(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_5

ID   BURVG_5; SV 1; empty ; DNA; empty ; PRO; 397868 BP.
XX
AC   NC_009230;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-397868
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of plasmid pBVIE01 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-397868
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-397868
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000617.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..397868
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /plasmid="pBVIE01"
FT                   /db_xref="taxon:269482"
FT   gene            49..678
FT                   /db_xref="GeneID:4948354"
FT                   /locus_tag="Bcep1808_6621"
FT   CDS_pept        49..678
FT                   /locus_tag="Bcep1808_6621"
FT                   /gene_family="HOG000222133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sex pilus assembly and synthesis protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6168 sex pilus assembly and synthesis
FT                   protein"
FT                   /db_xref="GI:134288153"
FT                   /db_xref="GeneID:4948354"
FT                   /translation="MKLKRIIPCVVGLSLSLFASLSPAEDLGNYGNTWSIQEQDAIDMI
FT                   KGRLTQMEKKGQLKKFWEDYRQKQLSNLENPKPLPGITTATGPRVWTFDPTYTYPDNVK
FT                   DHLGNILVPAGTKINPLDYTALSKSIVFIDGRDERQVAYAKKRIDANPRDKVVLVAGSF
FT                   LKLDRAWHRPVYFDQQGILVHHFGIKRVPAVLSQKGKLLQIEEFAP"
FT                   /protein_id="YP_001110316.1"
FT   sig_peptide     49..108
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.663 at
FT                   residue 20"
FT                   /locus_tag="Bcep1808_6621"
FT                   /product="hypothetical protein"
FT   misc_feature    118..669
FT                   /note="Sex factor F TraW protein N terminal; Region:
FT                   TraW_N; cl10149"
FT                   /db_xref="CDD:175097"
FT                   /locus_tag="Bcep1808_6621"
FT   gene            675..1712
FT                   /db_xref="GeneID:4947946"
FT                   /locus_tag="Bcep1808_6622"
FT   CDS_pept        675..1712
FT                   /locus_tag="Bcep1808_6622"
FT                   /gene_family="HOG000222151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TraU family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraU family protein; KEGG: rme:Rmet_6167 TraU"
FT                   /db_xref="GI:134288154"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="GeneID:4947946"
FT                   /translation="MKKILLAFSLVFGLFFTASSANADDLCQGKFPNLITDVCWSCVMP
FT                   IKLFGSMTLLSSGQEDFDSGSGKAFCFCQNPPKVGIPTSFWEFDMMTDVTAVPGCFPLL
FT                   GGVRVSTGVNADAFGQVSDDQSGEIGETRASFMQVNLYINPAMYVLGAILDDTCMDQRG
FT                   IDIPWVSFADPTHNDDELAGIITPYAFPFGGMLAIGAMSADAVAATAGFPLQSIFWAAG
FT                   TYGHMYPLTGNNEAHMSNEQSARLQTTRILAKLHAAGTQYSAFGDDAMCGYYPQIIMDK
FT                   RQYKFTRLYPIPQTAKINGRCCDPIGRSTILTQTNTELPMPGWRDFGYAIFRKRDCCGG
FT                   AIAGQ"
FT                   /protein_id="YP_001110317.1"
FT   sig_peptide     675..746
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_6622"
FT                   /product="hypothetical protein"
FT   misc_feature    753..1694
FT                   /note="TraU protein; Region: TraU; cl06067"
FT                   /db_xref="CDD:174855"
FT                   /locus_tag="Bcep1808_6622"
FT   gene            1714..2391
FT                   /db_xref="GeneID:4947947"
FT                   /locus_tag="Bcep1808_6623"
FT   CDS_pept        1714..2391
FT                   /locus_tag="Bcep1808_6623"
FT                   /gene_family="HOG000236960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6166 hypothetical protein"
FT                   /db_xref="GI:134288155"
FT                   /db_xref="GeneID:4947947"
FT                   /translation="MTAISAGAQSLQMPSDAQIRAQMAKQQQDASAVLAQKVVPVKPGT
FT                   FKADVPVIKAPPPVRTQSLDEVMQQYAEAKKGPQIKRGASDLIIFVSFSMPKEVLTELA
FT                   RQARASGAVMVVRGFKDGSLMETKRAALEVNRAGAPWEIHPELFKAFKVKTVPTFVVAN
FT                   AEAESVLDDGCSPEASYSSVSGDISVDVALDTIRRRAQPAIAKMAENRIAMIRARNQQG
FT                   SLH"
FT                   /protein_id="YP_001110318.1"
FT   misc_feature    1975..2304
FT                   /note="Type-F conjugative transfer system pilin assembly
FT                   protein; Region: TrbC_Ftype; cl09883"
FT                   /db_xref="CDD:175043"
FT                   /locus_tag="Bcep1808_6623"
FT   gene            2492..3265
FT                   /db_xref="GeneID:4947948"
FT                   /locus_tag="Bcep1808_6624"
FT   CDS_pept        2492..3265
FT                   /locus_tag="Bcep1808_6624"
FT                   /gene_family="HOG000263214" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6165 hypothetical protein"
FT                   /db_xref="GI:134288156"
FT                   /db_xref="GeneID:4947948"
FT                   /translation="MLKKLAFLVAASTLSMAAVAASTTVIKSPFSGIVPDSSVLPAVKQ
FT                   INGIDGVKAGDARSASAGKALVNVTVSTKTTTAFVEVVREVSLTTGDATLTLRPGARIA
FT                   PAARLVDANGKLFYLVKTDRNTSSFFKTNRFFAVTEEGAVLDHAFSATGDTYEARETVS
FT                   VTPGDMVVTTKLTTGPALCGLTAVYLGGSEGVAKFRVLRTSSDGRVTAEHERAFASDLK
FT                   FINLSGTDLTIDKIDADAVRVKVRGLDQPSCTGTI"
FT                   /protein_id="YP_001110319.1"
FT   sig_peptide     2492..2554
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 21"
FT                   /locus_tag="Bcep1808_6624"
FT                   /product="hypothetical protein"
FT   gene            complement(3856..4131)
FT                   /db_xref="GeneID:4947949"
FT                   /locus_tag="Bcep1808_6625"
FT   CDS_pept        complement(3856..4131)
FT                   /locus_tag="Bcep1808_6625"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288157"
FT                   /db_xref="GeneID:4947949"
FT                   /translation="MEFLQFLKLVLIAFRNWMFRSQVVTAKRTDAFGFNLYECEGTPSV
FT                   TPGFFIVKYRHVVNGEVHEQHRRRVTVQEWDALRSKLESAEQEPAV"
FT                   /protein_id="YP_001110320.1"
FT   gene            4323..5138
FT                   /db_xref="GeneID:4947950"
FT                   /locus_tag="Bcep1808_6626"
FT   CDS_pept        4323..5138
FT                   /locus_tag="Bcep1808_6626"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288158"
FT                   /db_xref="GeneID:4947950"
FT                   /translation="MDERLKQFMDDSERIRAHLRDFSVTIVTMTAEPKPAAIGSGTLVK
FT                   IGERYGIFTAAHVVRDVPKERFCLVFAERQEGLNAFISSVRLDGGRAYPDGTSDLLDVA
FT                   FLELSAEGVETVGRHKQFLPESRIEVGTAYRDARFVGYGTPRTLVAGSGTQLRAKPLFY
FT                   VTEATSVRTNGRTIDDHIFLEYPRAGNIHLADGSAFGLKPDESRLLDDPRGISGGGIWT
FT                   PRLDGGDYSNPETFALVGILAGFIPGCRHIVGNQIQHALMVINKAVEPN"
FT                   /protein_id="YP_001110321.1"
FT   gene            complement(5246..5773)
FT                   /db_xref="GeneID:4947951"
FT                   /locus_tag="Bcep1808_6627"
FT   CDS_pept        complement(5246..5773)
FT                   /locus_tag="Bcep1808_6627"
FT                   /gene_family="HOG000106483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: bch:Bcen2424_2777 single-strand binding
FT                   protein"
FT                   /db_xref="GI:134288159"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:4947951"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKQSG
FT                   EMRDATEWHRVSFFGRLAEIVSEYLKKGSSVYIEGRIRTRKYQAQDGSDRYSTEIVAEQ
FT                   MQMLGGRGEGGGHTDQDSGGDNRGGYQGGRGGGNAGQGRGQGGYQQNSGGGQNRPAPSR
FT                   NNSESEMDDIPF"
FT                   /protein_id="YP_001110322.1"
FT   misc_feature    complement(5450..5755)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_6627"
FT   misc_feature    complement(order(5480..5482,5489..5491,5522..5524,
FT                   5549..5551,5612..5614,5618..5620,5663..5671,5744..5755))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_6627"
FT   misc_feature    complement(order(5471..5473,5477..5479,5516..5521,
FT                   5525..5527,5531..5533,5555..5560,5597..5599,5603..5605,
FT                   5609..5611,5615..5617,5621..5626,5660..5665,5684..5686,
FT                   5714..5716,5732..5740))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_6627"
FT   misc_feature    complement(order(5456..5458,5537..5539,5543..5545,
FT                   5549..5551))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Bcep1808_6627"
FT   gene            complement(5960..6703)
FT                   /db_xref="GeneID:4947952"
FT                   /locus_tag="Bcep1808_6628"
FT   CDS_pept        complement(5960..6703)
FT                   /locus_tag="Bcep1808_6628"
FT                   /gene_family="HOG000262923" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1124 hypothetical protein"
FT                   /db_xref="GI:134288160"
FT                   /db_xref="GeneID:4947952"
FT                   /translation="MKLHAIALACTLGMVVAPAVTAEDQVPAQSVSIDLAAETVGAEPV
FT                   NFIAAVGNWRIGADGNRKVLTVDGSKWQRGQPSAGLADKARALYGERYAEFLDNVTAYA
FT                   YFPIAVVKRIDDFRDGEISLRFKGIAGRIDQGAGIVFNLKPNGDYLVLRANCLENNLVL
FT                   FKYVHGVRSPVKWIRNTPTDTGRWHDLKLEVNGVSVKGYLDGKLYLEDTLAAPISGRIG
FT                   VWSKADSVMYFDDFRMITATRRPVS"
FT                   /protein_id="YP_001110323.1"
FT   sig_peptide     complement(6635..6703)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_6628"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<6083..6352)
FT                   /note="Laminin G domain; Laminin G-like domains are usually
FT                   Ca++ mediated receptors that can have binding sites for
FT                   steroids, beta1 integrins, heparin, sulfatides, fibulin-1,
FT                   and alpha-dystroglycans. Proteins that contain LamG domains
FT                   serve a variety of...; Region: LamG; cl00102"
FT                   /db_xref="CDD:119531"
FT                   /locus_tag="Bcep1808_6628"
FT   gene            complement(6700..8085)
FT                   /db_xref="GeneID:4947953"
FT                   /locus_tag="Bcep1808_6629"
FT   CDS_pept        complement(6700..8085)
FT                   /locus_tag="Bcep1808_6629"
FT                   /gene_family="HOG000262922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1125 hypothetical protein"
FT                   /db_xref="GI:134288161"
FT                   /db_xref="GeneID:4947953"
FT                   /translation="MRSPDPRSTAAILPALFRNEVRNLLTSRALWILLLILSPLVGYSF
FT                   IQAVSLFGEASRSALQSAELARGMTPLDGILVPTFGGFYLVVTLLFPFVAIRAVGQEKQ
FT                   SGALKLALQSPVRVPTLVATKVLAVGLVWLIVLLPAASAVAAWRLLGGHLYGPEVAGLL
FT                   FGHALYGLAVTAIAFFAAAVTESIATGAIVTLAFTIGSWVLDFAASGQVGWLAKLAPLS
FT                   LTATLREFEHGLFASAGALRTLTFSLALLALSVVWLPPGTRLRAKLAISIAMLFAAALL
FT                   VAGAGETRWYVELSEDQRNSFDPEDEAALRKIMAPLAITLYLSPDDSRAREMESDVLAK
FT                   LRRAVPRLTIRYASVKAGPFGASGDDRYGVIVYEYAGKHEESRSNSPREILPILYGLAD
FT                   VTVKPGAVTIYPGYPLVAEPAAAAWWFYGALPGLILYGWWRTRGAAPAPRRSGQSQPRE
FT                   KQS"
FT                   /protein_id="YP_001110324.1"
FT   misc_feature    complement(<7396..7923)
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Bcep1808_6629"
FT   gene            complement(8072..8771)
FT                   /db_xref="GeneID:4947954"
FT                   /locus_tag="Bcep1808_6630"
FT                   /pseudo
FT   gene            complement(8925..9848)
FT                   /db_xref="GeneID:4947955"
FT                   /locus_tag="Bcep1808_6631"
FT   CDS_pept        complement(8925..9848)
FT                   /locus_tag="Bcep1808_6631"
FT                   /gene_family="HOG000108825" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function LppY and LpqO"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function LppY and LpqO;
FT                   KEGG: bpm:BURPS1710b_A1560 LpqO-like protein"
FT                   /db_xref="GI:134288162"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="GeneID:4947955"
FT                   /translation="MLKRSLFRRTVLASLFALVAVNASAAAGSPAMDTTSIEQVTGLKG
FT                   TFSKDENVFKVTKPRNDIKIQVDNWTMPPFMGLTSWAAFTPGHHGQTMMMGDTVLFDDE
FT                   VNPAMSAALDAGLEVTALHNHFFFDHPRVYFMHIGGSGDAKTLAEGVRKIYDRIAEVRA
FT                   AHAEPANAFPGRIADASSITSAPLEAILGRKGQTNSGMFKVSIGKPISMHGVSVGNEMG
FT                   VNTWAAFAGTDDEAVVDGDFAMRESELQTVLKSMRASGINIVAIHEHMTGETPRVLFLH
FT                   YWGKGKAVDLAKAVKGALVAQAGVEK"
FT                   /protein_id="YP_001110325.1"
FT   sig_peptide     complement(9771..9848)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.607 at
FT                   residue 26"
FT                   /locus_tag="Bcep1808_6631"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(9375..9749)
FT                   /note="Domain of Unknown Function (DUF1259); Region:
FT                   DUF1529; pfam07485"
FT                   /db_xref="CDD:148856"
FT                   /locus_tag="Bcep1808_6631"
FT   misc_feature    complement(8943..9296)
FT                   /note="Domain of Unknown Function (DUF1259); Region:
FT                   DUF1529; pfam07485"
FT                   /db_xref="CDD:148856"
FT                   /locus_tag="Bcep1808_6631"
FT   gene            complement(9876..10331)
FT                   /db_xref="GeneID:4947956"
FT                   /locus_tag="Bcep1808_6632"
FT   CDS_pept        complement(9876..10331)
FT                   /locus_tag="Bcep1808_6632"
FT                   /gene_family="HOG000109158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_C1204 hypothetical protein"
FT                   /db_xref="GI:134288163"
FT                   /db_xref="GeneID:4947956"
FT                   /translation="MKWVTRERPKIDRIACPWLIARFIDKQPEFLYVPNRDVLRVAEET
FT                   GAIPYDIPGVELSHVDDLCSFDAFLKKYGLEDSALHQLATIIRGADTSRLDLTPQSPGL
FT                   FAISLGLSQTFSDDHEMLRHGMVMYDALYAWCQLCQAEKHNWPPQMN"
FT                   /protein_id="YP_001110326.1"
FT   misc_feature    complement(9921..10325)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcep1808_6632"
FT   gene            complement(10374..10694)
FT                   /db_xref="GeneID:4947957"
FT                   /locus_tag="Bcep1808_6633"
FT   CDS_pept        complement(10374..10694)
FT                   /locus_tag="Bcep1808_6633"
FT                   /gene_family="HOG000262921" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6197 hypothetical protein"
FT                   /db_xref="GI:134288164"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4947957"
FT                   /translation="MKPLFRFLSATSLVALCIALVGCEKSPFEKQPGETVAIAQVPAAV
FT                   KATIDRQSQGGSVKEIEKLTRNGKTFYRASVLQNGQEQKFVVAEDGALMATRAGDDEED
FT                   DD"
FT                   /protein_id="YP_001110327.1"
FT   sig_peptide     complement(10626..10694)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.840 at
FT                   residue 23"
FT                   /locus_tag="Bcep1808_6633"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(10413..10574)
FT                   /note="Protein of unknown function (DUF2874); Region:
FT                   DUF2874; pfam11396"
FT                   /db_xref="CDD:151836"
FT                   /locus_tag="Bcep1808_6633"
FT   gene            complement(10801..12219)
FT                   /db_xref="GeneID:4947958"
FT                   /locus_tag="Bcep1808_6634"
FT   CDS_pept        complement(10801..12219)
FT                   /locus_tag="Bcep1808_6634"
FT                   /gene_family="HOG000003016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   sme:SMc00808 putative chromate transport protein"
FT                   /db_xref="GI:134288165"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4947958"
FT                   /translation="MNSVGPPRSDVPVFEAPAHERHGVSFREAFWVWVRVAALSFGGPA
FT                   GQIAVMHRILVEEKRWISETRFLHALNYCTLVPGPEAHKLAVYVGWLLHRTRGGLVAGI
FT                   LFILPGLVALGVLSWIYATYGDVGYVQALFFGLKAAVLAVVLEAVVRVGRRALKTRTMV
FT                   AVAALSFIAIFFFAVPFPAIIVAAAAVGLIGRATGAMSPRGTAAQRETEHDDGPLPAID
FT                   AAFAVEIPEHVRPSHARALKVTAIGLLLWLGPLFAFLATIGPDSVFTHIATFFSKMAVL
FT                   TFGGAYAILTYVAQQAVDHYHWLAPGEMLAGLGMAETTPGPLISVVQFVGFMAAFRQPG
FT                   ALDPAIAGTLGGILAKWATFAPSFLFIFIGAPYVEALRHNKALNAVLSTIMAAVVGVIL
FT                   NLAIWFAIHTLFAQVDVKQALGMTLQIPVLSSLDLWSLVLSAAAMVALFRFKLGMMTTL
FT                   AGCCVAGIVIHMIG"
FT                   /protein_id="YP_001110328.1"
FT   misc_feature    complement(<11827..12147)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_6634"
FT   misc_feature    complement(<11002..11412)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_6634"
FT   gene            complement(12273..12851)
FT                   /db_xref="GeneID:4947959"
FT                   /locus_tag="Bcep1808_6635"
FT   CDS_pept        complement(12273..12851)
FT                   /locus_tag="Bcep1808_6635"
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="manganese and iron superoxide dismutase"
FT                   /transl_table="11"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   rme:Rmet_6201 manganese and iron superoxide dismutase"
FT                   /db_xref="GI:134288166"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="GeneID:4947959"
FT                   /translation="MKQLACDPSRLAGLSEKLIVSHYENNYGGAVKRLNAITAQLASVD
FT                   VASAPVFVVNGLKREELIAANSVILHEIYFDCLGASGKPAGDLEAALTRDFGSVERWAA
FT                   EFSAMGKALGGGSGWVLLTWSPRLGRLVNQWASDHTHTLADGAPVLALDMYEHSYHIDF
FT                   GAKAAAYVDAFMENINWTNVADRFASVSG"
FT                   /protein_id="YP_001110329.1"
FT   misc_feature    complement(12294..12608)
FT                   /note="Iron/manganese superoxide dismutases, C-terminal
FT                   domain; Region: Sod_Fe_C; pfam02777"
FT                   /db_xref="CDD:145761"
FT                   /locus_tag="Bcep1808_6635"
FT   gene            complement(12901..13413)
FT                   /db_xref="GeneID:4947960"
FT                   /locus_tag="Bcep1808_6636"
FT   CDS_pept        complement(12901..13413)
FT                   /locus_tag="Bcep1808_6636"
FT                   /gene_family="HOG000262920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288167"
FT                   /db_xref="GeneID:4947960"
FT                   /translation="METVMRLQLKSTLLATVNTSGAQWIVPTRLALAVLLLFPIDGSIQ
FT                   HLFAFRVADLSALSFSSAALGKALRAIEILAGLSFVAGLGARLAAYPTVVIFAVRALAN
FT                   SANSFPWLRDAMNGVIVPHGDWGYGAMYFGVALLLGEFLDVGSGRWSIDYWLSRKLKES
FT                   GEPRSGR"
FT                   /protein_id="YP_001110330.1"
FT   gene            complement(13551..14738)
FT                   /db_xref="GeneID:4947961"
FT                   /locus_tag="Bcep1808_6637"
FT   CDS_pept        complement(13551..14738)
FT                   /locus_tag="Bcep1808_6637"
FT                   /gene_family="HOG000263790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bam:Bamb_5053 chromate transporter, chromate ion
FT                   transporter (CHR) family"
FT                   /db_xref="GI:134288168"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="GeneID:4947961"
FT                   /translation="MTTTVATNAPTYSLGQLVGYMLRLGALGFGGPVALAGYMRRDLVD
FT                   QRGWITEADYKEGMTLAQMAPGPMAAQLAIYLGFVHYRLLGATLVGFAFVLPSFLMVVA
FT                   LGFAYAHFGGLSWMQAVFYGVGAAVVGIIAMSAYKLTTKTIGKDKLLWTIFLTLAAVTF
FT                   ITESEIAWLFIVAGLICWFWRAPPKWLNRGGLNAIAAANLPIASNLLSGVDLSVLTQIG
FT                   IFFTKAGAFVFGSGLAIVPFLYGGVVTEHHWLNDKQFVDAVAVAMITPGPVVITVGFIG
FT                   YLVAGFSGALVAALGTFLPCYLFTVIPAPYVKKYGHRPDVKAFVDGITAAAIGAITGSV
FT                   LVIAKRSIVDIPTAILALATVVLLWRFKKLQEPVIVTAAALIGLVAYPLIHSHAI"
FT                   /protein_id="YP_001110331.1"
FT   misc_feature    complement(14175..14705)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_6637"
FT   misc_feature    complement(13590..14675)
FT                   /note="chromate transporter, chromate ion transporter (CHR)
FT                   family; Region: 2A51; TIGR00937"
FT                   /db_xref="CDD:162120"
FT                   /locus_tag="Bcep1808_6637"
FT   misc_feature    complement(13584..14087)
FT                   /note="Chromate transporter; Region: Chromate_transp;
FT                   cl00902"
FT                   /db_xref="CDD:154076"
FT                   /locus_tag="Bcep1808_6637"
FT   gene            complement(14735..15646)
FT                   /db_xref="GeneID:4947962"
FT                   /locus_tag="Bcep1808_6638"
FT   CDS_pept        complement(14735..15646)
FT                   /locus_tag="Bcep1808_6638"
FT                   /gene_family="HOG000266560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromate resistance exported protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_5054 chromate resistance exported
FT                   protein"
FT                   /db_xref="GI:134288169"
FT                   /db_xref="GeneID:4947962"
FT                   /translation="MRFWRALKAKGAAVLRDGIYLLPHTEEREQMLRELAVAIADSGGT
FT                   AHLLRAPSLDASQEAEFRALFDRSDDYATFINSLADARKTVSGQSATDLTRLLRRLRKD
FT                   YEALVATDYFPGDAATRAEVALQDLTALVDTVLSPGEPHPAERVIRLLSCDAYQGRTWA
FT                   TRERMWVDRVASAWLIRRFIDADARFVWLASPGDCPPDALGFDFDGAAFTHVGERVTFE
FT                   VLLASFGLDKDQALVRLGEIVHALDVGGPAAPETVGFEAVMAGTRRRAENDDQLLEQMG
FT                   AVLDSLYAHFASNGKNETGGRS"
FT                   /protein_id="YP_001110332.1"
FT   misc_feature    complement(14771..15163)
FT                   /note="Chromate resistance exported protein; Region:
FT                   Chrome_Resist; cl01744"
FT                   /db_xref="CDD:154566"
FT                   /locus_tag="Bcep1808_6638"
FT   gene            15824..16417
FT                   /db_xref="GeneID:4947963"
FT                   /locus_tag="Bcep1808_6639"
FT   CDS_pept        15824..16417
FT                   /locus_tag="Bcep1808_6639"
FT                   /gene_family="HOG000262919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6198 hypothetical protein"
FT                   /db_xref="GI:134288170"
FT                   /db_xref="GeneID:4947963"
FT                   /translation="MAATRTIHVRWIRKQEMSPMQTSDERARLSRSGVSHGRIAASLVR
FT                   SRRLFLRVNSNDAVKVGETAPFAMVRKRWMSPLTLALALFAIGSSEAIAQNASFKLLSA
FT                   AQIRAKLTNKYVSDNAHWLHHYLPDGRLVLVERGREKTGRWFVRNGQLCLVRSERISEP
FT                   ECLDIYAQGREVEYRDKGQVIAAGSIRSSPDRSH"
FT                   /protein_id="YP_001110333.1"
FT   gene            16576..16923
FT                   /db_xref="GeneID:4947964"
FT                   /locus_tag="Bcep1808_6640"
FT   CDS_pept        16576..16923
FT                   /locus_tag="Bcep1808_6640"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhodanese domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rme:Rmet_6200
FT                   rhodanese-like protein"
FT                   /db_xref="GI:134288171"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:4947964"
FT                   /translation="MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASW
FT                   YAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAATLAQLGFAASYLEGGFAQWLADGL
FT                   PVTSHTPGNPS"
FT                   /protein_id="YP_001110334.1"
FT   misc_feature    16591..16872
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="Bcep1808_6640"
FT   misc_feature    16777..16779
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Bcep1808_6640"
FT   gene            17072..18214
FT                   /db_xref="GeneID:4947965"
FT                   /locus_tag="Bcep1808_6641"
FT   CDS_pept        17072..18214
FT                   /locus_tag="Bcep1808_6641"
FT                   /gene_family="HOG000099341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c assembly protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   rme:Rmet_3282 cytochrome c assembly protein"
FT                   /db_xref="GI:134288172"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="GeneID:4947965"
FT                   /translation="MEYISNDNSGSLLTGRSAFDWFYAILIVGGAVFALMRYHEYMNVY
FT                   EETILILTAPTSILLGWHWKAARWTLMLIAILSLSAILLYAGDSSHSASNFFLKYLLSS
FT                   PTAILWMCTLFFLSTAFFWGGLVFKSELGFSLGSKLCWSATVLGSAGLMVRWYESYLLG
FT                   PDIGHIPVSNLYEVFVLFSLITAMLYLYYEERYETRAVGPFVLLVISASIGFLLWYTFS
FT                   RQADQIEPLVPALQSWWMKIHVPANFIGYGGFALASMVAVSYLLKDRGLIVDRLPSLEL
FT                   LDDVMYKSIALGFLFFTIATILGALWAVDAWGGYWSWDPKETWALIVWLNYAAWLHLRL
FT                   VKGLRGRIAAWWALGGLLVTTFAFLGVNMFLAGLHSYGRL"
FT                   /protein_id="YP_001110335.1"
FT   misc_feature    17489..18205
FT                   /note="Cytochrome C assembly protein; Region:
FT                   Cytochrom_C_asm; cl00504"
FT                   /db_xref="CDD:174248"
FT                   /locus_tag="Bcep1808_6641"
FT   gene            18476..19423
FT                   /db_xref="GeneID:4947966"
FT                   /locus_tag="Bcep1808_6642"
FT   CDS_pept        18476..19423
FT                   /locus_tag="Bcep1808_6642"
FT                   /gene_family="HOG000209225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bxe:Bxe_B1271
FT                   hypothetical protein"
FT                   /db_xref="GI:134288173"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:4947966"
FT                   /translation="MSSDLPSRPSRRSALKCLAFGGAGTLFVLSGGVLTPVELALAASS
FT                   KDKAAASVVPLFLQISDSHIGFNKEANPDVAGTLKQTIDYVNAMPIKPALAIHTGDITH
FT                   LSKPEEFDLAAQLLSGLNPITELHTVPGEHDVTDGPQGEYFKRFGKASDNRGYYSFDHN
FT                   GVHFIGLVNVLHFAPNALGSLGEDQLSWLESDLKARSSSTPIVVFAHMPMWTIYAPWGW
FT                   GTGDAGQAMSYLKRFGSVTVLNGHIHQIVSKVEGNVTFHTARSTAFPIPTAGNGPGPVP
FT                   LTVASDQLPRMLGVTSIKISRHPLAATVSDTTLA"
FT                   /protein_id="YP_001110336.1"
FT   sig_peptide     18476..18604
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.692 at
FT                   residue 43"
FT                   /locus_tag="Bcep1808_6642"
FT                   /product="hypothetical protein"
FT   misc_feature    18641..19288
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Bcep1808_6642"
FT   misc_feature    18644..19222
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="Bcep1808_6642"
FT   misc_feature    order(18659..18661,18665..18667,18776..18778,18872..18877,
FT                   19103..19105,19211..19213)
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_6642"
FT   misc_feature    order(18659..18661,18665..18667,18776..18778,18872..18874,
FT                   19103..19105,19211..19213)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Bcep1808_6642"
FT   gene            19481..19693
FT                   /db_xref="GeneID:4947967"
FT                   /locus_tag="Bcep1808_6643"
FT                   /pseudo
FT   gene            19858..20733
FT                   /db_xref="GeneID:4947968"
FT                   /locus_tag="Bcep1808_6644"
FT   CDS_pept        19858..20733
FT                   /locus_tag="Bcep1808_6644"
FT                   /gene_family="HOG000262918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bxe:Bxe_B1190 ABC molybdate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="GI:134288174"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR011587"
FT                   /db_xref="GeneID:4947968"
FT                   /translation="MGRKLLACCAMLAGVLIAKTSVAYEGTVDVLYAGSLVNVMERSVG
FT                   PAFEKDTGLRFHGYAAGSNKIANEIKGKLRRGDVFISASPKVNDGLMGAANGDHVTWYV
FT                   NFAESPLLIGYNSRSHFAGEFKSKRWDQVLREPGIRIGRTDPKLDPKGAFTVDMMKKAA
FT                   DFYHQPDLVEKTLGAPENPEQVLPEETLVGRLQSGQLDAGFFYSTETSDLKIPAVRPAP
FT                   ELQAKARYTLTILGDAPNPAGAARFVDFLLSAKGRALLKEHGVDVVKPTVAGNAQAVPP
FT                   SLQAVIDAAQ"
FT                   /protein_id="YP_001110337.1"
FT   sig_peptide     19858..19929
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_6644"
FT                   /product="hypothetical protein"
FT   misc_feature    19870..20718
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep1808_6644"
FT   gene            20730..22577
FT                   /db_xref="GeneID:4947969"
FT                   /locus_tag="Bcep1808_6645"
FT   CDS_pept        20730..22577
FT                   /locus_tag="Bcep1808_6645"
FT                   /gene_family="HOG000262916" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related; SMART:
FT                   AAA ATPase; KEGG: bxe:Bxe_B1189 ABC molybdenum transporter,
FT                   fused ATPase and inner membrane subunits"
FT                   /db_xref="GI:134288175"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4947969"
FT                   /translation="MKRSTARPLVALAGLLAVYLCAPFVASIPQIGQADWAGVDWGTTW
FT                   SAVAVSAGSASVAALLILVGGVPLGYWLARSSSRAMALLGFVVQLPLALPPLTSGVLLL
FT                   FLVGPYSWVGRVTGGALTDSFAGIVLAETFVAAPFLIVAARSAFASIDPVFEDVAATLG
FT                   HHAGNRFFRVALPAAWPAIRAGLALAWLRAFGEFGATVMVAYHPYSLPVYTYVVFGGQG
FT                   LPAMMPLLLPTLAIAVICAMLSVYSRGARIDAAAPPVNGDEPPFAPPRAVIADALPNPC
FT                   LAVQLTKRLGTFSLDLNWTPSTKRLAIIGPSGSGKSLALRLIAGLEQNEGGTVMLGQLD
FT                   LGALPPERRQIGYTPQDYGLFPHMTVAQQLAFPVDADAASARYWVDHLGLTALLNRLPH
FT                   QLSFGQRQRVAVARALTRHSHLLLFDEPFSALDTPRRRRLQRSLRELQREISAVTIIVT
FT                   HDPDEASLLADEVLVIDQGRVLQTGAIEQVFKQPASMRVAELLGLRNVGSGVIHAPGLI
FT                   RVNDELFIETANRSIGVRQRVMWRVAARAIRPVGGPGSFEAVVDSIELRNGERFARVEI
FT                   ARVHFDLAIGDSSLVERHACHFAVDPDGVSVWIVGSEAT"
FT                   /protein_id="YP_001110338.1"
FT   sig_peptide     20730..20834
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.613 at
FT                   residue 35"
FT                   /locus_tag="Bcep1808_6645"
FT                   /product="hypothetical protein"
FT   misc_feature    20940..21362
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    order(20949..20951,20979..20990,20994..21023,21030..21035,
FT                   21039..21041,21129..21134,21138..21140,21144..21146,
FT                   21153..21158,21162..21164,21174..21179,21186..21188,
FT                   21237..21239,21279..21284,21291..21293,21312..21323,
FT                   21330..21335)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    order(20997..21041,21312..21329)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    order(21039..21041,21111..21113,21330..21332)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    order(21189..21227,21243..21248,21258..21260)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21585..22556
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21585..22247
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21657..21680
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    order(21666..21671,21675..21683,21795..21797,22002..22007,
FT                   22104..22106)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21786..21797
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21930..21959
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    21990..22007
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    22014..22025
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   misc_feature    22092..22112
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Bcep1808_6645"
FT   gene            22752..23018
FT                   /db_xref="GeneID:4947970"
FT                   /locus_tag="Bcep1808_6646"
FT   CDS_pept        22752..23018
FT                   /locus_tag="Bcep1808_6646"
FT                   /gene_family="HOG000023915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   vei:Veis_2756 protein of unknown function DUF156"
FT                   /db_xref="GI:134288176"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:4947970"
FT                   /translation="MTIHASHPDIIKRLKRAEGHLKSVIAMLEEGRPCVEVAQQLQAVE
FT                   SAVGNAKQALVRDHIDHCIDHAIHEGGSADAALTELKAITKYL"
FT                   /protein_id="YP_001110339.1"
FT   misc_feature    22770..23003
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="Bcep1808_6646"
FT   gene            23028..24158
FT                   /db_xref="GeneID:4947971"
FT                   /locus_tag="Bcep1808_6647"
FT   CDS_pept        23028..24158
FT                   /locus_tag="Bcep1808_6647"
FT                   /gene_family="HOG000230055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="high-affinity nickel-transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   rso:RS03927 hypothetical protein"
FT                   /db_xref="GI:134288177"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="GeneID:4947971"
FT                   /translation="MTEFSTLLQQGASNAWLFIPSAILLGALHGLEPGHSKTMMAAFIV
FT                   AIRGTVGQAVLLGLSATISHTAVVWAVALAGMYFGRNWNAETSEPYFQVASAVLIVGVA
FT                   AWMIWRTWRQQRLAHAHDHHDHDHHDHGDEAKLIDTGHGVVRLEVFEDGVPPRFRLYRQ
FT                   GRHSHVWSSDEVRIETERQDGSRQAFTFRMGDGFVESVQEIPEPHEFVARLSLGHGNHS
FT                   HDYDVEFVEHGHHHHAGADQDGLNISDAGYQDAHELAHANDIRRRFANREVTTGQIVMF
FT                   GLTGGLIPCPASITVLLLCLQLKKIALGATLVLCFSIGLALTMVVSGTLAAISLKHVSK
FT                   RWSGFGDFARKAPYFSGALIMLVGLFVGYQGVVALG"
FT                   /protein_id="YP_001110340.1"
FT   misc_feature    23028..>23378
FT                   /note="High-affinity nickel-transport protein; Region:
FT                   NicO; cl00964"
FT                   /db_xref="CDD:174483"
FT                   /locus_tag="Bcep1808_6647"
FT   misc_feature    <23679..24152
FT                   /note="High-affinity nickel-transport protein; Region:
FT                   NicO; cl00964"
FT                   /db_xref="CDD:174483"
FT                   /locus_tag="Bcep1808_6647"
FT   gene            24390..27326
FT                   /db_xref="GeneID:4947972"
FT                   /locus_tag="Bcep1808_6648"
FT   CDS_pept        24390..27326
FT                   /locus_tag="Bcep1808_6648"
FT                   /gene_family="HOG000111179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   rme:Rmet_6212 transposase Tn3"
FT                   /db_xref="GI:134288178"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:4947972"
FT                   /translation="MDHWRLAYLGVRHFPHELTEFELNTFFTFSARERALIDGRRSHLY
FT                   RLAVALHLGFVRMTGRTLDAYKQVPNRLWQHLGEQLGIDSPDLGTLRALYDDRTDTLAD
FT                   HQRLAYDALGFKPMAEHQRRYVVRWLKERLSGRQDRSTALFDLKQWLYEHRVLIVHDRA
FT                   LQQLIVQAVQDVEAALIHRLEVAFGAAALDQWGMLLPRPESGGASLQQWVWSVPLRNST
FT                   NQMGELFRKIERLTKLGVHRDWPVECNEATVRHYARRCANRPPSVSKRIRQPVRQLEAA
FT                   CFMRYALCVATDQLLWMLARWQRKMVNEAGRKVDATRPDLKAQLREFATAVKALATDAT
FT                   LAHDALVARLVQLADTTLAQSGPSRASLVRAQLLTKQRVARAMLAKLLTLPFASQTPHP
FT                   VIDALEVLRTIYVCGERELPADVSVPVGRAWQRTVAGEDRVQALLAFEWATLSALRVAL
FT                   RNGSVFVEHSFAFRSQATLLIPDDTWKAQRNHFYGHLKLSQDPKEYIEPICAHLSEGLE
FT                   RLTQAVSRGEVRVDTAIHLDPASAQRAEPAVEALRRAIFNVHPDGQLPRILLEIDSETR
FT                   FSWLLLGREPRARSELLMVYAAVLAHGTSMSAAEVARMVPELSAGAIRQMMHRVADERV
FT                   LREAADAVLGFMHRHPIAAHWGRADLASSDMMSLETTRTVWQARADPRRRTASIGVYTH
FT                   VRDRWGIFYDQPIVLNERQAGVAIEGAIRQEGTDDVSQLAVDTHGYTDFGMAVARGLGF
FT                   DLCPRLAHLRDRRLHVPVSTSVPEALAAVVDRDVQLEAIEVIWDDFVRLVASIQSGHCT
FT                   AVQALTRFGAAARGLPLYDGGVALGRLFRSIYLIDYFTLPAFRAELQHVLNRGEAVHTV
FT                   QRAIHQGKIPVELTRHRHTLMAVSSSLSLLTNSVLAWNTMHMQQAIERIETLGQTPVLP
FT                   DYLRRIAPTYLEGINLRGTFEFPVADYAHRLMPSLAIGMPMAGREARG"
FT                   /protein_id="YP_001110341.1"
FT   misc_feature    24477..27239
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Bcep1808_6648"
FT   misc_feature    26226..27170
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Bcep1808_6648"
FT   gene            27393..27851
FT                   /db_xref="GeneID:4947973"
FT                   /locus_tag="Bcep1808_6649"
FT   CDS_pept        27393..27851
FT                   /locus_tag="Bcep1808_6649"
FT                   /gene_family="HOG000222565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bma:BMAA1052 hypothetical protein"
FT                   /db_xref="GI:134288179"
FT                   /db_xref="GeneID:4947973"
FT                   /translation="MSRKSARRSGHRPLSKEMLLPLPLARTRALSLEHHLALATIAKGH
FT                   ANVDLMVCLLKAVYTAFYLRKETPATGDDAEFQRAEAALARCIARAERGETWVMLDRDK
FT                   VVIERILVLHDEQLASIPTHCYLTALDKLNRFAVEGLQSPIPPLATEP"
FT                   /protein_id="YP_001110342.1"
FT   gene            complement(27848..29329)
FT                   /db_xref="GeneID:4947974"
FT                   /locus_tag="Bcep1808_6650"
FT   CDS_pept        complement(27848..29329)
FT                   /locus_tag="Bcep1808_6650"
FT                   /gene_family="HOG000262915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   rme:Rmet_5988 phage integrase-like SAM-like"
FT                   /db_xref="GI:134288180"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:4947974"
FT                   /translation="MNFADWIDTGATPPQRLPNGLDAAIAYVSDVLGQVVYLRWTLTLV
FT                   KRRFPSLADAKVAKPAVMRLLLDQSTAVEYWDRGRARVVSVDDAPASEAVLTRVLHAHG
FT                   RRFKFGEVALLAITSGEWFRESAPLVGGVPLALRPWFARAGRFAAVASATNTLGVGDDA
FT                   QATALFLRDRASRSPHTARAYLTEIRRLAAWCIAHELGPLSDLTRHDLLEYKRMLHRPS
FT                   QDVADDAQPEGRLSEATQARALAVVASLFQYWTETGYLTANPAAGLVRGQRRHAGFAPT
FT                   RMLSAAQLGACDAEVDAVDRDVEPLIAARRRAIWSLYRFAGVRLVELAWSDARQLPVLD
FT                   VDSNGCWTLHVCGKGQKPRAIPLPAGCVSRLQTYRRLRGLPEQPEPSEHVALVHGLKGG
FT                   TLQSSGLYDEVKAIFRAAAARLDPTDPPSAATLRRASPHWLRHAYARTLVVDRQVPLPA
FT                   AQALLGHASIQTTAGYAKTDLSQLRAFVDRAFDTD"
FT                   /protein_id="YP_001110343.1"
FT   misc_feature    complement(27860..28825)
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Bcep1808_6650"
FT   misc_feature    complement(28571..28825)
FT                   /note="Phage integrase, N-terminal SAM-like domain; Region:
FT                   Phage_integr_N; cl12235"
FT                   /db_xref="CDD:176623"
FT                   /locus_tag="Bcep1808_6650"
FT   misc_feature    complement(27905..28417)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Bcep1808_6650"
FT   misc_feature    complement(order(27908..27910,28016..28024,28268..28270,
FT                   28355..28360))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_6650"
FT   misc_feature    complement(order(27908..27910,27935..27937,28007..28009,
FT                   28016..28018,28268..28270,28358..28360))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_6650"
FT   misc_feature    complement(order(27908..27910,27935..27937,28007..28009,
FT                   28016..28018,28358..28360))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Bcep1808_6650"
FT   gene            complement(29364..30311)
FT                   /db_xref="GeneID:4947975"
FT                   /locus_tag="Bcep1808_6651"
FT   CDS_pept        complement(29364..30311)
FT                   /locus_tag="Bcep1808_6651"
FT                   /gene_family="HOG000262914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_6192 hypothetical protein"
FT                   /db_xref="GI:134288181"
FT                   /db_xref="GeneID:4947975"
FT                   /translation="MSRPAAVTADQIRTAVLAMLAEAGDAAPASGTRFRQIVSVRKLRA
FT                   RLGAGDPATLARALNAIEAEVVRAGLTEVAIPDLPPDIADLMRALWQTAVAVQLDDVVR
FT                   LKQAADANVVAAEAARTDAELRVELLRQEVQTLRTTLVTRDAELADLRAQHGVQRDRCA
FT                   SLEAQADERQVALDALTTEQASRDHAHTTALEAAQHRYEALSKQLLQETAHQREALKKE
FT                   HTHAVTQLKFAERRIAALEGERDRLDSEVVREREARQQAVGEALALKAVNAQQHAQLGD
FT                   LLRDIAPKPAQTARAGLATAKRATGSASTKRKGK"
FT                   /protein_id="YP_001110344.1"
FT   misc_feature    complement(<29451..>29936)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="Bcep1808_6651"
FT   gene            30395..30661
FT                   /db_xref="GeneID:4947976"
FT                   /locus_tag="Bcep1808_6652"
FT   CDS_pept        30395..30661
FT                   /locus_tag="Bcep1808_6652"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134288182"
FT                   /db_xref="GeneID:4947976"
FT                   /translation="MIQDNFHYRCYADPTAPANACLRPPGLGEEVLRRSRKTSQEAADF
FT                   IDYYFGGGALTLVAARWTYTGKLHENQGDPISGVSFSKPQSGD"
FT                   /protein_id="YP_001110345.1"
FT   gene            complement(30818..31723)
FT                   /db_xref="GeneID:4947977"
FT                   /locus_tag="Bcep1808_6653"