGA CACCGTACTT GCGTCCCTGA AGACGATAAA    200220
     AGTCCAGCAC GGCTTGTTCG TCCTCGGACA GCATCGCAAC AATCTTGCCG TTCAGCGATT    200280
     CTACTTGCTC AATTGACGGT ATCGTCATAG GTCTCACCTG TTAGAGATCG GAAGTCAGGT    200340
     TAAATCGAAC AAACTACTGG ATGATCGAGC CGGTCGCCCA ATCATTTCCT CTGAACGGTG    200400
     CAGAGGTGAG AACGCAGGGC CTCTTGCGGC TCCCTTCCAT CGACCAAATC TCGCTCTCTT    200460
     CGTGACCGTC GATCGTGAAT TTCACATCGG CCTTGCACGC GTAGGACCCG TTGTCATCAG    200520
     TCATGTGGAT TGCCACAAGG AAAACCTTGT TTTTTATGCC GGTGGCGCCC GCTATCCGAT    200580
     CGGCCATGTG GTGCGACGCT TGCGAGCACG CGTTCAATCC GTTCTTTTGC CAAAGGCGTT    200640
     CACGTCTCTC CCTCGGATAC TGCAGGAGAA GGTAGTGAAG GAGTAATGCC GCACCGACGC    200700
     AACAGACGAC CATGGCGACG GTCTCACCCC AGTGCTTTAC CCCATTCGCG CGTTGCATTT    200760
     CAATGCTCAT AATTGTCGAC TCTGTACGCT CCGGAAGCTT CAGTTAACCG CTTGCCTTAC    200820
     TTCCCAACAC TCGATTGCCT CGGAGCGAAG ATGTGTCTCT GATTGATCTC GATTCTCGCC    200880
     GCGTACGAAT GCCAACCAAT GGCCGCGTAC GGCCACAATG TAGTTCTTTG AAGGAGACAG    200940
     CCGGTCGAAG AGCTTCCGTA GCGTCAACGT GCCTGCAACG CGCCCGTCTC GACACGGTAT    201000
     CAATTCAAGA CCGAGCCGAC GTGCGGCCTC CAAACCGCTG TCCGATTCAA TTCCATTGCC    201060
     TTCGATCCAG CCGCACTCCC GGCACACCTC GAGGACTTGA TCGATAGGGA TGGCGCCTGC    201120
     CTGACTGAGA GCATAGGGTA CGCACCCACT TTCGACACAA CGTCCGTCGT CCTCCAGCAT    201180
     CGGTTGGTCG AAATAGTACG CCCTGTCGTG ATGGTCCCAT GTATGCCCGC ACTCCGTACA    201240
     CTTGCGGTGC CAGTCTGCGC GATTCAATTC ATGCAGGACG CGTCCCATCT CCTTATCGCC    201300
     TTTCCCTTGA CCACACGATG GGCACGTTGG CCAGTGCTTC GGTACATAGC GATTGTCGCC    201360
     GGAGGTGTCG ACCACGGCGT CGGCTTGAAC CGTCTCCAGT GGCGCGAGCA AACCACGCTG    201420
     GACCAACCAC TTCGGGAAAT CGTCCTCGCT GATCCAGCAG TAGTCGTCAC CGGCTCCTTC    201480
     TGCTTGCGTG TAGCGTTCTG CTCGAAACTG GTCCGCGAGC GAGTCGATGT TCAAGCTCGG    201540
     CTGGCCAACA TACGGACCGG AGAGAAAGCG GCCGTCGCCG GCATAGAGCA TGTAGATCGT    201600
     GTCGTGAGAA GTTGTCATGC TGGATCGTTG TTAAGCGGCA TCCCGTTCGC GGGCTTGCTG    201660
     ATTGAGATCG ATGACGGCAC GATGCGACAG CAGAATGCGA AGATCGGTGT TGCCAATTAC    201720
     AACGAAATCG TCGCCAATTT CGGTAGCTCC AGCTTCGCTA AGGAGCTCGA TTGCCGCTTG    201780
     TGAGAGTTTA GCCACGTGTT CTCCAGTGCC CACCATATCG GGCGCAATGG TTAGGCGGCG    201840
     ATGCGCTCGA CGGCACGCGT CTCGATGCGG TTGGCCCCGA GATACGGCCG ATACGTTTCG    201900
     ATCCACCTCA TCGCCTCCGC TTCGGTGTCG AAGTCCTCGT CCGCGACGTT GAACACCCAT    201960
     CCCGGCGCAC CGTTTGCGCG CAGCGCGTCA ACAACCCATT TCGTCGCGAG CATTGGTGCT    202020
     CCCCTTCGTG TTACGTTGGT CAGTGCCCGC CGTAGGCTGC TCGACGATGT TGCCCTTTAT    202080
     GTCGAACTTC AGCCCTTGAT GTTCCGCCGC GTCGATTATC ATTCGCGCCT CGCTGTGCGT    202140
     CAGCGTCGAA TTCTTCTTGT TGCCGTACAT CACTGCGCAG GCTTCCTTGA GTTTCTTGCG    202200
     TTCTTCAGCA TTCATCGTCG TCCCTCTTCG TGTTGCGCTA GTCACGCTCT TTCTCCCGCA    202260
     GCGGCTATCA AAAAGCATTG AAGCATGGCT CGATGATAGG TGCACAAGTG CACCATGTCA    202320
     ACGTCAATAT TCGAATTTTT ATCTGCCTGC CAATGGAGCG AGGAAACTGC GCGGTCGCCG    202380
     AAAAAGGAGC CGCCCGGCAC ATGCGGGCGG CTCAATGCGA CGCATGTAAG GGGCATGCGT    202440
     CGCGGCCGTG GGCACAGCGG GGAACTGCAC CCAGCAACTG GAATGCGGGA ACAATGAGAT    202500
     AGGCTGGCGG GAGCGATGCG TTAGCCTTCT GAACGGCGCC GTCCAAACAG GCGATCGATC    202560
     AACGATCGCT TAGGCACCGT CGCAATGGCT TCCGGCGAGG GCCTCGGAAA CCAGTCGCGA    202620
     ATATCGCGGT ATGGCATGTT GTGCTGCTTC TGCCAATCGC CGATCCACAT TGCAATTACG    202680
     GCGTAGACGC TGACGCCATA ACCAATACTC GCGGCACCGT AAACTTGATG GTCGACCTCA    202740
     GGTGTTGCGC AATACTTCGG ATCGTCGAGC GTAAAGAACG TCCGGCAGTT GAATGGGCGC    202800
     GTTTCGTAGA TCGAGCAGCT GCCGTCCGCC GCTAGGAACG TACACGCGTC CTTGTGCCCC    202860
     GTCGTCTGCC CTTTCCCCTG CTGATCCAAC GCGGGGCCGC CTTTCCGCAT GATGTACTCG    202920
     GCTTCGAGCC TGCTTACGCT CACATCAATA CTGCAGCAGT GACTGCAGCC TTTGCTACAG    202980
     ACGCTGAATG TCGACACGAA CTCTGCGTAG CGATCGAGAT ATCCGTAGAC CGCTTCAAGC    203040
     CGAGTGAGCA TCGTTCCGCC CGGCACATTG AGCTGGGTGT CCACGACGTT CTGCCAGTCG    203100
     TCTATCAGCT TCTTCGGGAT CGGCGGGAGC GGGGTTTTGC CGGCCTGCTT GTGGAGCTTG    203160
     ATCGGACTAA CCTTCATTTA ATCTTCCTCA CGAACATCGT GTTGGCGTGC GGGGGCGGGG    203220
     TTTTGACTAC CGCTGACCGT CCTTTCGAGC GCCGAATTGA GCCAATATAT GGTGGCGAGC    203280
     GCAAACCAGA CGATTACACC GAGGAGCGGA CTGTGGTGAG AGGCCAAGCA TGCGATCGCC    203340
     GTTCCGAGAA GTAGCAGACC GGTATGTGCG ACAAGAATCG CCGCGTACAG CGCGGCCTCG    203400
     AGTTTCGGTT CAGTGCGGTT TCGCAGAATG AGGATCTCTT CCTTTGCCAA GTACACGCTT    203460
     AGGAAGATTG GCAGCGCAAG GCACGCGCAC CAAAGAGCAA CTGTGAGCTG CAAATCGAGC    203520
     GTGGGCAGTC CTGTCAGCGC CAACAGGATC AAGACGCAGA ACCCTGCGGA TCCAAGCGAA    203580
     TGTCGCTCGA GAAGTGCGCG AGCAGGATTG GGGCGTCGGC GATCGTTCTT CTTGTCCATG    203640
     ACTAGATCTC TCTATTCGCC ACGGGGCGGT CAAGTCGACG CATGGCGCAA TCGATCCACG    203700
     TCGCGATTGC TACGCCCCAC GATCCGACCA ACAGAACGAT GGCCACAACC GCTTGAGCGG    203760
     AGGCTGGCGC GCCGGATCCG GATGCTTTCA TGGAGACGTA CAGGACGCCC GGCAAGAAGA    203820
     CCAACATGGC AAGAGAAAGC ACTTCCCCGA CCTTCGGCTC GATCGTAAGC GCGGAGACAA    203880
     TGATGCCGGC TGCCGCAATT GCTAAACCGA CAGGTACAAA CCAACTCGGC GTCAGCGCGA    203940
     CGATCGCTTC TGCTTCAATA TCCCAGACGA GTTTCAGAAG CAGCGACGTC ACTGCAACGT    204000
     TCAACCAGTT CGCTGGAGAC GAGACGAATT TCTTAACCCC GGCCCGAGAT ATCGGGCGCC    204060
     CTCGTATGAT TTTGGTCATT TTGATTTTTC TACCAACTGT TCCGCTCATA GTTAACGGAA    204120
     GCGCGTCGAG AAACTTTACT TTCGGCCTGC TGTGCCGCCT GCGCATTCGA TCTTTTTCGT    204180
     AAGCCACTGT TGCGGCTCGG TCGATTTCTC TTTGGCGACC TCGATCTTGC ACTTTTGGCC    204240
     AGCGACGTTG GCGCTATAAC TTGCCGCGTC AGTCGAGAGT GCGATCGGTC GAAGTTCGAT    204300
     GAACATCGCG GCGAGCGCGT CTCGTGCCGC CTTCGCCGCC TGCTCAGTGT CGACACGGGC    204360
     CAGCACCGTA TTGCCCGTCC GCAAATCCAC CCGGACACTG TACTGAACGT CGTTCATCGT    204420
     GACGATCCCG GACTGGCTGG CAACACCGGA TCCTTCGCGA ATCGCAGCGC CAATCAGGCA    204480
     CGTAGCAGTC GAATCGGTCA TCCCCTTTGC GATAGATAGC TTGCGGATGT CGATTCGCTT    204540
     CACCGGCGTT TGCTCGCGCA TTACCGCCTG TGTACATGCG GCAGAAATGA GGTCCGGATT    204600
     GACCGGGTGA GCTGCAGCAG CGATCGAAGG TAGGTCAGTA GATTGGGCGA TGGCCACCTT    204660
     GGCTACGCAA AGAAGTGAGA GCACAAAGAC TCTTTTCATT AATCCCTCGG GTTGTGATTT    204720
     GAAGATCAAG CACGTTGAGC AATCGTAGGT GCACATGTGC ACTATGTCAA CTCGATCCGC    204780
     TGCGCGTCGA ATTATTCTGA GACGAGCACT AAAGTAAGCG CGACAAGATG CCGTAATAGC    204840
     GCGCACATCC ATTTCGGAAG CAAATGATCC GATGCGCTCG ACCTCTCGGA AAGCTCCCCT    204900
     GTTTGACGCG GCTACGCGTT TGAGCGCCAT GCCTGCCGAA ATCCTCGATC CGCTCTTCAT    204960
     TCGTTACCAT CTCGCGCTCG ACTTCCTTCG CGCCGGTTCG ACCGACGCGT CACACGTGGT    205020
     GACGCTCGCG GAGGTGCTCA TTGTGTCATG CGCTCTCTCC GATCTCGGGA GCGGCGACCT    205080
     CTCGCCCGAA GGCGTCGCGG CGATCGAAGG TGCCCTGCTG GAGTGCCACG AAAACGGGAC    205140
     ACGTACGGGA TCGTGGGTGC TAAGTGGGGA GGGTTACGGC GTTTTGTGCG CGCTCCTCGA    205200
     GCTGCATGAA AGCCAGCTGC GGGCGGCACC GCTGCATCTG GTCATGAAAG CGAACAAAGA    205260
     GCTGCTTCGC CGCCAGTGCT CAGCGCCACA TTGCGCGATC GGCAAGGCCG CGTAAGCGCG    205320
     CCTGTCAGTC GTCGTCCTCG GCATCGGACG GTGGAATCTC CGTGTGATCG ATAACCAGCG    205380
     GCAATCGAAT CTCTGCCCCT CGGACGAGAA GAAGGTTCTC TCCGGCCTTG AAGCTCCGTT    205440
     GGGGCGCCGG GCTCGGTACC AGCGCGGCGA CGTCGAAGTA GCCCCGAACT GGGATAATCT    205500
     GGCCGCCACT GCCCTCCATT CCACTAAATG CGACGACCGG CCGTCCTCGT CGCCAATAGA    205560
     CTATCCCGCC CCTTACGACC CCGAGGTTCG TTCCTGCATG CGAGGCGCGA ACGTTGATCC    205620
     GCACCGAATC GAAATCCCCT CGCGGAGGAA TCGGAACGAG ATAGCCGGAT CGGCCCTTTG    205680
     CGGGCACGAA ATGCACGTCC GTAAAATCGA CTGCTCCGTC CAGTGTTCCA TCAGGAACTG    205740
     GTGAGCGAAA CGCGTCCTGA CGCGAAAGGG AGCGGTCGGT ATGGCCATGA ACCCGTACAG    205800
     CATGCGCGCA TACCGCCGGC GCCGCTCCTG CAAGCGAGGC GGCGACAAGG AGAAATGCAG    205860
     CTCGTGCCGT GATTCGTGAC ATCGCGTTCA TGGCCTGTCC CCACTGGTCA GTCGGCAAGC    205920
     GACGTCAATC GAACGCTGAT CTGCGTATCC CCGAAGCGAG CGTTCATTTC CTGTCCGACT    205980
     CGCAGCGTCG AAGCGTCGAG CCAGCCTTCC GACTTCGTCT CGCCGGCAAA CAGCGGGCAG    206040
     CCGGCGATGA TCTTGCTCGG CGTTTGCGGT GCTTGCGACG TAGTCGCACG AATGATCGTG    206100
     GCGACGGCAC CATCCTTCTC TTCTGCCGGC ACGATCGTCA ATGAAACATC ATCGCCTTGG    206160
     GCGATCTGCA GTGTACTCGT TCCGAGTGCG CTCTTGAACG TACACGTCGC GTCCGGCGCC    206220
     GAGGTTCTGA AACCCGCCGT TGCCGCTGCG CCAATGATCG CCGACACGGA CGTTTGCGTC    206280
     ACTGACTTTC CTCGACGCAT GGTAACGGCG TAGAACGCAT TCTTGGGAGA AGGCGCGGTC    206340
     GATGCGCTTA CCCCTACCGT ATTGCCGGCC GTCTTCTCGT GGGGCGACGT GATGCCGGAA    206400
     TCCCTGACCG ATTGAGCCAG TGCAGGACCG ACGACCGACA GCCCCATTGT CAGCGCGACT    206460
     GCAGTGGCGC GGACCAAACG TTGATGATTC ATCTTCACCT CGGAAATAGA TGCGGGCCGC    206520
     CCTCAGGGCG ACCCGAGAGT TGAGTCGTTA GAACGTATAG CTGAGACCCA ACTGAACGAT    206580
     CGGATAAAAG CGGTAGCGGT CGACCTTGTC ACGCAGCTTT TGCTCTTCGG CCGCGACGTT    206640
     GGCGGCCCCG GCTGCAGCGA CGAGATCCGG AGAGACGTTG TAGTCGACAC GCGGGCGGCC    206700
     GTACGCCACG CCCACGTCAG CGGTAAAGCC GAGACCGCGC TTCGTCACGG GCTTGTGGCC    206760
     GAAGCCGAGG CCGATGTACG GCATCGCCGT CGGGTATTTC ACTCGCGCGC TGACCGACGC    206820
     GTTCGGCGCG TAGTACGACG AACCGTTGAT CTTGTACGAA CCATTCTGCG AAACCGCGTG    206880
     GCCGTCGATG TAGTCGTCGT TGAACAGCAC GCCGGCAGTG AGGCGGAACG AGCTCGAGCT    206940
     GAAGGGGAAC AGATCGAGGT AGGTGCCGGC GTTAAACAGA TGAAGACGCG CGTCGTAGTC    207000
     GAGATCGCCC GCCGAGAAGT TGTGCGAGAG ACCAAACCCG TTGATGTCCG CGTGAAGTCC    207060
     GGCCCACGAC GAAAGCGGCT GGGCGTAGCC GATACCAACA CCTTGCGTCC CGCCTTGCAG    207120
     GTAGAGATCG CCCGCGCGGG CGCCGGTTGC GACGAGACCG ACCGCGAGCG CGGCCGCAAC    207180
     GATTCGAAGT TTCATGATTC CCCGTACATG AGTAGGTCGA GATGGCCGCA TCAATTTCCA    207240
     AGCGGATGCG GCGAATTCTA CGCATCGCCA CTCAGACAGG CAACAAAAAA AGATATGTTT    207300
     ATGAATCCAT TCTCGCCGAA TTTCCATATT GGAAAACAAA AAAGGCGGCG CCGCATCGCG    207360
     GACACCGCCC TCCTCGTTGC ACCGGAATCC CCGCTCCTTA CATTTCCAAC CCCGACGTCA    207420
     AGGGGCGGCC GTCGGCCGAT GCCACGAGCT CGACCGACCT GCGACGCTCC CATTCGTCAG    207480
     CCACGGCATG TCCGGCCGCG ACTAAGCTGG CACGCCGACT CCGCTCGACG GCGTCGCGAG    207540
     GCGGGGCATC CGTGACAGTC GCATGGACCA CGAACGCACC GTACGCACTC AGCTCGGTTT    207600
     CCGACAGCTT GTCGAGATCG ACTTTAGCCG TCACTGCGTC CGGCGCCTTG ATGGCGTCAC    207660
     TCAGCGGATA CATCTCGATT GTCCCGATCG CGCCGTTCAA CGCTGCAATC TGCTCGAAGG    207720
     CGGCCGGGCT CGCTTTCACG TTGAAGCAGC CACCTTCGGC GTTGAACGGG CCGAGCTCAA    207780
     GCCCGAAGGA CGCGAGAAAC TCGCGGTCTG GCTCGGACGT TCGAATGTAG CCGTAGTACG    207840
     TGATGCTGGC AGGGCTCGCT GCCGGCAGCG CTGAACGCGG CACGCCAAGC AGCTGCTGCG    207900
     CGGAAAGGTC GGCAGCCGGG GAGAGAACGC CACGCTCACC ACTCCCGATC CCCATGGCGG    207960
     CCAGCGCCGC CCGCCCCCGC GCCGATCGAC CAGTATCAAC GCGGCGCAGT TCCCCGCCCG    208020
     GAGCGCTCAA GTCCGCAATC GTCGAAAGAC GGGCCAACAG ACGCGCAGAC GCGGAATGGC    208080
     GATCGAGCGC GGTCCGATTG ACGAAATCGG TGATTTCCGG CGTCATCACG CGGTCGATCT    208140
     CTTGCTGGAC AGCAGACGCG TAGGTTTCGC CGCGCGGCAC CTGCAGATGG TCGATACGAT    208200
     TGTTCAGCTG CTCGATCGTC GCACCGTGCC GCTTGAACCG ATCGGCAACG TCGCGGTACA    208260
     GGCGCTTAAA GAAGCCGCCG CTTTGATCTC GCTCGTACTC GCGTCGCTGC TCGTCTAGCG    208320
     ACGCCTGCAG CAGCGCGCCC GTTCGATAGC GCTGATCGCG GTCTCGCAGG CCGCGCACAG    208380
     TATTCGCGAT CGCGCGCGCG GTCGCGTACC CGGCAGCACC GATCGCTACC GCGCCAACGG    208440
     CCGGTGCTGC GATCGGGCCA GCCGCGATCA AACTGCCCAC CGCACCGAGC GATGCAACGG    208500
     ACACGACGCC GAGGCCAATG CGGTCTGCAC GTGCGCTTCG TGCTGCATCA GCCTCGCTGG    208560
     CCGCGCTGCG CTTCGTGAGT CGTTCGATGA AATACTGACG GAGATCGTCC TGAGTCAGCT    208620
     GCGCCGCATT CGGCGACAGG ACCTTGATGC GCTCTTGGAT CTGACTCCTA AGCGCGACGT    208680
     AGTCGAGTGG CATTCCGATC TCCCTACGCC GCAGCGAGAA TACTGGTCGA GACCGCATTC    208740
     GAACGCGCGA TCAGGCGATC GAGTTGCGGA TCGTCGGGAT GCACCGTCGA CGCGAAGATA    208800
     CCAGCGCGAG CAAGGTTGAG CGTGTCGGTG TACTCCACAA CGGCGCCAAG CACTTCCTTC    208860
     ATCGCGTCGT GCTGATCCTT CGGCAACGCC GAACCACGTG CTTTCAGGTC ATTGACGATT    208920
     ACGTCTCCGG CCTGTTGCAG GCGGTCGCGT TCCGCATCCA GTTCGCGGAC GACGGGGTGA    208980
     TTTTCCAGAT CGATACCTTC CTGCATCGAG TCCTCCATTG GATAAAACTG TCAGTTGATT    209040
     ATATGGAGGG TGCCAAACGT TCCGAAGGAA TAAATCGAGA ATTTCCGCAT AATTTGTCGC    209100
     CATTGCTCGC AAAGCGATTC GGCGTATATA TTTTTATTTG CGTGAAATTG CGCCCCTGAA    209160
     ACATTTTCGC AACATTCGCT ACTTATGTTC CGTCAAAGGG TCTCCAGCTG AAAAGGCCGT    209220
     GGCCTTGCGA GCAGTCTCCG CTAGTAGAAC GACTGCGGCG AACTTGCAGC CGAGCCTCAA    209280
     TTTGGCGTAG CGTTACCAGC CTGACCGTTA GTTGCTTGAA TTAACGTCGA TCACGCCCAG    209340
     ATGGCACGCG CGCCGGCACG GTATCCACGG TTGCAATCCG ATCGCCAGAC GCCCGAGCAA    209400
     GGCGCGCGCA TAACGAATTC GGATCCGTAC CGTAACGGGT AGCCACGCGG ACAAGCTGAC    209460
     GGATCGGCTT GACGACATCG ACGCCGAAGT TCGTTGCGAG ATGCCATTTC GTGATCTCGC    209520
     AGATCCACGG CAGGCTCCCA AGAATGGCTA CCTTGTCACC CGCTTCATTG AGTCGTGTGC    209580
     AACGCCCAGC GCGTTCCGAG CGTCGTCGTC TTCGAGTATT GCTAACACCA ATGCCCGACC    209640
     ACACTCGCAC TTCTTCAAGT GCTCTTTGAA GGTGTCGCGC GCGTTGCTGA AATCTGCGCT    209700
     GCATGCGGGA CAACGAAATC CCACTTTTCG CTCCTGCTTC CTATCCGCGA AAATCTGAGC    209760
     GGGCCACAAC CCCAATGCAG GCAGCGCCCA GAAGCACCAT CCCGAGAAGT CCAACAACCC    209820
     CCCGCCATTC ATCGGACAAG ACCAACGGAG CAGGAAGATT CTTCACCCGC AGCCCAACAG    209880
     CGACGCAGAC ACCGCCAGCA ATCATTGCCG CCGCGATTAC GGCGGCGTTC GGCGCTCTTT    209940
     TTGAAGAACC TTTCATATCT TTGCCTCGCT TTTTTCGTAC GTGTCTTACA CCGTCGCAGT    210000
     CAGACGCCGG GTTGCTTCCT CGCGTCCGAG ACGCGCGACA AAGCGCACCT CATCGGCACG    210060
     CATATTGGCC TCCCATTGCA TCGTGGCATT GCTACCGCAT TGCACGCGGA AATCCTCACT    210120
     GTACTTCTCG ATCACAATGC CTCGATCGCC ATTTGTGATC GCCTGACTCG AACCGGCCAA    210180
     GGCCCGATTG TTTATCGGCA CAAGGCTGAC CACCTCCACC AAGTCCCCGA CTTGGAAATC    210240
     GTCGAGCATC ATTTAATCCT CCTTTCGAAA AATTCCGGCT GACCGCGCGA ACGGCGGCGA    210300
     CTGCATCGAG TGGCGACAGG CCATCGTGAC GACGCGCGAG CACTTTCACT CGCCGCGACC    210360
     CGTGACGACG CATGCGGGCG AGGACTCGTT CAGCCTGCTT GACGCGAAGC AACCAGATAT    210420
     GCGGCGAAAT GCCCTTATCG AACTGAACCT TGCTCATGAT ATTTCTATTC GTGAATTTGC    210480
     TTCAGCGTGA GCACGACTGC AGCACCAGCC GGGCTACGCA GAGCCAGCGG ATGATCCAGC    210540
     AACAGGTATT GCGTGGCGAT GCCAGTACTT GAAGCCTGCT CGGTTCCTGC ATTGTCGATC    210600
     ACGTTCACAG TCGACTCAAG CATCTTTCCT TGGAGCCCAT GCCGCGCCGC GACAGCAACA    210660
     AACACACCAC TTGGGGACTT CGCCGTTTGA GGCTCGCCAA AATCCTCAAC GTCCAGCGTG    210720
     ACTGGCGTTG CGGTTGTGTC GTCAGGAAAT TGAACGTCAA CGACGTACGA CGCAGCTCGT    210780
     GCGCCGGTGA GAGCGGTCGC AAGTGCCGTC GCGACGCCCA AACGTTGAAG CGCAAGTTTC    210840
     ATTGGTATTT CCCGGTCAGT TCTTCAGGGT GATGCCTGCG TTCGAGTTCG TGCGCACAGC    210900
     TTCGACGAAA TCAGAGCTGG CATTCTGAAA CGAGGTGGTA TCCGTCTCCA CCATCTGCAC    210960
     AACGCGAACC GGTTTGCCCG CCTCTTTGGC TAAGCCACTA ATCGCCGACT CGATAGCGGC    211020
     GTTACGCTGG CCGCTGATGT AAATCGGCTC GCCCGCCTCG ACACGCTCTT TCAGCACGTC    211080
     GTACAGATCA ACTTCGCATG CCTCGCTATT CTTTGCCGCC ATCATTTCCA CGGTCGTGTT    211140
     TGCCATGTCG TTTTCCGTCG CCCGCCGTAG CGGACCCATT GGTTAGCTTT GTCGACTCGC    211200
     CGTCTTGGCG ATCTTCTCCC CGATCTCGGC TTGCAAGCGC TCGCAAGTGG CCGCGAGCTT    211260
     TTCGAGCTTC TTGGTGATGC TGGCGGGTGC TTCGCTCTCG GCGACGCGCA GCGCGTCGAT    211320
     CAAGGCACTC TTGGCGCGTC CCAGACGATC GGCCGTTCTT TCCATCACCC CCCCCTTTCC    211380
     GTTAGTCCGA CGAGTGCCAA ATCGCGGATT GCGATGAACT CGCGAGTCCG CTGGTGTCGC    211440
     TGTCGGGGCT GCAAGTCGAA ATCGACGTAT ACATGATCTG CAAACGTCTT TCCGCAGAGA    211500
     CTCTTGATCG TGCCAGTCCA TCCGCCTCGC TTCGCCTGCT CGCTCCACTC GAAATAGCGC    211560
     ACCTTGACTT CAGGTACGAC GCGCACCCTC GCGCCAACGG AGAACCCCAT AGCTGATGTT    211620
     GTAGTCACGA TCTATTTCCT GTCCGTGTTA TCGGCACATA TGCGCCAACC ATGAACAGAT    211680
     CATATACCCC CAATGGGGGT ATATCAAGCG TTTTTCTTGT CCCACTCAAG AATCTCTCGC    211740
     ACGTAAGCCC AAACCACGTC AGGCATGTTT CGAAAGTCAC TCGTGTCGTT CGGTGCGAGC    211800
     CACTTGTCCA GCGTCTTGAT TGGGACGCTG ATGCGTTTGG CAAACTCCGC CCGCGTCATC    211860
     CCCAGCGTTG TCATTGCTTC GCGTAGAAAT TCCTGCTGCG TCAGTGGTGT AGCCTGTACT    211920
     TTCGATGCCA TTCGCTTCTC GTATCACGTG CCATTGCCTG GGCTGGATGT CGTCGGCGCA    211980
     GATCTCGCCG GGCCGCGTGA AATGTTATAC CCCCATTGGG GTGCTATCAA CAGCAGGATT    212040
     CCAAGGCCTA GCACTCATTG AGTGCGGCTA TCGCCTTCCG CATTTCTCGC GCAGAGACGT    212100
     GCACCTCAGC GCGCGATCTC TGCCCGGACG TTCAAGTACC CCACCAGCTA CATAATGTCG    212160
     CCCGGCAAGT TCAAGGCCTG AAACCGAAAT CAACGACCCC ATATGGCCAC GCAAGGATCG    212220
     AGACGATCCC ACCAACCGCC AAGTAGGGAC CAAACGAAAA TACCGAGCCA GCCTTCATGA    212280
     CTTTCATCCA TCTCGCGACA GGCACAACTA GCAGACAGGT AAGGCAGGCC ACAAGCAGGG    212340
     TGTCGACCAC TGCGTTCCAT CCGAGCCACG CACCGACCGC AGCCAGCAGC TTTGCGTCAC    212400
     CCTGCCCAAT CGCGTCCTGA CTGCGCCCTC TCAATCGAGC CGCCCAATGC GCCGCCATCA    212460
     ATATTGCCCA GCCTGTTACC GCGCCCACCA GCGCGGCCGA AACGGGCACA AACACGCCGG    212520
     CGATCGCGCA GGCGAATCCG CATCCCATAA ACGGCAACGT TAGTAAGTCC GGGAGCAATT    212580
     GGGTATCGAG ATCTATCAGA GCAAGCAGCG TGATCCAGCC GCAGAACATC GCCACTGATA    212640
     ACGCCCGAAC CGACAGGCCG ACACGCCACG CGATCATCAC GGCGAGCACA CCGGCAACCA    212700
     GCTGCACGGC CAGAGCACGG ATCCGTTGTC GAACGGCGGA CTGCGGTCCG CTCGAGCAAA    212760
     AAATCAGCTC GACTGGAATC TGCCATGCGT GGGCAAGCGC ACGTGGTGCG GCCACCGCCA    212820
     CGCGATTGAG CATCCAGCCA CACGCAACCC CGGCGACGAG CAATACCGCG AGCAAGTTCG    212880
     ACTGCAATAG CATCAAGCCT CCGCCGTCCT GCAAAGCACT TGGCCCAGAT CTGATGACGC    212940
     GCAGAGCTCG CGCACCGAGA AGAGGGCGAC CCAGCGCGTG CTGCCCCGGT GTTCGCCTTC    213000
     TTCAACCACG GATTCGACCA CGTAGCCGAC ACCACCCCGT CCGTCGTCCA CGACGTCGAC    213060
     GACCGCACCG AGGTCGCCAA TACGGGGCGA AACAGGCGCG ACAAATGACG ACCTCATCAC    213120
     CGCGCGCGGT GGCGATTCGA TGTGAACTAC TTGCACGATC GGTCTGCTCT TCAAGCTCAT    213180
     TGCAACCTCC AACTCGTCAC CATCAGATCG AATGCCCTCA GGCGGCGGCC GCCGGCACCG    213240
     CATCCGGTGC GTCTTCGCTG TCGCTCGCTT CAGGAGGATC GTCGTGGAGG TACGACATGT    213300
     AATCAGGTTG GCTCCCGAGC CGACGATGAT CGCTATCGCG GGCGTCCATG TCATCGGCGC    213360
     AGATCTCCAG CGTCTCCTTC AAGACACCGG TCAAATGCTC ACGCGCGAAA CGAATGGCCT    213420
     CGGAATCGAA AGCGGACTTC CGCGCCCGCG CGATCCCGAG CGCGATGATC ATAATTTCCT    213480
     TGATCTCTGC CGGCGTGGTG CGATCGAGCA GATATCCGAG CGTCTTATCG TCGATCGATA    213540
     CGCCCTCCGG CAGGTACATG CGCGCACACT GCGCGGCGGC CTTCGAGCGA AATGCCGCGA    213600
     CGGGAACGAT CTTGTCGATG CGTCCGGGAC GCTTCAGAAT TCGGGGGTCG ATCCGCTTCG    213660
     GGTAGTTCGT CGAGAAAATC ACGTAGGTCC CGGCCGGATT CTTGGGCGTT CGCATCCCGT    213720
     CGAGAAAGCT AAGCACCTCC GCATCAGCGT GATAGAAGTG GTCGACCTCC TCCGCGATGA    213780
     TGATCGTCGG CCGTTTGTAC TTCGCTGCCT CAGTGCATGC GGAAGCGAGA TATTTTCCGT    213840
     CGACTTGCAC GCAAGCGATG TTTTTCGAAT GCTTGGCGGC CAGTGCTTGC GCGATCGTCG    213900
     TTTTCCCGGT GCCCGGGGGA CCCGCCATCA GGACCTTGCG CATACCGGAC TGCCCGTAAC    213960
     GCGTGTACAG CTCGATCTCT TCGAAGAACT GCAAGAAGTC GGCTTCGATC TCGGCGAACT    214020
     TCGGATGTAC GGTGAAGCGC TCCGCCTCTT TCAGTACGGT CGTGTCTACC TTCGTGTAGT    214080
     ACACCTGCTT ATCGAAAATC CCGATGTCCC ACACCCCCGA TTTCGGCAAC ACGCGCCGGA    214140
     ACTTTCTCAT CCCTGCATTC ACGAGGTTGT GCAGCTCGAG CATCGCCGCC CTCGTGCCGA    214200
     TCGCATACTC GATCGCGACC TTTGAATTCA GCCGGGAGCG AAGGATATGG ATCACGTGAT    214260
     CCTTTGACAG GCGAACACGA AAAGCCCCCG ACGCGTCGCC GAACATCAGC CGATTGCCGG    214320
     CCTTAGTCTT CACCACGGTC GGGCGGCTGT TCGATACCAT CAGCGACGAC GAGATCGGCT    214380
     CGATGTCGAG GTAGCTATGC ACCTTCTTCT TTCTTCGGTC GAGCAGCAAC TCCGCAAGTC    214440
     GCGGATAGTA GTGCTCGTCC TTCACGATCA ACCCAAAATC GTCGGGATAT TCCGCTTTGT    214500
     GGAAGTTGAT CGCCTGTTGC CACATCGGCA CGCGGGCTTG CGGAGAGGGG TTGATAGGTT    214560
     TGCTCATGGT TCGGCTCCAC TTGTTTATTG ATCGCAGATC AACCTGCGAC CAAGGCGTCA    214620
     ATGTCCGCTG CTACGATCGC ATCGCCGGCA CCGCCGACGA GCTTTGCGAG GACGTTTTGC    214680
     ATGTGCTTGC GCGCTTTCGA CTCGGATAGT TCGCGGGCGG TGGCCGTCTC CGGCGTGTCG    214740
     CCCATGAGTC CGATAAACTG CTGCGCCTTG GCACCGAGGT TTTCCAGCAT GTCCGGATCG    214800
     ACACCGGCGT CAGACACGAG GTAGTAGCAG AGCACCGGAT TTTGTTGTCC ATCGCGATGC    214860
     AGGCGGTCCT CCGCTTGCTT ATGGATTGCA GGTGACCAAT CCAGCTCGGC GAACACCGCC    214920
     ACTCGCGCCC TCGACTGAAG CCCGTCAATA CCGGTGGCCG CGCGCAGCGC GACGATGCAA    214980
     AGAAGTGACT CGCCCTTGAT GAAAGACTCT TTGGCAATCC ACTTTTGGTC TTCGGTTTGG    215040
     CGCCCCGTGA TTAGGACCGG TCGAAAGTCC GCCAATTCCG CCTGCAGGTA GTCGACGACA    215100
     TCATGGTGAT GCGCAAAAAC GACGGTCGGC TCGCCAGCCT CGAGCATTCC CCGCACGAAC    215160
     GCCGCAACCG CCGGGGCCTT GGCCACACCG GTCGCGCGCC GGGTCAATTC GATTGCCTGC    215220
     ATCTGCAGGC GCCCGCGCTC GAAACGATCC GGTGAAGCCT TGGCGCTTTT GGCAAGGCGA    215280
     ACTGCCTCGG TGACGAATTT CGCGAAGATG CCCTGATCGG AATCGACCGA CTCCACGATC    215340
     CGCTCTTTCG CAGGCAGCTG CGCCGCCACC TCCTCCTTGC GACGTCGCAA CATCAATCCA    215400
     TCGCGCCGGA GAGTCGCGTT GAGCAGTTCA GGGTCCTTCA CGACATCGCT GCCGTACCCC    215460
     GCACACCATT CGCGCGTGAA TGTGTCCCAG TCACCGAGAC AGTGGTAGTC GACAACGTTC    215520
     ATGACGTTCC ACATTTCACC GCCACGGCCG TAAATCGGCG TGCCGCTCAA GGCGAGAACA    215580
     ATCTCGGCGA TCGAGGCGAG CTCACTGGCA GCCGAATACT TTTCGGTGCC AGCGTGGCGC    215640
     AGCTCCTGCG CCTCGTCGAA AATCACCTTC TTCAGCCCTG CAGCGGCGAG CTCTTCGCGC    215700
     CAGTGCCGCA GCAACAGGTA GTGGCAGATG TAAATGTGTG CCGGCGGCAG CGGCTCCTTT    215760
     TTGCGGTTTG TGCCACGAAT GACATGCACG ACCAGCTTGC CGTCGCTAAA CAGAGGCCCG    215820
     GCGGAATTGT CTTGGACATC GAGAAACCGC GCGAGGAAGG CCTCCCAATG CTTCACCAGA    215880
     TGGGGCGGTG GCGTGACCAG CACCGGCCAC GCCGGATCGG TCGCGATAAC CGCGCTCGCC    215940
     GTGACGGTCT TGCCGAGGCC CATGTCGTCG GCGAGAAGCG TGCGCTTGTT CGTGAGAATC    216000
     CAATCGAGCC CTTCCTGCTG GAACTGACGC AATTCGCCCG TGAACAGTAC GTCGGGATAC    216060
     CGAACGATTG GGTGTGCAAG GATCTCCTGA CGCTTCAACA CAAAGGCGCA CGACCGCTCG    216120
     TAGTCCGCGA GGAATTCGTC CTTCGATACG ATGTCGAGCG GGTATCGGTG GAGAAACCAC    216180
     ACCAGCTCGC CGAAGAGGCG CTGGTTCACC GGAAACTTCG CGATGCCAGC CCCCCGCCCT    216240
     TCCGAAGCCG GAAAGAGTCT TTTTGCCATG GTGACCATCT GCGGATCACC CGTGATTTGC    216300
     CACAACGGCC CATGCGGTCC CTTGACCTTC TCGAGCACCC CGAGCGGCTC GGTATTGTGC    216360
     TCAGGCAGGA TCAGATATGG CGGAAGATCG TTTTTCAAAG CGCGACTCCC CAGAGCGAGT    216420
     TCAAGCTCAC GACATGTACG CGTTTCCCTC CGATCATCGC CCCTAGCTGA ACGCTCTTTT    216480
     CCAGCACCAC GACGATTTCT CGGCAGCTCG GCTGCGCTGC GTAGCGCTCA ATCTGGGAAA    216540
     GTAGCGCCGC TCGCGGCGGA CGACGCTTTT TGACCTCTAC GACCACGCCG TCCACCCAGA    216600
     CGTCGGCACG GCAGTGAGGT CCAAACCGGT ATTCCGTGCG AGCAGGCAGA TCCAGCGCGC    216660
     GGAGCTGATC CGCAATCTGT TCGCTCAGGT ACGCCTCGTC CTGTCCAGCA AGGCCGATGC    216720
     GAAGTTCGCG CAACGCCCGA ATCACGGACT CCGCCGTGAA GTTCGGAGCT TCACCCATCA    216780
     GCGCCAGTTG TTGCACTAGG CTCCTCCAGA AATCGCGACG TTCAGCTCCG TGATTTCGAA    216840
     CAGTTCATCT AGCAATTCCC GCAGCACCGT GCCACGTCCT GACCCACGCA GCGCGCGGTA    216900
     GCGCACGTAG CGCTGGCCGA TGCTCGCCAC ACGGAAGACT TCACCGCTTT CCCGGTCGCG    216960
     CAGGGCAACG CGCTTCCGCA GACAGGTAAG AACGACCGCT GCCATCGCAC ATCGCGCCCG    217020
     GAACGGGCGC GCCTAAAATA ATAAATGTTT TTGCATTCTA CAGCGCACAT CTTACCCATT    217080
     CAAGGCTATA CTTCGCATCA ATTTTCGATA ATTCGTCGCG ATCGTTTCTC AGGAGGCGTT    217140
     ATGTTGCGTG TGGTGAGCGG ATGGCTGCTG TCGAGCGCAT CGGCGCTGTT CATCCTCTAT    217200
     CTCGTCCTCC ATCTCCTTGC AGTCGCTCGA CTGTGGAGCA CGCGAGAACT TCCTGATCAG    217260
     TGGCCTGCGA ATCTCGCAAT CGCCGTTGCT ATCGGTGCCA TCGGTGCAGC CGGCTTGAAG    217320
     TACGGCATTT CGCTCACGCG GAAGCCGGTC CGAATCCGGA CCGGTCAACA TCAGTCACGT    217380
     TGAGGTCGAT ATGGACAAGG AACATGCCGT CAACACGAGC GATGTCTACG CGTTCAAGGC    217440
     TGTCATCGCC GCCGATCGCC TCGCTCTGCT TCGAGAAAAT CTCGCGAAGC TGAACAAGCG    217500
     GGCAGCAAAG CATGGGGTTG AGCCGTTCAC GATTGAGCTC GGCCGCTACG GCAACCAGTT    217560
     CGTGGAGGAC CGCTCCGAAG GCTTTGCTGC GAACATCCGC ACCGTCGAGG TCACGCTTAC    217620
     CGGTCGTCGC ATTTCGCTCG GCGACTATCG CGTGATGGCC TCGATCGATC ACCGAAACCA    217680
     AGCCTTCCAG ACCTTCGGCG ATTTCCAGAT TCCCGGGCGG TATCTCGACT GCGACGCGGA    217740
     GTGCGACCAC TGCAAGACGA AGCGCGATCG CGCGAAAACG TTCCTGCTGG CTGACAAGAG    217800
     CGGCGATCTG ATCCACATCG GCAGTTCCTG CGTCGAATCG TTCACCGGAT ATGCGCCCGA    217860
     ATTTGCCCTT GGGGCGACGA GCGTATGGGA TCAGTTTTCG GACATGAAGG AGCAGCTCGA    217920
     GGGCGGCGAT GACGGCATCC GCGACTGCAA AATGGAAGCG GCCAGCCCCA TGCGGCCGTT    217980
     CCTCGCCATC GTCTCGCGCA TGATTCGCCG TGACGGTTGG GTCTCGTCGT CGCTGGCCAC    218040
     CGCGAATCGC GAGAGCGGCC TCCAACCTGC GTTCTCGACA TCCCACAGCG CACTCGACGA    218100
     GCTAAAAAAG CTGATCGAGC GCGTCGGCCA CGAGGCGACT GTCGAACCGA ACGTCGACCA    218160
     GATCGATTTC GAGATCGCAT CGAATGCGCT CTCTCACGCA CGCGCAAGTT ACGCCGACGT    218220
     GCCCGACCGT GAGACGGTCG AGGCTTTCGA CGCGAACATG TGGTCAGTTT CATCTCACGA    218280
     CACGTTCATC AATCGACACG CCGGCTTCGC AGCATTCATC GTCCGCAAGT ACCGCACTGA    218340
     AGTGCTGGAA GCGAACCTCG CCAATCAGTT CTCAGGGGAG TCTCAGTACG TCGGGACGGT    218400
     CAAGAAGCGC GAGGAATTCG AGTTCACTCT CGACAAAAAG ATTCCCCTCG AAGGCGCGTA    218460
     CGGCACCAAC ACGCTCTGTC TGATGCACGA CCAGCAAGGC AACCAGCTTC GCTGGATGGC    218520
     ATCCGGGCTC ACCGACATGG AAGCCGGCAA GTCCTATCGC GCGAAAGCGA CCGTCAAGAA    218580
     GCACGAGGAG TACAAGGGCA TCAAGCAAAC CATCCTTTCT CGAGTCTCCG TAACCGAAGA    218640
     GCTCGGCAAC GAGCAGCGCA TCGAAGCCGG CGCCGCTGAG CCCCAAGCCA TCGAATGCTC    218700
     GATGTAAGCG GCTGGCGCCA ACCACTACCT GCATCATCAC CAATCTGAGG AGAACAGCAC    218760
     CATGAAGAAA ACCACCGTCA CCGCCGTCCT CGCAGCCGTC ATCGCACTCG CTGGGTGCGC    218820
     AAGCGCCGGC AACCAAACGC TGCGCAGCGC AAACCCGTCG GAAATCGAGC AGCATGTCGT    218880
     CAAGGGCAAA TCGACCAAGT CCGATGTCGA AGCGTATCTC GGCGCAGCCG AAAGCGTCTC    218940
     GTTCACCGAC TCCGGTCTCG AGATCTGGCA ATACACGTAC GCGAAACAGA CGTCCAAGGC    219000
     GATCAACTTC ATCCCCGTCG TCGGCATTCT TGCCGGCGGC GCCGACGTAG ACAAGAAAGT    219060
     GCTGACGATC CTCTTCAACG ACAAGGGCGT CGTCATGAAG TCCACTTACG CCGCGTCGAA    219120
     GGGCGAGATC CGCACCGGCC TCGCAAACTA ACGCGCTGGC TCGAGGCCTT ATGCGCTCGA    219180
     GCCCAACCCC GACTAACGGA GAGCCCATTG TGCCCTACTA CGTCCAGCTC ACTCCCGACG    219240
     TACTAATTGC GCTCTCGGCG CTCTCCGCGA CCGAACACAC CGCCAAGCTC GATGCCGAGT    219300
     GTCGGGACTT CGTTGTACTC GGTGGCACAC ACTCGCCGTC CGGTCAATCG CTCGACCTTT    219360
     CGGCTCAAGA AACGGCCTTC AACTTCGGCA CCCAAACGTC ACTCCTCTGA AGTGCCCACC    219420
     GCTCGCCGCA ATCGGCGAAA GCAGAGCGGA GAGAAACCAT GTTCACCATC TCGACTCCAC    219480
     GCGATCGGCT CGAACGCTCG CTTCCGTTCA TGAGCGCAGC GTCCGCTGAA GCCTGCGAAC    219540
     TCGTACTCGC AGGCAAGTTG ACCGGCCTCA ATGGCAGCCT GCGCGACGCG CTCGCACGCA    219600
     CCGTCGGCGA GCTTGCCGAC CAGCTCGTTA CCAATGGCAA CATCTCCATC TCCAACCTCC    219660
     TGAGGCTCGT AGCGCTCGAG GCGACGGCCG CTCATCCGCC TGAGATCCCG GGCGGAGAAC    219720
     AAAACCGTTC GAACTTTGCG CGTACGTTGT TTGAGCATCT TTATGGCTTA CTGACCGTCT    219780
     GCCGCCCCCA CTGACTACCT CACTGCTACA CGGAAACCCA TGAGCCCTAT CAGCAACGCT    219840
     CTCATTGCCA GCGTCGATGC TTCGGTGAAG CAGCAGACGC TCGTCGCCCT CGCCCCGCTT    219900
     CTCACCTATC TTGTAGGCTA CTTCGTCCGC CGGTTCTCCA AAACGGGCAC TGCGCAAAAG    219960
     TTCAATGTAG CTGCCGCGTT CGCGCTGCTG TTCGTCGGCG CAAGCCCGGT TGCGTTTGGC    220020
     CTTGCATCCA TGTTGCGCCT TGCAGTGCAG ATGCAGACGG TACAAACAGT ATGGGAGACA    220080
     GGTTCGCTGC TACACGACTA TGCAATCGTC TGCAAATACG ACCCGAGTAA AAGAAGAACT    220140
     GGCGAGCTGG AGGCAGCTGA AAAGCACCTC CGCCAGAAAG ACGTGCTCTG GAAGATGGCG    220200
     AATGTGAGCA ATCCCGGTCG TCCGCTCAGC GCAACCGAGC CCATTCCTTG CGACGTGACC    220260
     GCAGTCCCGG ACCTCAGAGA AATTCAAGCA TCGATGCCGC TCCTCGTGCG ACGCAGCGAG    220320
     TACGTGACCA TCTGCGCGTA CACGTCCTCT ATGTTGGCGC TCGTCTTCGT ATGGCTCATG    220380
     ATCCATCCGA TCCAACTTCG CAAACGCGTT CGAGACGGGC GAGAAGGCGA CGCAGCGCGG    220440
     GTAGCACCCA ACTCGATCGA CGTTGAACCT AGTACCGCCG GCAGCGACGC AGTGAGCTCC    220500
     GGCGCAAAAT GGTAATCGTG ATCAGCATCG GTTACGCGTA AGTGGACGAC TCGATCGGAG    220560
     ATCAGGTATG GACGGCAGAG AAAAACGGAA GCGCGATCGG ATGCCGCAGA TCGCCGCGTT    220620
     CGTCGAGTCG CTCGCCGACG CGTTTGGCCG CGAGTACATT GAGGATCTCG TGCGTCGGGG    220680
     CCAACAAGGT GAGCCGACAT TCTTTGCCAG CGAGAACGGC ATCGAGGTCG GTACCCGCTC    220740
     CCCCAACCCA GTAACCGTCT GGCGTTGTGA TCTGAAAGCG CTTCGTGACC GGCACGGTTG    220800
     CGGTGGCTGT GACGGAAGCT GTATTGGCAC GCAACAACGC TGCAAGCGGC AAAACTCCGT    220860
     CTAATCTCGG CCGCTCACAC TTCACCTTTG CGCTTCACCT TCGCAGCTGC TTCCTCAATG    220920
     CGTTCGACTG CATCAGCGCA GTCTGGATCG CCGCAATCCG CCATGCACTT CAAACAATCA    220980
     CCGCCGCAAT CGGTGCTCAG CGGATCCGCA GGATTACCGA GCGCGCGGCC GCAGACCCGG    221040
     CATTCATCTT GACCGGCACC CTTCAGGCGC CGAACGAAAA AGCCACCCCC GCCACTCACT    221100
     CCAACGCGCT CTATCTTTTA CGGTGTCCCG TTCGCCTCGC ATGCCGCCTT TATTACCCAT    221160
     ACCGTCGCTC CATGGGCACT GTGGGTGCTA CATCCGGTCC GGAGAAAGTT TTCGTAGAGA    221220
     CGACTGCCGG TGGCGTTCGT AACCGCCAAC GGAAAGGTTC CCTCCGGCGG ATCAATCGGT    221280
     CGAACCTTCC TTCGACCGTC CCCGTCGAAT GGCTTATATT TCGTCACTGT CCCCTCCGCG    221340
     TTACGTGCAT TTGCGTGCGA TGTACTCGTC AATCATGCGG TGAGCAATCT CTTGCGTCAC    221400
     GCGCTTGATG TGAGCCCCAT CGTGATAGTC GTCAGCGCCG TACCACACAG CCACAATGTC    221460
     CGACTGCGCC AACAGGACGA GTAGCGTCAA CGCATACCGG ACGGCAGGTC CGTCAAAGAA    221520
     ACCCAACCCA CTGCTAAACA CCTCCCAATA GCGGGTCAGG TAGTCAATCT TAAACAGGCG    221580
     ACCTTCGATC TGCGCCACAT TACTAGGGAA CCACTGATTT ATTCCGCCGG ACGGTCATCG    221640
     TTGAACAGGA CTAAGACGTT GTAGAGAAGA CCCCCGGAAC AGGCATAGTG AATGAAGCGG    221700
     CAGATCAGTT TTGCGGAAGC GGAATGCACC GGCAAGAAGC GCGTGACTCG TCGACAGCGC    221760
     TTTTTGACGG AGATGAACAG CGTCGTGCCT TGGGCGCGTC TGCTGGCGGC GCTCGAACCG    221820
     TACTACCCGA AGGGCACGCG AGGGCGTCCG CCGATCGGGT TGGAGCGGAT GCTGCGCATC    221880
     TACTTCCTGC AGCAGTGGTA TGGGCTGTCG GACGAAGGCT TGGAAGATGC GCTGTATGAC    221940
     AGCATCGCGA TGCGCGCCTT TGCCGGGATT GATCTGGCAG TCGAGAACGT GCCGGATGCG    222000
     ACGACTTTGC TGAAGTTCCG TCGCTTGCTG CTCGAGCATG ATCTGACGCG CCGGCTGTTC    222060
     GACGAGATCG GCATCTCGCT GTGCGAACGC GGGTTGATGA TGAAGGAAGG CACGCTGGTG    222120
     GATGCGACGA TCATCGAGGC ACCGCCGTCG ACCAAGAACG CCGAGAAGCA GCGCGACCCA    222180
     GAGATGCATC AGACCAGGAA AGGTAACGAG TGGCACTTTG GTATGAAGGC ACATGTCGGC    222240
     GTGGATGCCG ACTCGGGGCT GGTGCATAGT GTAGTGGGGA CAGCCGCCAA TGAATCGGAT    222300
     GTCTCGCAGG CGCATGCCCT GCTGCATGGT CATGAAGCGC ACGCATTCGG CGATGCGGGC    222360
     TATACAGGCG TGGAGAAGCG GGAGGAGATG CAAGGCGCCA CCGTAAAGTG GCATGTTGCC    222420
     ATCAAGCGCG GCAAGATCAA GACGATGCGC GAAGGCGCAT TGAAGGATCT GCTGATCGCT    222480
     GCGGAGCGAA CGAAGGCGCA GATCCGGGCG CGGGTCGAGC ATCCCTTCCA CGTGATCAAG    222540
     AATCTGTTTG GTCATCGCAA GGTACGCTAC AAAGGTCTGG CGAAGAACAC AGCGCAGTTG    222600
     TTCAGCCTGT TTGGTCTGGC CAATCTGGTC CTGGCCAAGA AATCGTTGTT GGCCAGTCAT    222660
     GGGAGCAGTC CGTCCTGAGT GCGCCAAGAG CGCTAGGGAA GCGCTGATCA ATAACGTCTT    222720
     TGTGTCGATC GGGTTGTCGA ACTGATCACG TAATTTCGCA ATGCACAATA TAAGTACATG    222780
     CCGAGCGGGT TTTTCCCCGA AAAGCGCCGG TTTGCGCCTT CCCCTAGCGC TCTTGGCGCA    222840
     CTCAGGACGG ACTGCTCCCA TGACTGGCCA ACAACGATTT CTTGGCCAGG ACCAGATTGG    222900
     CCAGACCAAA CAGGCTGAAC AACTGCGCTG TGTTCTTCGC CAGACCTTTG TAGCGTACCT    222960
     TGCGATGACC AAACAGATTC TTGATCACGT GGAAGGGATG CTCGACCCGC GCCCGGATCT    223020
     GCGCCTTCGT TCGCTCCGCA GCGATCAGCA GATCCTTCAA TGCGCCTTCG CGCATCGTCT    223080
     TGATCTTGCC GCGCTTGATG GCAACATGCC ACTTTACGGT GGCGCCTTGC ATCTCCTCCC    223140
     GCTTCTCCAC GCCTGTATAG CCCGCATCGC CGAATGCGTG CGCTTCATGA CCATGCAGCA    223200
     GGGCATGCGC CTGCGAGACA TCCGATTCAT TGGCGGCTGT CCCCACTACA CTATGCACCA    223260
     GCCCCGAGTC GGCATCCACG CCGACATGTG CCTTCATACC AAAGTGCCAC TCGTTACCTT    223320
     TCCTGGTCTG ATGCATCTCT GGGTCGCGCT GCTTCTCGGC GTTCTTGGTC GACGGCGGTG    223380
     CCTCGATGAT CGTCGCATCC ACCAGCGTGC CTTCCTTCAT CATCAACCCG CGTTCGCACA    223440
     GCGAGATGCC GATCTCGTCG AACAGCCGGC GCGTCAGATC ATGCTCGAGC AGCAAGCGAC    223500
     GGAACTTCAG CAAAGTCGTC GCATCCGGCA CGTTCTCGAC TGCCAGATCA ATCCCGGCAA    223560
     AGGCGCGCAT CGCGATGCTG TCATACAGCG CATCTTCCAA GCCTTCGTCC GACAGCCCAT    223620
     ACCACTGCTG CAGGAAGTAG ATGCGCAGCA TCCGCTCCAA CCCGATCGGC GGACGCCCTC    223680
     GCGTGCCCTT CGGGTAGTAC GGTTCGAGCG CCGCCAGCAG ACGCGCCCAA GGCACGACGC    223740
     TGTTCATCTC CGTCAAAAAG CGCTGTCGAC GAGTCACGCG CTTCTTGCCG GTGCATTCCG    223800
     CTTCCGCAAA ACTGATCTGC CGCTTCATTC ACTATGCCTG TTCCGGGGGT CTTCTCTACA    223860
     ACGTCTTAGT CCTGTTCAAC GATGACCGTC CGGCGGAATA AATCAGTGGT TCCCTAGGGG    223920
     AAGGCGCAAA CCGGCGCTTT TCGGGGAAAA ACCCGCTCGG CATGTACTTA TATTGTGCAT    223980
     TGCGAAATTA CGTGATCAGT TCGACAACCC GATCGACACA AAGACGTTAT TGATCAGCGC    224040
     TTCCCTAGGA GCCGCAACGC GAGGGTCCGC ATAGTAAATC AGCATCCCAT CCGATCCGAC    224100
     ATCGACGTAC TCATCCGCCT CGTCGACCAC TACCAGTCGC TCGTATTCGT CTGTCCTCTC    224160
     TGCCCTCCGG GCACCGGTGC AATGTTCAAT CAGTCCATCC AGCTGGCCCA CCCGTGAGGC    224220
     CGGAGGCGGT TCGCGGAATA GAACAAAAAT TGTTGCGCCC ACTGCCATTT CTCCGACCTC    224280
     CTAGTACTCG GCCGCCGAAC GGTAGGGGAT GTCAATGCCT AATCTCCCGG CGCACTCAGC    224340
     CTCATTTGCG ATCTGGCATA GGCTGTTTGC GAGGCGTCGC AACATGTCCG GATCAATCTG    224400
     CTGCCCATCA CCGAGCAAGG ACTCGAGCAC GATGACTGCT TTCCCGTTGA CGTCAGAGAT    224460
     CAACGAATAA GAGAGAATTG ACAACTTGAA GCCCCAGAAA TTTAGCCGAC TTCCAATTTC    224520
     TCATCGGCCG AACCGTATTC AGCATAGCGC ACAAAAACAC TACCTCATAA CGACATAAAT    224580
     GGCACTGCCT TGAATCCAAT CTGTCGGCCA TCTCGGTCGC GGACACCGCT CCGGCTTAAT    224640
     CAAGCGCCGA ACCGCCCATC CAGCGACACC ACCAAATGAA AAGCCCCGCG AAGGCGGGGT    224700
     CAGAATGCTC GTGCGGCGAT CGTCGCAAGT TACAGCGACG GCGAAGCAGA TTCCGCGTCC    224760
     GACTCCACCT GAGCACGATT TCGGCCAATC TTCGCATAGG CCGCCCTGAG AGCTTTGCAG    224820
     CCTGCGTCGC TCCATTCGAC CTGAGTCGTG GAGGGGCGAT GGAGATACCC AGCTCTCACG    224880
     CCGTCATTCA CGACACCGTT GATATCCGGG TTGTTCCACC AACAGGGCTC GGTGGACATC    224940
     GAGCGACGCG CCCAGCTAAC CCTGTCCATC GCGGTCGCAA CTTGCAGGAT ATCCGGCGCC    225000
     CCCCGAAACA CAGCCCACTG CGGAAGCGAC TCGATCGGCG ACAAATTCCA ATCCCTCGGG    225060
     CTCGCACTAA CGTCGTTACC ATCGAACAGC GATTCAGCCA CGTCCTCGCG CTCTGCAGAG    225120
     GACAAATCTA CCCACTTCTG GCCATCGAAA GCCTGTGCGG AGACAAGTTT ATCGTTCGCC    225180
     ACATCCACCA CGATGCGACA TTGCGTTTCC GCACGGCCCG GACCAAAGAG ATGGCTCCAC    225240
     TCACCCTCAA ACAGCCGGGC TTCCAGTAAG TTCCGATCAA GCTTCGCCGC ATTAAGGGTT    225300
     TCGCGCGTAG ACACAGGCAG TTTCATTACT TCGGGAATGA ACCGCTCCCC GGCCTCGAAA    225360
     CGACGAACGA GACCATCTGG AGACTCCGAC TCATCGGGGT CCAGTGCCGA ACGCAGAAGC    225420
     AGTCCGCCGT TGGGTGTTCT GAAATATTGC GTGTACTTCA CCGAACCATC CTTCAGCGCC    225480
     ACCGCGTCCG GAGTGATCCA CCCATCAACC AGTTCCGGCT TCTGCAAATA CTCCCGTAGA    225540
     TTCTCCGCTA CCTGCTGTTC CGACAGGTTC CGAACCGGTT TCCCCCAAAT CTCGCCTTTG    225600
     TCGTCCATCG CGAATGCCTC GGACAGCGTA TTGGCGTTAG GATCAAAGCG CACATTGAAG    225660
     TTGAGCCATT GGGATTCAGT CGCCGGAAAC CCGTGTTCGA CATCCTGTAG AAACTCGACT    225720
     CGAACCTCCG TGGTCCACCC GTTGGCTACA GTCGATGGCT TCCACGGGAT CTCGCTCATC    225780
     TCAGCCCAAC GGACACCGGT TCCGTAGTCG TAATCCATCA ATGTCCGATG CGCTATGTTG    225840
     AACCACGCCT TCGGCATTTT CCGCCCCAAC GTCAGCAAAC TGTGCACGTC GAGCACTCCG    225900
     CTAAGTTTAT TGCGCAGACT TTGACTGGCG AAGGAAGCCT TTCCGAGAAT CAGATCCTTG    225960
     CTGCCAACCA ACACTCGATA GATCCGAACA TTCAGATCAG TCGAAATCAC GAGAGGCGTA    226020
     TCAGCGTAGT CGCCGCATTC GCGCAGAATC GCCTGTGCTC GGGTTTTCAG GTCTTCATTG    226080
     CGACTACCAT GGATGTGCCC CCATGCATCT TGCAGCGTGA AAATGAGGTC CTTGTACTGC    226140
     TCCCGAACCG CTGTCTCCGG CGTCCGCTCC ACTCCGTCCA CGACGCGCAC GATGTCTTCC    226200
     GGTGCTGGTC CCGCGCGCCG ATCTACAGGA GCGATGCTAG CGAGATGGCT CTCTTCCACC    226260
     TCGATGCGGT ATCGCACGGC ATCGTTGTAA AGCATGCTGC TCTTGTCATG AATGAAGGAC    226320
     AGGTCGTCGA CCTCCCACGC CGGCGTAGTT CCGCCCCCAT CCACCCTCAC GCATCGCGTG    226380
     CCAGCCGGGA TGATCACGTC GTGCTTCATC TGACCCACAC CGAAAGAAAC TGCCATTTCC    226440
     TCCGACGTAA CGGCCGTATG TGTGTGGGGG ATTTTCACCG AGCTCATAGA ACCTCCAAAA    226500
     ATATTCTCGA TTGCCTAACG ACTAGCCATC GCGCCTAAGA CGAGACGTCA GCGTCGAACG    226560
     ACCGAAAGAA TCTTTTCGAG GCCGGACAAA TCGATCATCT TGCAACGCAA CAACGCAATA    226620
     CACACTGCGC GCTTGCGGCG GGCAATCGCT CAACAATCGT ATTGATGGCG ATGCAGGGA     226679
//

If you have problems or comments...

PBIL Back to PBIL home page