(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_6

ID   BURVG_6; SV 1; empty ; DNA; empty ; PRO; 1241007 BP.
XX
AC   NC_009254;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 chromosome 3, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-1241007
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of Chromosome3 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-1241007
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1241007
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000616.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1241007
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /chromosome="3"
FT                   /db_xref="taxon:269482"
FT   gene            199..1908
FT                   /db_xref="GeneID:4949525"
FT                   /locus_tag="Bcep1808_5455"
FT   CDS_pept        199..1908
FT                   /locus_tag="Bcep1808_5455"
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="in some organisms the DhaK and DhaL subunits are
FT                   encoded by separate genes; in others they are fused;
FT                   functions along with DhaM to phosphorylate
FT                   dihydroxyacetone"
FT                   /db_xref="GI:134290885"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="GeneID:4949525"
FT                   /translation="MKKLVNLPSDVVSEMLEGIARQSPHVAILGDEHVLVRQPLPEPSR
FT                   RPVAVLSGGGSGHEPAHGGYVGEGMLSAAVCGEVFTSPSTDAVLAAIRASAGPNGALLV
FT                   VKNYTGDRLNFGLAAELARAEGIPVEMVIVADDVSLRGVVERGQRRGIAGTVLIHKLAG
FT                   AAAARGLPLARVAAVAREAAAEIGTMGVALDGCTIPGADKSGFSLADHEIELGLGIHGE
FT                   KGVERTAPLPADALVETLLSRIVADLVLDRGERVALLVNGLGATPDMELAIVLRAAYDN
FT                   LTRRGITVARAWAGTFLSALNMPGCSISLLRLNDERAALLDAPTQARAWPGGGAVNPHV
FT                   RIDAPVANEPPPQPLDAAASAWAARLQPALRAVAQALLDHEATLTELDTAAGDGDLGAS
FT                   MHRAAQAILALPDTAYGAPAATLAALGAALRRAIAGSSGPFYASALLRASRRLADASDP
FT                   IAPSARDWAAALRGAADAISELGGARAGDRTMLDALVPAANAFGRALDHDHDVASAWAA
FT                   AVQAAEHGARQTADMPPRAGRASYLGARALGTPDGGAVAVTYWLRALLPHVR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001114654.1"
FT   misc_feature    199..1905
FT                   /note="dihydroxyacetone kinase; Provisional; Region:
FT                   PRK14479"
FT                   /db_xref="CDD:172954"
FT                   /locus_tag="Bcep1808_5455"
FT   misc_feature    199..1188
FT                   /note="dihydroxyacetone kinase subunit DhaK; Provisional;
FT                   Region: PRK14481; cl10557"
FT                   /db_xref="CDD:175227"
FT                   /locus_tag="Bcep1808_5455"
FT   misc_feature    1366..1893
FT                   /note="DAK2 domain; Region: Dak2; cl03685"
FT                   /db_xref="CDD:174797"
FT                   /locus_tag="Bcep1808_5455"
FT   gene            2325..3710
FT                   /db_xref="GeneID:4948355"
FT                   /locus_tag="Bcep1808_5456"
FT   CDS_pept        2325..3710
FT                   /locus_tag="Bcep1808_5456"
FT                   /gene_family="HOG000141611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="general substrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bam:Bamb_6031 general
FT                   substrate transporter"
FT                   /db_xref="GI:134290886"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4948355"
FT                   /translation="MRYVPSMTSVSAAASVADDAASRGDEPHCLPRVAIAAAALGNATE
FT                   WFDYGIYAYGLEYISAALFPGSTASATLFALGTFAISFLIRPLGGLFWGPLGDRLGRKR
FT                   VLALTVLTMSGATLLVGVLPTYASAGWLAPAALIVLRMVQGFSTGGEYGGAATFIAEYA
FT                   PDARRGLCGSFLEFATLAGFSLGALLMLGFALLLGDTAMHAWGWRLPFLVAAPLGLIGF
FT                   YLRSRLEETPVFRELEEQAQRREQSAAAAALPLGRLLVRYARPLLLLGGLVVALNVVNY
FT                   VLLAYMPTYMHKELGVSENLSLLIPLLGMLAMMVLLPFAGWLSDRVGRKTMWWISLVGL
FT                   FVAAVPMFALMTHGVLGAFVGFAVLGLLYVPQLATISAMFPAMFPTHVRYAGMAIAYNV
FT                   STSLFGGTAPIVNDWLIGKTGNTMIPAYYMMAACAVGLVALSAVIETRGCSLRGDAVPG
FT                   QAR"
FT                   /protein_id="YP_001114655.1"
FT   sig_peptide     2325..2378
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.696 at
FT                   residue 18"
FT                   /locus_tag="Bcep1808_5456"
FT                   /product="hypothetical protein"
FT   misc_feature    2427..>3008
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep1808_5456"
FT   misc_feature    2445..3635
FT                   /note="metabolite-proton symporter; Region: 2A0106;
FT                   TIGR00883"
FT                   /db_xref="CDD:162087"
FT                   /locus_tag="Bcep1808_5456"
FT   misc_feature    order(2469..2471,2478..2486,2490..2495,2544..2546,
FT                   2568..2573,2580..2582,2592..2597,2601..2606,2766..2771,
FT                   2778..2783,2790..2795,2802..2804,2838..2843,2850..2855,
FT                   2871..2873)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep1808_5456"
FT   misc_feature    3255..3662
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cl11420"
FT                   /db_xref="CDD:176432"
FT                   /locus_tag="Bcep1808_5456"
FT   gene            complement(4039..5739)
FT                   /db_xref="GeneID:4948356"
FT                   /locus_tag="Bcep1808_5457"
FT   CDS_pept        complement(4039..5739)
FT                   /locus_tag="Bcep1808_5457"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bte:BTH_II0449 methyl-accepting chemotaxis protein"
FT                   /db_xref="GI:134290887"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="GeneID:4948356"
FT                   /translation="MREMKVSSRLMLGFGLLTILLVTVAATAFYGMWQLHGQLDTIARV
FT                   NNTEAKLANRLRATIQDRAIAVRNLALLTDQQEMAQEAERIKKQDDIYADAYQKLARMF
FT                   ADEPATTERERTLVAALKQDEAAAQPALRKAAQLGLSNDPAAATKELMENARPPQRVWL
FT                   ARATELANFEDEMNEQAKQDAAATYASVRALVAAIVGGSLLVAVATTIVIARSILRQLG
FT                   GEPSVAQHAAAQIADGNLMIDLPVAHGDSSSLMSSLDAMRARLTTIVQGIKVSAESISL
FT                   AAAEVAQGNVDLSQRTEEQAASLEETAASMEQLTSTVRQNTENARQGSTLAAAASQTAA
FT                   SGGTVVKQVVGTMEDIASSSQKVAEIISVIEGIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRTLAQRSAVAAKEIKELIETSVTHVAAGSALVSNAGTTMDEIVRSVRRVTDIM
FT                   GEIASASSEQSTGIEQVNVAVTQMDEVTQQNAALVEQATAAAQSMADQADSLKAAVAIF
FT                   KVESRSQPAAAPVAAAARTPARGAKRPVRETGKVGNAPARVAGADWATF"
FT                   /protein_id="YP_001114656.1"
FT   sig_peptide     complement(5653..5739)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.464 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_5457"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(4279..5199)
FT                   /note="Methyl-accepting chemotaxis protein [Cell motility
FT                   and secretion / Signal transduction mechanisms]; Region:
FT                   Tar; COG0840"
FT                   /db_xref="CDD:31182"
FT                   /locus_tag="Bcep1808_5457"
FT   misc_feature    complement(4180..4707)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Bcep1808_5457"
FT   gene            complement(5980..7374)
FT                   /db_xref="GeneID:4948357"
FT                   /locus_tag="Bcep1808_5458"
FT   CDS_pept        complement(5980..7374)
FT                   /locus_tag="Bcep1808_5458"
FT                   /gene_family="HOG000020207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bam:Bamb_6024 aminotransferase class-III"
FT                   /db_xref="GI:134290888"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:4948357"
FT                   /translation="MKQSIDALLRADRAHFMHPSTHAYDHESGALPGRIVRGAHGIHIE
FT                   DHEGRRYIDAFAGLYCVNIGYGRTEVADAMHEQAKQLAYYHTYVGHASDAIIELSSRII
FT                   ECAPVGMKKVYYGMSGSDANETQVKLVWYYNNVLGRPNKKKIISRERGYHGSGIVTGSL
FT                   TGLPSFHQHFDLPIDRVKHTVCPHWYRNAPVGMSEAQFVAYCVDELEKLIAREGADTIA
FT                   AFIAEPVMGTGGIIAPPAGYWPAIQAVLRQHDILLISDEVVCGFGRLGSKMGAQHFGIE
FT                   PDLITVAKGLTSAYAPLSGVIVGDKVWDVIARGSQAHGPMGHGWTYSGHPVCAAAALAN
FT                   LAILERENLVGNAAEVGAYFGAKLRDAFGAHPLVGEVRSVGMLAALEFMADRDARTPFD
FT                   PALKIGAQVSAAALRRGVIARAMPHGDILGFAPPLVMTRAEADEIVGIVKEAVDEVAER
FT                   NLAAVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001114657.1"
FT   misc_feature    complement(5992..7374)
FT                   /note="hypothetical protein; Provisional; Region: PRK07482"
FT                   /db_xref="CDD:168968"
FT                   /locus_tag="Bcep1808_5458"
FT   misc_feature    complement(6019..7353)
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_5458"
FT   misc_feature    complement(order(6508..6510,6586..6591,6595..6597,
FT                   6694..6696,6907..6909,6913..6918,7012..7020))
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_5458"
FT   misc_feature    complement(order(6508..6510,6586..6588,6595..6597,
FT                   6694..6696,6913..6918,7012..7017))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_5458"
FT   misc_feature    complement(6508..6510)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_5458"
FT   gene            complement(7406..8884)
FT                   /db_xref="GeneID:4948358"
FT                   /locus_tag="Bcep1808_5459"
FT   CDS_pept        complement(7406..8884)
FT                   /locus_tag="Bcep1808_5459"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bam:Bamb_6023
FT                   succinate-semialdehyde dehydrogenase (NAD(P)(+))"
FT                   /db_xref="GI:134290889"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="GeneID:4948358"
FT                   /translation="MLPGHPVLFKSMCYVDGRWIHSDSAATRAVVNPADQSVIGHVPML
FT                   ERAQIVGAVDAAQRAFGTWRWTPQAARSAALLRWHALILRHLDDLAALLSLEQGKPLAE
FT                   ARGEIRYAASFVEWFANEAKRAVGRTIPTHIDGAHLGTVMEPVGVAALITPWNFPAAMI
FT                   TRKAAAALAVGCTVIVKPAHETPFSALALAQLADEAGFPAGVFNVVLGEPQMAMEALVG
FT                   DARVRAVSFTGSTRVGRLVTETAAKAGIRKIALELGGNAPFIVTDDADLDDAVRIAVGA
FT                   KFQTSGQDCCAANRIFVARALYDAFVGRYASAVRALKTGPAFEPGVDVGPLMHQAAFDA
FT                   TVARVDDARARGARIVAGGRPHALGGWFYEPTVIADAAPGMRVYDEENFAPISAVCAFD
FT                   TLDEVVARANDTEYGLAAYVCATRIDTIFRLVRRLDFAMVSVNGVKFTGAPIPFGGMKA
FT                   SGLGREGGVEGFEPFTETKYFCFGNLGLPVAATA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001114658.1"
FT   misc_feature    complement(7442..8797)
FT                   /note="Mitochondrial succinate-semialdehyde dehydrogenase
FT                   and ALDH family members 5A1 and 5F1-like; Region:
FT                   ALDH_F5_SSADH_GabD; cd07103"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcep1808_5459"
FT   misc_feature    complement(order(7442..7462,7496..7498,7511..7513,
FT                   7529..7534,7541..7543,7559..7579,7583..7585,7592..7594,
FT                   7598..7600,7610..7615,7619..7621,7823..7825,7961..7963,
FT                   7973..7975,8147..8149,8156..8158,8168..8170,8204..8206,
FT                   8450..8452,8465..8473,8489..8515,8519..8524,8531..8533,
FT                   8654..8656,8681..8683))
FT                   /note="tetramerization interface; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcep1808_5459"
FT   misc_feature    complement(order(7526..7528,7640..7642,7718..7720,
FT                   7724..7726,8015..8017,8111..8119,8162..8167,8174..8176,
FT                   8183..8194,8336..8341,8345..8347,8390..8392,8414..8428))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcep1808_5459"
FT   misc_feature    complement(order(8015..8017,8024..8026,8117..8119,
FT                   8414..8416))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143421"
FT                   /locus_tag="Bcep1808_5459"
FT   gene            complement(9008..9478)
FT                   /db_xref="GeneID:4948359"
FT                   /locus_tag="Bcep1808_5460"
FT   CDS_pept        complement(9008..9478)
FT                   /locus_tag="Bcep1808_5460"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bam:Bamb_6022 transcriptional regulator, AsnC family"
FT                   /db_xref="GI:134290890"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:4948359"
FT                   /translation="MIKLDRYDLAILRILERDGRITKSRLAEAVNLSISPAWERVRKLE
FT                   ESGVIRGYRADVDWVGTFSGSRIVVEVTLSRHTAPDMRRFEARVSAAPEVAQCYATGGG
FT                   VDYVLHVVARDIDHYQRFIDALLMDDLGIERYFTYIVTKVVKCDAGGAPDWH"
FT                   /protein_id="YP_001114659.1"
FT   misc_feature    complement(9041..9478)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Bcep1808_5460"
FT   misc_feature    complement(9140..9469)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep1808_5460"
FT   gene            complement(9492..10529)
FT                   /db_xref="GeneID:4948360"
FT                   /locus_tag="Bcep1808_5461"
FT   CDS_pept        complement(9492..10529)
FT                   /locus_tag="Bcep1808_5461"
FT                   /gene_family="HOG000190472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bam:Bamb_6021
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="GI:134290891"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="GeneID:4948360"
FT                   /translation="MRASPITPTVDFDADGVQHGFLKLPYSRDDSAWGAIMIPIAVVKR
FT                   GDGPTVLLTGGNHGDEYEGPVALSKLAGSLKAADVTGRVIVVPFMNYPAFRAGRRTSPI
FT                   DAGNLNRSFPGRPDGTVTEKIADYFQRHLLPLATHVLDIHAGGRTLDFVPFAAMHVLEN
FT                   REQEARCERAMRAFGAPYSMRMLELDSVGLFDTAAEAAGKVFVSTELGGGGTSTAASVA
FT                   IAERGVRGFLEHAGVLAKRDDASAAVRAAPRTTTLLDMPDGSCFTTSEHRGLLEMCRDL
FT                   GSEVEAGDVLARVHDIDRTGVAPVEYVARRRGLLAARHFPGLVQAGDTIAVVADIVERN
FT                   VPVGV"
FT                   /protein_id="YP_001114660.1"
FT   misc_feature    complement(9528..10526)
FT                   /note="ectoine utilization protein EutE; Region:
FT                   ectoine_eutE; TIGR02994"
FT                   /db_xref="CDD:132039"
FT                   /locus_tag="Bcep1808_5461"
FT   misc_feature    complement(9528..10487)
FT                   /note="A functionally uncharacterized subgroup of the
FT                   Succinylglutamate desuccinylase (ASTE)/aspartoacylase
FT                   (ASPA) subfamily which is part of the M14 family of
FT                   metallocarboxypeptidases. ASTE catalyzes the fifth and last
FT                   step in arginine catabolism by the...; Region:
FT                   M14_ASTE_ASPA_like_2; cd06252"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="Bcep1808_5461"
FT   misc_feature    complement(order(9903..9905,9945..9947,9957..9959,
FT                   10059..10061,10098..10100,10197..10202,10230..10232,
FT                   10347..10349,10356..10358))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="Bcep1808_5461"
FT   misc_feature    complement(order(10098..10100,10347..10349,10356..10358))
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133109"
FT                   /locus_tag="Bcep1808_5461"
FT   gene            complement(10534..11742)
FT                   /db_xref="GeneID:4948361"
FT                   /locus_tag="Bcep1808_5462"
FT   CDS_pept        complement(10534..11742)
FT                   /locus_tag="Bcep1808_5462"
FT                   /gene_family="HOG000243787" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="creatinase"
FT                   /transl_table="11"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: bam:Bamb_6020
FT                   peptidase M24"
FT                   /db_xref="GI:134290892"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="GeneID:4948361"
FT                   /translation="MSAVIDTYEAAPRLAFERSEYAARIAKTRTAMQRAGIDLLIVTDP
FT                   TNMAWLTGYDGWSFYVHQCVLLPMEGEPVWYGRAQDANGAKRTAFMTHENIVGYPDHYV
FT                   QSQDRHPMDYLASVVIAARGWSTLRIGVELDNYYFSAAAHASLQKHLPTARWVDATALV
FT                   NWQRAVKSPREIEYMRIAARIVERVHAHIVDTIEPGMKKSDLVAQIYATGIAGADGHGG
FT                   DYPAIVPLLPTGADAAAPHLTWDDSRFARGAGTFFEIAGCYRRYHCPLSRTVYLGKPPA
FT                   HFIEGERAVIEGIEAGLAAAKPGNVCEDIANAFFAVLRRAGIEKDSRCGYPIGASYPPD
FT                   WGERTMSLRPGDRTVLEPGMTFHFMPGLWLDDWGLEITESILITDTGVETFCRTPRKLF
FT                   VKE"
FT                   /protein_id="YP_001114661.1"
FT   misc_feature    complement(10537..11709)
FT                   /note="ectoine utilization protein EutD; Region:
FT                   ectoine_eutD; TIGR02993"
FT                   /db_xref="CDD:132038"
FT                   /locus_tag="Bcep1808_5462"
FT   misc_feature    complement(11236..11673)
FT                   /note="Creatinase/Prolidase N-terminal domain; Region:
FT                   Creatinase_N; pfam01321"
FT                   /db_xref="CDD:144790"
FT                   /locus_tag="Bcep1808_5462"
FT   misc_feature    complement(10582..11220)
FT                   /note="A family including aminopeptidase P, aminopeptidase
FT                   M, and prolidase. Also known as metallopeptidase family
FT                   M24. This family of enzymes is able to cleave amido-,
FT                   imido- and amidino-containing bonds. Members exibit
FT                   relatively narrow substrate...; Region: APP_MetAP; cd01066"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="Bcep1808_5462"
FT   misc_feature    complement(order(10609..10611,10648..10650,10750..10752,
FT                   10936..10938,10969..10971,11020..11022))
FT                   /note="active site"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="Bcep1808_5462"
FT   gene            complement(11753..12757)
FT                   /db_xref="GeneID:4948362"
FT                   /locus_tag="Bcep1808_5463"
FT   CDS_pept        complement(11753..12757)
FT                   /locus_tag="Bcep1808_5463"
FT                   /gene_family="HOG000137263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ectoine utilization protein EutC"
FT                   /EC_number="4.3.1.12"
FT                   /note="putative cyclodeaminase"
FT                   /db_xref="GI:134290893"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="GeneID:4948362"
FT                   /translation="MIPPVTLLDRAQLRTLVPLDVAAIDQIEAAFASLATEAVAMPPIL
FT                   NLALPERHGEVDVKTAYLPRFDSFAIKVSPGFFDNPSLGLPSLNGLMLVLSARTGLTEA
FT                   VLLDNGYLTAVRTAAAGAVAARRLARADARRAAIVGAGEQARLQLDALMLVRDITHVTV
FT                   WARDAERAVRFADDARAAHGIDATVARSVHAALADADIAVTTTPSREPLVHAADLHAGL
FT                   HVTAMGSDAHYKTELAPSVFGAARYFCDRLQQTRVAGELAHAIAAGAVAADAVFPELGE
FT                   VIAGRREGRTQRDDITICDLTGTGAQDTAIAVLALQRARAARAGTIFHNDLTT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001114662.1"
FT   misc_feature    complement(11768..12754)
FT                   /note="ectoine utilization protein EutC; Validated; Region:
FT                   PRK08291"
FT                   /db_xref="CDD:169347"
FT                   /locus_tag="Bcep1808_5463"
FT   misc_feature    complement(11834..12739)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcep1808_5463"
FT   gene            complement(12759..13730)
FT                   /db_xref="GeneID:4948363"
FT                   /locus_tag="Bcep1808_5464"