(data stored in ACNUC7421 zone)

HOGENOMDNA: BURVG_7

ID   BURVG_7; SV 1; empty ; DNA; empty ; PRO; 2411759 BP.
XX
AC   NC_009255;
XX
PR   Project: 58075;
XX
DE   Burkholderia vietnamiensis G4 chromosome 2, complete sequence.
XX
OS   Burkholderia vietnamiensis G4
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2411759
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Complete sequence of Chromosome2 of Burkholderia vietnamiensis G4";
RL   Unpublished
XX
RN   [2]
RP   1-2411759
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2411759
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Tiedje,J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (15-MAR-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000615.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436384
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2411759
FT                   /strain="G4"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia vietnamiensis G4"
FT                   /chromosome="2"
FT                   /db_xref="taxon:269482"
FT   gene            complement(192..446)
FT                   /db_xref="GeneID:4951673"
FT                   /locus_tag="Bcep1808_3314"
FT   CDS_pept        complement(192..446)
FT                   /locus_tag="Bcep1808_3314"
FT                   /gene_family="HOG000216810" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0760 hypothetical protein"
FT                   /db_xref="GI:134292032"
FT                   /db_xref="GeneID:4951673"
FT                   /translation="MTTDNRPDDRDEHKLENLEAAVDHLHKSIESQSIAAGAAKGILFS
FT                   LIETLGALIGDPDLPEHARSGYEALRDKASELRSGLDRH"
FT                   /protein_id="YP_001115768.1"
FT   gene            complement(545..2770)
FT                   /db_xref="GeneID:4949526"
FT                   /locus_tag="Bcep1808_3315"
FT   CDS_pept        complement(545..2770)
FT                   /locus_tag="Bcep1808_3315"
FT                   /gene_family="HOG000216835" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /transl_table="11"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG:
FT                   bur:Bcep18194_B0759 amylo-alpha-1,6-glucosidase"
FT                   /db_xref="GI:134292033"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="GeneID:4949526"
FT                   /translation="MPNHAEATTTQAPQVAPVSPARASGPAFIAPEADPQALARNNQYV
FT                   LKSGDAFVVSDALGDIGGRDDGLFVDDMRVLSAWRLTFGGRAPSLLSGATSADNASFTA
FT                   HLTNRPLPPLGGHETPEGVIHIERTRVLAGDVLYEALTLTNYGASEAEVPLSLSFAADF
FT                   KDMFEVRGTQRPKRGTVAAPRVADGAVRLRYDGLDGVERNVTVHFSPAPDALSVDRADY
FT                   TLTIAAQACLSIYLTVDATLGPAHDGEGPGCGRVALRTALVGVHREMRSRRESMARVNT
FT                   GNPLFDAWLDRSLADLGLLTTQLDTGPYPYAGIPWFSTPFGRDAVITSLQMLWLQPSLA
FT                   RGVLRFLAEHQARETSAFRDAEPGKIMHEFRRSEMAATGEVPFALYYGGVDTTPLFIVL
FT                   AGAYVEHTGDDALIDELWPALERAAQWVIDKCDRNPYGLLDYQRTSERGLANQGWKDSH
FT                   DSVFHADGRFPDGPIALVEVQAYACAALDAMATCSHRRGHAADAARYALRAKTLREQVE
FT                   ALFWMPDGDFYGIALDGHGELCRVLASNAGHLLAFGLPDAERGAAVAGVLGSTLFQTGW
FT                   GIRTLAAGQPRFNPMAYHNGSVWPHDNALIARGLARYGDKAAAVSLLRALFEAAVSFEM
FT                   RLPELFCGFPRRRGEPPTAYPVACLPQAWAAGAPFMMLQACLGVSVDASRLEVRVERPA
FT                   LPEGVDWLRIDELRVGDETVSLMFRRVDGQVVAAAERSGRVKVVAVL"
FT                   /protein_id="YP_001115769.1"
FT   misc_feature    complement(623..2572)
FT                   /note="Glycogen debranching enzyme [Carbohydrate transport
FT                   and metabolism]; Region: GDB1; COG3408"
FT                   /db_xref="CDD:33214"
FT                   /locus_tag="Bcep1808_3315"
FT   misc_feature    complement(770..1837)
FT                   /note="Bacterial alpha-L-rhamnosidase; Region:
FT                   Bac_rhamnosid; cl01801"
FT                   /db_xref="CDD:174672"
FT                   /locus_tag="Bcep1808_3315"
FT   gene            complement(2910..3944)
FT                   /db_xref="GeneID:4949527"
FT                   /locus_tag="Bcep1808_3316"
FT   CDS_pept        complement(2910..3944)
FT                   /locus_tag="Bcep1808_3316"
FT                   /gene_family="HOG000019757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: bam:Bamb_4366 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="GI:134292034"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="GeneID:4949527"
FT                   /translation="MSTPLFGKLFAQPVAIDPGTASTRIYTHERGVVLNQPSVVCFRKA
FT                   GMSDARPTLEAVGERAKALLGREPGHLQAVRPMRHGVIADAHAAEQMIRRFIDMSHTRS
FT                   RFRRRVEVTLCVPSDATAVERRAVREAAFAAGVSDVALIEEALAAGLGAGLPVTEPVGS
FT                   MVVDIGAGTTEVAVIALGGVVYREAIRVGGNQFDAAIINYVRNVYGVLLGEQTAERVKQ
FT                   TIGSATSAVPRTSTRAIGRGIGDGLPRSIELSNHDVADALAAPLKQVIGAVKSVLENAP
FT                   AELVTDIAHRGVVLTGGGALLADLERLLRDETGLVARVADEPATCAVRGAGEAMGRLAM
FT                   CPVD"
FT                   /protein_id="YP_001115770.1"
FT   misc_feature    complement(2931..3938)
FT                   /note="rod shape-determining protein MreB; Provisional;
FT                   Region: PRK13930"
FT                   /db_xref="CDD:172443"
FT                   /locus_tag="Bcep1808_3316"
FT   misc_feature    complement(<3084..3452)
FT                   /note="Cell division protein FtsA; Region: FtsA; cl11496"
FT                   /db_xref="CDD:159497"
FT                   /locus_tag="Bcep1808_3316"
FT   gene            4215..6668
FT                   /db_xref="GeneID:4949528"
FT                   /locus_tag="Bcep1808_3317"
FT   CDS_pept        4215..6668
FT                   /locus_tag="Bcep1808_3317"
FT                   /gene_family="HOG000216868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="patatin"
FT                   /transl_table="11"
FT                   /note="PFAM: Patatin; surface antigen variable number
FT                   repeat protein; KEGG: bam:Bamb_4367 patatin"
FT                   /db_xref="GI:134292035"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="GeneID:4949528"
FT                   /translation="MTAPASLHWLAARRLGATLVALWCCAAAAQPVPAADPATRAAQAG
FT                   AGTAGAASAAAVASATIAPAAVAAAAAPAPTPSCTADGGPAGRPPVGLVLSGGGARGYA
FT                   HLGVLKVLEDNRIPIDCIAATSMGAVVGGLYASGMAADEMRKRLSEVNLTDIAFDVTDR
FT                   ADLPQSSREDERLYINSLTLGFGKKGVKAPVGLVQGNRLQALLADWTAAVPTNQPFDRL
FT                   PIPYRAVATDLQTGQMVVLDRGSLPLAIRASMAMPGLFAPAEINGRALVDGGLVSNLPV
FT                   DTARQMGAKVVIAVDIGSQLRPLDALASPADVMQQMVGILIRQNVTSQRKQLAAQDVLL
FT                   TPDLGSLAFTDFQNAKQAIAAGAAAATAALPRLRHLALTPEQYAAYRSAHAQPLPPPIR
FT                   ITRIEIKTTGGVPKRVVSDALHVKPGDIYDPATVSQDLLRLTTDGNFESVTQQIVSHGD
FT                   DNVLEIDAREKYWGPNFLLFGVGMSSSSTDEGGFRLHVGYRRPWLTESGLEFRADATIG
FT                   SDLQSARVELRQPLPAAYGFYISPYAEYQRRYVNVYDNTGEVKLNQYLMQTARAGLDFG
FT                   LPIARLGDFRMGIGYATGHGSPNYNLPLPFEENGSTLMWPSFTSQALTARARLVIDQLD
FT                   DPMFPRRGYYTELRIERSLWSHNSQSAEDLADTSNKPYTELYGKAMIAQQYGRHSVSAT
FT                   LEGGKSIGGTNLINAFNFTLGGFQHLAAYAADQLTGNELAYGNVTYMNQLMTFNASPIK
FT                   ALSVGASAELGNVWTSGVKVGGSTLKQSYTFFTSLTTAFGPLYMGVALAPGGRRNIYLQ
FT                   LGRTY"
FT                   /protein_id="YP_001115771.1"
FT   sig_peptide     4215..4304
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.944 at
FT                   residue 30"
FT                   /locus_tag="Bcep1808_3317"
FT                   /product="hypothetical protein"
FT   misc_feature    4485..5105
FT                   /note="Patatin-like phospholipase domain containing protein
FT                   6, protein 7, and fungal NTE1; Region:
FT                   Pat_PNPLA6_PNPLA7_NTE1_like; cd07205"
FT                   /db_xref="CDD:132844"
FT                   /locus_tag="Bcep1808_3317"
FT   misc_feature    order(4506..4511,4515..4517,4590..4592,5028..5030)
FT                   /note="active site"
FT                   /db_xref="CDD:132844"
FT                   /locus_tag="Bcep1808_3317"
FT   misc_feature    4584..4598
FT                   /note="nucleophile elbow; other site"
FT                   /db_xref="CDD:132844"
FT                   /locus_tag="Bcep1808_3317"
FT   misc_feature    5406..5621
FT                   /note="Surface antigen variable number repeat; Region:
FT                   Surf_Ag_VNR; cl10520"
FT                   /db_xref="CDD:158899"
FT                   /locus_tag="Bcep1808_3317"
FT   misc_feature    5718..6599
FT                   /note="Surface antigen; Region: Bac_surface_Ag; cl03097"
FT                   /db_xref="CDD:155280"
FT                   /locus_tag="Bcep1808_3317"
FT   gene            complement(6681..7811)
FT                   /db_xref="GeneID:4949529"
FT                   /locus_tag="Bcep1808_3318"
FT   CDS_pept        complement(6681..7811)
FT                   /locus_tag="Bcep1808_3318"
FT                   /gene_family="HOG000216869" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bam:Bamb_4368
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="GI:134292036"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4949529"
FT                   /translation="MIRRNPSHPDAAPLSPLRYAKWRWLHFRRAWTDTRADRIPSWSRL
FT                   YVRTYLHLLGLVLLTALVPGLALCVVLSPQVVWHAFDALPGDIWIVLAFMLAAPALAAY
FT                   RWMRPVWSDLVMVRERAIDFTGGRFNTRARESHSVIIGPLARTLNALAMRMERLIAAQR
FT                   DLTNGISHELRTPLARVRFALEMLREPGSAAEYYGALDSIAQDVTELEELIDMSLTYAR
FT                   LEYSSLQSNLELTAPVAWFEHQISDAQLLYPERAIESRIAIASDLRVKMDRRLMSYAMR
FT                   NLLRNASKYANARIVVGIALEHGNIAIFVEDDGPGVPENDRERIFDAFVRLDRRTGGYG
FT                   LGLAITRQVLHAHNGRIAVVDPVVLGGARFEISWPI"
FT                   /protein_id="YP_001115772.1"
FT   misc_feature    complement(7146..7337)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(order(7161..7163,7173..7175,7182..7184,
FT                   7194..7196,7203..7205,7215..7217,7263..7265,7272..7274,
FT                   7284..7286,7293..7295,7305..7307,7317..7319))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(7299..7301)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(6690..6977)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(order(6702..6704,6708..6713,6729..6731,
FT                   6735..6737,6783..6794,6861..6866,6870..6872,6876..6878,
FT                   6882..6884,6945..6947,6954..6956,6966..6968))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(6954..6956)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3318"
FT   misc_feature    complement(order(6786..6788,6792..6794,6864..6866,
FT                   6870..6872))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3318"
FT   gene            complement(7879..8589)
FT                   /db_xref="GeneID:4949530"
FT                   /locus_tag="Bcep1808_3319"
FT   CDS_pept        complement(7879..8589)
FT                   /locus_tag="Bcep1808_3319"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bam:Bamb_4369 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="GI:134292037"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:4949530"
FT                   /translation="MSFRILLVEDDTRLSTLIAGYLRKNDYEVDTVLHGDAAVPAILST
FT                   RPDLVILDVNLPGKDGFEICREARKQYDGVIIMVTARDEPFDELLGLEFGADDYVHKPV
FT                   EPRILLARIKAQLRRVPARSIEGAAAQPERYTFGQFSIDRTDRSVVLPGGGSPDLTSAE
FT                   FDLLWVLVCRAGEVVSRDDLMLQLRGVEFDGLDRTIDGRISKLRRKLHDDAGNPQRIKT
FT                   IRSKGYQFSKHAWD"
FT                   /protein_id="YP_001115773.1"
FT   misc_feature    complement(7882..8580)
FT                   /note="DNA-binding transcriptional regulator RstA;
FT                   Provisional; Region: PRK10701"
FT                   /db_xref="CDD:170644"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(8239..8574)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(order(8281..8286,8293..8295,8350..8352,
FT                   8407..8409,8431..8433,8560..8565))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(8431..8433)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(order(8407..8415,8419..8424))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(8278..8286)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(7900..8187)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bcep1808_3319"
FT   misc_feature    complement(order(7909..7911,7924..7926,7960..7965,
FT                   7987..7989,7996..7998,8050..8055,8110..8112))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Bcep1808_3319"
FT   gene            8810..9724
FT                   /db_xref="GeneID:4949531"
FT                   /locus_tag="Bcep1808_3320"
FT   CDS_pept        8810..9724
FT                   /locus_tag="Bcep1808_3320"
FT                   /gene_family="HOG000216890" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="catalyzes the formation of glutamate from glutamine"
FT                   /db_xref="GI:134292038"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR007043"
FT                   /db_xref="GeneID:4949531"
FT                   /translation="MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTL
FT                   DGNVYTVGDARERFSIQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESER
FT                   GKPRNPFINAGALVVTDVLCRRFVKAETALVEFVRRLIGATDVDYDSRVALSELQHAER
FT                   NRAMAHFMASFGNMQMPPDTVIDAYCRQCAIEMNCIELAQAALFLANGGVAPVTGERIV
FT                   DASSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDA
FT                   NGNSLAGTLALEWLTTYSGRSIF"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115774.1"
FT   misc_feature    8810..9721
FT                   /note="Glutaminase; Region: Glutaminase; cl00907"
FT                   /db_xref="CDD:174450"
FT                   /locus_tag="Bcep1808_3320"
FT   gene            10144..10440
FT                   /db_xref="GeneID:4949532"
FT                   /locus_tag="Bcep1808_3321"
FT   CDS_pept        10144..10440
FT                   /locus_tag="Bcep1808_3321"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:134292039"
FT                   /db_xref="GeneID:4949532"
FT                   /translation="MLVGNPTPQSANCFSRNNTGADSDCRYGYNRCLDWQESNCGRPRC
FT                   HSGNLLCRLLHIHIIAVIDLRNAQFFLLALLIHECLYYSNGPDVINGLQIKNL"
FT                   /protein_id="YP_001115775.1"
FT   gene            complement(10975..11595)
FT                   /db_xref="GeneID:4949533"
FT                   /locus_tag="Bcep1808_3322"
FT   CDS_pept        complement(10975..11595)
FT                   /locus_tag="Bcep1808_3322"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine exporter protein LysE/YggA"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B2347 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="GI:134292040"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:4949533"
FT                   /translation="MTYVAQLAAVGGVMLLACVSPGPDLIAVTSHALAKRRAGLYATAG
FT                   ISTSHALWAALAIFGLGLILAKLAWLYEVIRIAGAVYLLYLGGKTLAGLRKPMQQTEVD
FT                   AQSAKSDGQAYRRGLLVGLTNPKAAAFFGSLFITVLPAHAPLWVHGATLIIVTAVSLTW
FT                   FGAMAILFSTERVQVGYARIRKPIDAVMGTVLLGLGAKLALDR"
FT                   /protein_id="YP_001115776.1"
FT   misc_feature    complement(10990..11538)
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Bcep1808_3322"
FT   gene            complement(11746..13638)
FT                   /db_xref="GeneID:4949534"
FT                   /locus_tag="Bcep1808_3323"
FT   CDS_pept        complement(11746..13638)
FT                   /locus_tag="Bcep1808_3323"
FT                   /gene_family="HOG000227272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   regulatory protein, MerR; O-methyltransferase domain
FT                   protein; Albicidin resistance; protein of unknown function
FT                   Mtu_121; KEGG: bur:Bcep18194_B2665 transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="GI:134292041"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003455"
FT                   /db_xref="InterPro:IPR008396"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="GeneID:4949534"
FT                   /translation="MRLKIGELANKAGLTVRTLHHYDAIGLLSPSQRTEGGARLYGQDD
FT                   LIRLHRIEALKRFGYSLPDIKASLEGDPARVPLELLQRQIAELNAQALRAQRLGRRLQY
FT                   IVDMVCAGSEIAAADWMNALELMNMYQKHLDDEELDALLASGPETAAPSDPAWAALIEE
FT                   VRVAMQNALPTASDAAQALAWRWIRLVVRMTRNDPDLATKLMLMQLREPRARKIVGITV
FT                   EMLEWIDEAFMHARCALLAKYLSPAQADEVRRRQFASAKHRAWPALVVELRANMAAGVD
FT                   PGAAPVQAIVGRWQQLFRDSFCGDDAVLEARVRDALMREPDLQLGVGLDDSLLAYLNAA
FT                   HLAGRDMSPVDGGPKPSALMVATQRAAHQLLDRPLVLDDPVALPILGAAEAQALRDNLD
FT                   RFREPPSVGMRSSVIVRSRLAEDVWREAVERGIRQYVILGAGLDTSAFRHPDMPGRIFE
FT                   VDLPATQAWKQARLREAGIAVPSSLHFVPVDFESVGLAEGLARAGFDADAPAVFSWLGV
FT                   TMYLDEEAVIDTLRFIAGCAKGSAVLFEYVTPLSGLPTIMRIAMEQFTARLAERGEPWK
FT                   TFFEPAVIAEKLSALGFSQVNAWTPDELNQRYLANRDDGLLIGVTPTRLVLATV"
FT                   /protein_id="YP_001115777.1"
FT   misc_feature    complement(13375..13632)
FT                   /note="Helix-Turn-Helix DNA binding domain of the
FT                   transcription regulators NolA and AlbR; Region:
FT                   HTH_NolA-AlbR; cd04788"
FT                   /db_xref="CDD:133415"
FT                   /locus_tag="Bcep1808_3323"
FT   misc_feature    complement(order(13522..13530,13579..13581,13621..13629))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133415"
FT                   /locus_tag="Bcep1808_3323"
FT   misc_feature    complement(order(13384..13386,13396..13398,13435..13437,
FT                   13462..13467,13477..13479,13486..13488))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:133415"
FT                   /locus_tag="Bcep1808_3323"
FT   misc_feature    complement(12937..>13203)
FT                   /note="TipAS antibiotic-recognition domain; Region: TipAS;
FT                   pfam07739"
FT                   /db_xref="CDD:149030"
FT                   /locus_tag="Bcep1808_3323"
FT   misc_feature    complement(12610..12951)
FT                   /note="TipAS antibiotic-recognition domain; Region: TipAS;
FT                   pfam07739"
FT                   /db_xref="CDD:149030"
FT                   /locus_tag="Bcep1808_3323"
FT   misc_feature    complement(11815..12567)
FT                   /note="Leucine carboxyl methyltransferase; Region: LCM;
FT                   cl01306"
FT                   /db_xref="CDD:163969"
FT                   /locus_tag="Bcep1808_3323"
FT   gene            14075..15310
FT                   /db_xref="GeneID:4949535"
FT                   /locus_tag="Bcep1808_3324"
FT   CDS_pept        14075..15310
FT                   /locus_tag="Bcep1808_3324"
FT                   /gene_family="HOG000262984" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll4302 hypothetical protein"
FT                   /db_xref="GI:134292042"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4949535"
FT                   /translation="MIDPNKSRRASFAVFALLYLGYCISYIDRSAIALSLVAIGKEFHV
FT                   GSAALGVVMSTFYISYAAMQIPGGWIADRWGSKKVIVVSVAFWSLFTLMTGLAWSLASL
FT                   IAIRFIFGLGEGGYPGAAVKGVTESVARADRPKMSALLMSSNYVGSFIAPLAIAPLILL
FT                   LGWRHAFFVAGCAGLVFALFYLFAVKDTHQKRDSNGRAARIDGDATRALLKMPLMWKIL
FT                   LTWFGMGIVNKGLDAWMPAYLLTERHLDLKAVGMLTPLPFVAASISTALGGWILTRWLD
FT                   GREKWLMAACCAISGFFLYQMYTAQTVTGVIAYQSIVYFFKSFVFAGVFALPAKFLPTN
FT                   LIGTGAGMVNFGGQVAGFVAPAIIGLLVSATGNYDAVFGFLIVATAFALVTSLSIRLVP
FT                   EATPHVGATKEA"
FT                   /protein_id="YP_001115778.1"
FT   misc_feature    14117..15262
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep1808_3324"
FT   misc_feature    14132..15268
FT                   /note="d-galactonate transporter; Region: 2A0114;
FT                   TIGR00893"
FT                   /db_xref="CDD:162094"
FT                   /locus_tag="Bcep1808_3324"
FT   misc_feature    order(14159..14161,14168..14176,14180..14185,14234..14236,
FT                   14243..14248,14255..14257,14267..14272,14276..14281,
FT                   14417..14422,14429..14434,14441..14446,14453..14455,
FT                   14489..14494,14501..14506,14522..14524,14759..14761,
FT                   14768..14773,14780..14785,14792..14794,14834..14836,
FT                   14846..14848,14858..14860,14867..14869,14879..14881,
FT                   15029..15031,15038..15043,15050..15052,15062..15067,
FT                   15074..15076,15107..15112,15119..15124,15131..15136,
FT                   15143..15145)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Bcep1808_3324"
FT   gene            15336..16298
FT                   /db_xref="GeneID:4949536"
FT                   /locus_tag="Bcep1808_3325"
FT   CDS_pept        15336..16298
FT                   /locus_tag="Bcep1808_3325"
FT                   /gene_family="HOG000203650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: reu:Reut_A1656 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="GI:134292043"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4949536"
FT                   /translation="MMKHHVSSHRSIMSARILQEAAVRYFLEVVNTGSVADAASRLNVV
FT                   PSAVSRQIARLESELGTPLFVRRSRGMVPSKAGEMLAAYARRSQLDAEQVSLEIDALRG
FT                   EAERTIRIACTEGFAATFVPRAMAVFRRTVAPASFEVVVDTAAGVTQRVREAECDVGLT
FT                   FSFGPEKDINTAFSMPSPIFAIVAASHPLARVPQVSFRQLLAYPLALPGVHSTLHKLID
FT                   IYCSREGVACKSVLSSATLETLLGFTIASDAVTFSGELFVRPRLASGELVALHVPELTT
FT                   SERAIEIQTLARRALPPLLDAFIEHLSRELAPAARVEQK"
FT                   /protein_id="YP_001115779.1"
FT   misc_feature    15399..16283
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcep1808_3325"
FT   misc_feature    15399..15572
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep1808_3325"
FT   misc_feature    15660..16256
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep1808_3325"
FT   misc_feature    order(15705..15710,15714..15719,15726..15728,15738..15740,
FT                   15744..15764,16038..16055,16071..16076,16080..16085)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep1808_3325"
FT   gene            16387..17916
FT                   /db_xref="GeneID:4949537"
FT                   /locus_tag="Bcep1808_3326"
FT   CDS_pept        16387..17916
FT                   /locus_tag="Bcep1808_3326"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amidase"
FT                   /transl_table="11"
FT                   /note="PFAM: Amidase; KEGG: pst:PSPTO_2569 amidase family
FT                   protein"
FT                   /db_xref="GI:134292044"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="GeneID:4949537"
FT                   /translation="MSDRHELTRHSAVALRALLLAREISAVELLDACIARIETLNPYVN
FT                   AITATSFERARREARAADAALARGNAVGVLHGLPVGIKDLEETEGLLTTYGSPLYRANI
FT                   PAQDNTLVRRLRAAGAIVVGKTNVPEMGAGANSFNPVWGATGNPFDPRLNAGGSSGGSA
FT                   AALALDMVPLASGSDTGGSLRIPAAKCGVVGLRTSPGLVPSDRKPLGWTPIAVVGPMGR
FT                   TVEDTWLQLAATVGQSGSDPLGYPCALDATMERRAHTDLATLRVGYTEDFGVCAVDDDI
FT                   RAVFRRRIALLRGEVAVCEPIDVDFSGAHQCFDVLRAEAFVAGLQKAYETNPDLLGPNP
FT                   RANYEMGINLGLADCVRAHADQTRLFRRFQTLFDRYDVILSPTTPVSPFRWTQPYLKSV
FT                   NGIALENYYRWLSLTYVVTLTTNPAVSLPCGVDHRGMPFGLQMIGAFRGDLALLDAARA
FT                   FETLFESSDEMRRPIPDVAKLRASDVDLRSIVTHPPVLDAASSSHACASAV"
FT                   /protein_id="YP_001115780.1"
FT   misc_feature    16402..17715
FT                   /note="amidase; Provisional; Region: PRK07486"
FT                   /db_xref="CDD:168970"
FT                   /locus_tag="Bcep1808_3326"
FT   misc_feature    16468..17715
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cl11426"
FT                   /db_xref="CDD:175251"
FT                   /locus_tag="Bcep1808_3326"
FT   gene            17925..19286
FT                   /db_xref="GeneID:4949538"
FT                   /locus_tag="Bcep1808_3327"
FT   CDS_pept        17925..19286
FT                   /locus_tag="Bcep1808_3327"
FT                   /gene_family="HOG000218072" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-serine dehydratase"
FT                   /EC_number="4.3.1.18"
FT                   /note="catalyzes the formation of pyruvate from serine"
FT                   /db_xref="GI:134292045"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="GeneID:4949538"
FT                   /translation="MTDSIYGKPLESWLRDYPLLRPLMALEPVEWFNPAVAPLTEALDD
FT                   IALDASHIADASARLQRFAPLLADLFADVCDTGGIIESPLTDVPAFAQALSERYGVETP
FT                   RRLLLKQDSHLPISGSIKARGGIYEVLFYAEQLALRHGLLNDGDDYRVLAGDACRALFR
FT                   EHRIAVGSTGNLGMSIGIASATLGFAATVHMSTDARQWKKDRLRAHGVTVVEYAGDYGE
FT                   AIENGRRLAANDPMCHFVDDENSTTLFLGYAVAGERLKRQLEASNVRVDATHPLFVYLP
FT                   CGVGGGPGGVAFGLKLAFGDAVHCVFAEPTHSPCMLMGVLTGLHEQLAVQDFGIDNVTA
FT                   ADGLAVGRPSGFVGRAMQRMIDGYFTVEDRELYAMLALMAQTSDIRLEPSALAGAPGFA
FT                   RVSTERQGYRARMQLDDSVMRDATHVIWATGGGMVPQAEMNAYLQAGRQALAGS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115781.1"
FT   misc_feature    18015..19232
FT                   /note="D-Serine dehydratase is a pyridoxal phosphate
FT                   (PLP)-dependent enzyme which catalyzes the conversion of L-
FT                   or D-serine  to pyruvate and ammonia.  D-serine dehydratase
FT                   serves as a detoxifying enzyme in most E. coli strains
FT                   where D-serine is a competitive...; Region: D-Ser-dehyd;
FT                   cd06447"
FT                   /db_xref="CDD:107208"
FT                   /locus_tag="Bcep1808_3327"
FT   misc_feature    order(18285..18290,18444..18446,18771..18785,19092..19094,
FT                   19209..19214)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:107208"
FT                   /locus_tag="Bcep1808_3327"
FT   misc_feature    18288..18290
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107208"
FT                   /locus_tag="Bcep1808_3327"
FT   gene            19513..20337
FT                   /db_xref="GeneID:4949539"
FT                   /locus_tag="Bcep1808_3328"
FT   CDS_pept        19513..20337
FT                   /locus_tag="Bcep1808_3328"
FT                   /gene_family="HOG000028061" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arylesterase"
FT                   /EC_number="3.1.1.2"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   pst:PSPTO_0675 arylesterase"
FT                   /db_xref="GI:134292046"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4949539"
FT                   /translation="MSRITTPDGTEIYYNDWGTGQPIVLVGGWLVSADMWEYQAHFLAS
FT                   NGFRVIAYDRRGFGRSSQPWSGYDYDSLTSDLDELIQQLDLTDAILVGYSMGGGEVARY
FT                   IGTRGSKRIAKVVLLSATTPLLMAGADNPAGVPRDIFDGLRAGVLHDRADFLVNFGRAF
FT                   TGADHDASVVTQAMLDWTFNMAITASIKATHDCIASFSETDLRPDLKKFDIPTLVIHGG
FT                   ADPVVPIDLSGKVSAELIPGARLVVYEGAYHALYYTHKDRLNQDILDFARSS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115782.1"
FT   misc_feature    19513..20334
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Bcep1808_3328"
FT   misc_feature    19537..19758
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcep1808_3328"
FT   misc_feature    19654..20319
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Bcep1808_3328"
FT   gene            complement(20586..20969)
FT                   /db_xref="GeneID:4949540"
FT                   /locus_tag="Bcep1808_3329"
FT   CDS_pept        complement(20586..20969)
FT                   /locus_tag="Bcep1808_3329"
FT                   /gene_family="HOG000220719" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7260 hypothetical protein"
FT                   /db_xref="GI:134292047"
FT                   /db_xref="GeneID:4949540"
FT                   /translation="MTTTFDEATTAAIAAFAELDFYTAVQAMRAEADYDRELDQWISRY
FT                   IDDHGGGVDDAEYDALHARAQATPEYAQFVDAVRREICEYFDVTDEQLDWIVELRNDDS
FT                   DELWAEVNRRRSALGTGEVRGDL"
FT                   /protein_id="YP_001115783.1"
FT   gene            21322..21957
FT                   /db_xref="GeneID:4949541"
FT                   /locus_tag="Bcep1808_3330"
FT   CDS_pept        21322..21957
FT                   /locus_tag="Bcep1808_3330"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bam:Bamb_4372
FT                   isochorismatase hydrolase"
FT                   /db_xref="GI:134292048"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="GeneID:4949541"
FT                   /translation="MQPEHASDHAPNDPTGPDARAHAPLPPLVPAQTALIVMHYQTDIL
FT                   GLFPSAAPTLLANTRRLCDAARAGGVHVCFANLHFSPGYPEVSPRNKNGQGIKQLGRFV
FT                   DDGPCPELGRLDGEPLIAAHRASVFFGTDLQARLAARGIDTLILVGIASTGVVLSSVAH
FT                   ASDADFRLYTVKDCCYDPDPIVHEHLFATAFETRTTVLSLEQALRLLT"
FT                   /protein_id="YP_001115784.1"
FT   misc_feature    21418..21936
FT                   /note="Isochorismatase family; Region: Isochorismatase;
FT                   pfam00857"
FT                   /db_xref="CDD:144449"
FT                   /locus_tag="Bcep1808_3330"
FT   misc_feature    21421..21885
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle. It...;
FT                   Region: cysteine_hydrolases; cd00431"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bcep1808_3330"
FT   misc_feature    order(21436..21438,21688..21690,21787..21789)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bcep1808_3330"
FT   misc_feature    21772..21777
FT                   /note="conserved cis-peptide bond; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Bcep1808_3330"
FT   gene            complement(22025..22756)
FT                   /db_xref="GeneID:4949542"
FT                   /locus_tag="Bcep1808_3331"
FT   CDS_pept        complement(22025..22756)
FT                   /locus_tag="Bcep1808_3331"
FT                   /gene_family="HOG000216926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease T2"
FT                   /transl_table="11"
FT                   /note="PFAM: ribonuclease T2; KEGG: bur:Bcep18194_B0733
FT                   ribonuclease T2"
FT                   /db_xref="GI:134292049"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="GeneID:4949542"
FT                   /translation="MLNTLARTVAALAVASASLHAVAQTSYDYLLLAASWEPGFCASHD
FT                   TPECTNLAGTYAATSLSLHGLWPNNYDGNQPFYCGVPQSDVDLDNAHQWCSMDAYPIST
FT                   TTRNTLSTYMPGVASCLDKHEWFKHGTCSNSASADAYWNQATGMVSRLGNTSFNAFLQA
FT                   NAGKTVTRNQLLSAFEGAFGSNTRSAVSLKCTKTNGVSYFTEAWIAVKTSATTQFPSAA
FT                   SLVTDGNTQGTCPTSGVYIAK"
FT                   /protein_id="YP_001115785.1"
FT   sig_peptide     complement(22685..22756)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.742 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_3331"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(22034..22678)
FT                   /note="Ribonuclease T2 (RNase T2) is a widespread family of
FT                   secreted RNases found in every organism examined thus far.
FT                   This family includes RNase Rh, RNase MC1, RNase LE, and
FT                   self-incompatibility RNases (S-RNases).  Plant T2 RNases
FT                   are expressed during leaf...; Region: RNase_T2_prok;
FT                   cd01062"
FT                   /db_xref="CDD:29474"
FT                   /locus_tag="Bcep1808_3331"
FT   misc_feature    complement(order(22136..22138,22556..22558,22664..22666))
FT                   /note="B1 nucleotide binding pocket; other site"
FT                   /db_xref="CDD:29474"
FT                   /locus_tag="Bcep1808_3331"
FT   misc_feature    complement(order(22142..22144,22394..22396,22637..22639,
FT                   22652..22654))
FT                   /note="B2 nucleotide binding pocket; other site"
FT                   /db_xref="CDD:29474"
FT                   /locus_tag="Bcep1808_3331"
FT   misc_feature    complement(order(22361..22396,22553..22576))
FT                   /note="CAS motifs; other site"
FT                   /db_xref="CDD:29474"
FT                   /locus_tag="Bcep1808_3331"
FT   misc_feature    complement(order(22370..22375,22382..22387,22550..22552,
FT                   22556..22558,22565..22567))
FT                   /note="active site"
FT                   /db_xref="CDD:29474"
FT                   /locus_tag="Bcep1808_3331"
FT   gene            complement(23081..24220)
FT                   /db_xref="GeneID:4949543"
FT                   /locus_tag="Bcep1808_3332"
FT   CDS_pept        complement(23081..24220)
FT                   /locus_tag="Bcep1808_3332"
FT                   /gene_family="HOG000217004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bam:Bamb_4380 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:134292050"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:4949543"
FT                   /translation="MSTPMTTDDRFAQPAPEVLFRVVNRVALITLNRPAALNALSYSMI
FT                   GELAALLERCRGDDQIVAVVLRGAGEKGFCAGGDVRALHRMVAQRETWLPFFVDEYRLD
FT                   YAIHTFPKPVVALMDGVTMGGGMGLAQGAALRVATERSKIAMPETRIGLVPDVGATHFL
FT                   SRMPVELELYVGLTGAVLSGADALIAKLADLCVPSSWLDTFETRIESVKWDGDVLAALR
FT                   KVFEPPCNVVPHAALDTQMGWIVRHFDKRSTVERIVATLKQEFARDELAREHRQWLQTT
FT                   LDALAGHSPTMLCVTREALLRGRQMTLAESFRMELGIVARAIEEGDFREGVRAHLIDKD
FT                   RKPRWAPASLVELRAERVRHFLTSPWKLFAHPLVDLGGV"
FT                   /protein_id="YP_001115786.1"
FT   misc_feature    complement(23129..24181)
FT                   /note="3-hydroxyisobutyryl-CoA hydrolase; Provisional;
FT                   Region: PRK05617"
FT                   /db_xref="CDD:168130"
FT                   /locus_tag="Bcep1808_3332"
FT   misc_feature    complement(23627..24169)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3332"
FT   misc_feature    complement(order(23768..23770,23777..23782,23846..23854,
FT                   23858..23860,23981..23995,24005..24007,24104..24106,
FT                   24110..24112))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3332"
FT   misc_feature    complement(order(23846..23848,23987..23989))
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3332"
FT   misc_feature    complement(order(23642..23644,23651..23653,23684..23686,
FT                   23693..23698,23702..23707,23711..23716,23726..23731,
FT                   23735..23743,23747..23749,23765..23776,23810..23821,
FT                   23882..23884,23906..23908))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3332"
FT   misc_feature    complement(23186..>23356)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cl11392"
FT                   /db_xref="CDD:175234"
FT                   /locus_tag="Bcep1808_3332"
FT   gene            complement(24217..25008)
FT                   /db_xref="GeneID:4949544"
FT                   /locus_tag="Bcep1808_3333"
FT   CDS_pept        complement(24217..25008)
FT                   /locus_tag="Bcep1808_3333"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Catalyzes the reversible hydration of unsaturated
FT                   fatty acyl-CoA to beta-hydroxyacyl-CoA"
FT                   /db_xref="GI:134292051"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:4949544"
FT                   /translation="MIELDYVDDGAIACATLKRPPANAFTADGLRQLQDTVAELNANPR
FT                   VRALVITGDGPKFFSAGADLNTFADGDAAVARAMAARFGAAFEALHDARVVTIAAINGY
FT                   AMGGGLECALACDMRIAETHAQMALPEASVGLLPCGLGTQTLPWLVGEGWAKKIILAGA
FT                   RVDAATALRIGLVEDVVESGAARDAALALARNVVRQSPHALAYSKELIGLARRGVPRSA
FT                   ALAVERERFVDLFDTADPREGVAAFLGKRAPQWHTDGDTQR"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115787.1"
FT   misc_feature    complement(24460..24999)
FT                   /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
FT                   superfamily. This superfamily contains a diverse set of
FT                   enzymes including enoyl-CoA hydratase, napthoate synthase,
FT                   methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
FT                   dehydratase, and dienoyl-CoA isomerase...; Region:
FT                   crotonase-like; cd06558"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3333"
FT   misc_feature    complement(24250..24981)
FT                   /note="enoyl-CoA hydratase; Provisional; Region: PRK05980"
FT                   /db_xref="CDD:168327"
FT                   /locus_tag="Bcep1808_3333"
FT   misc_feature    complement(order(24607..24609,24616..24621,24685..24693,
FT                   24697..24699,24814..24828,24838..24840,24937..24939))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3333"
FT   misc_feature    complement(order(24685..24687,24820..24822))
FT                   /note="oxyanion hole (OAH) forming residues; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3333"
FT   misc_feature    complement(order(24478..24480,24487..24489,24520..24522,
FT                   24529..24534,24538..24543,24547..24552,24565..24570,
FT                   24574..24582,24586..24588,24604..24615,24649..24660,
FT                   24721..24723))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:119339"
FT                   /locus_tag="Bcep1808_3333"
FT   gene            complement(25008..25907)
FT                   /db_xref="GeneID:4949545"
FT                   /locus_tag="Bcep1808_3334"
FT   CDS_pept        complement(25008..25907)
FT                   /locus_tag="Bcep1808_3334"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: bur:Bcep18194_B0717 3-hydroxyisobutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="GI:134292052"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="GeneID:4949545"
FT                   /translation="MKIGFIGLGHMGAPMALNLLKGGHEVHAFDLSADALRALQDAGAQ
FT                   VAPSPRDAAAGAAFVITMLPAAPHVRSVLAGENGVLAGLGAGATVIDSSTIDPASAQAF
FT                   GALVREHGGAFVDAPVSGGTGGAAAGTLTFMVGGSDADFERAKPVLAAMGKNIVHCGAT
FT                   GMGQVAKVCNNLVLGISMAAVSEAMSLGVALGIDPKVLAGIVNTSTGRCWSSDTYNPYP
FT                   GVIDTAPSSRGYSGGFGTDLMLKDLGLANDAARQACQPVYLGALAQQLYQTMSSRGDGQ
FT                   LDFSAVIRLYQPAGKKDA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115788.1"
FT   misc_feature    complement(<25350..25907)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bcep1808_3334"
FT   misc_feature    complement(25032..25895)
FT                   /note="3-hydroxyisobutyrate dehydrogenase; Region: HIBADH;
FT                   TIGR01692"
FT                   /db_xref="CDD:130753"
FT                   /locus_tag="Bcep1808_3334"
FT   gene            complement(25926..27455)
FT                   /db_xref="GeneID:4949546"
FT                   /locus_tag="Bcep1808_3335"
FT   CDS_pept        complement(25926..27455)
FT                   /locus_tag="Bcep1808_3335"
FT                   /gene_family="HOG000271507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   [acylating]"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: bch:Bcen2424_4961
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="GI:134292053"
FT                   /db_xref="InterPro:IPR002086"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="GeneID:4949546"
FT                   /translation="MNANATPQPGQDVPTVKLLIDGAFVESATSEWRDIVNPATQQVLA
FT                   RVPFATAAEVDAAVQAAHAAYATWKNTPISARMRIMLKFQALVRANQQRIAKTLTAEQG
FT                   KTLPDAEGDIFRGLEVVEHACSIGTLQLGEFAENVAGGVDTYTLRQPLGVCAGITPFNF
FT                   PAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMELVELAIEAGVPQGVLNVVHGGKEVVD
FT                   AICTHPLVKAISFVGSTAVGTRVYNLGSQHGKRVQSMMGAKNHAILLPDANREQAINAL
FT                   VGAGFGAAGQRCMATSVAVLVGSAREWLPDIVAKAKTLKVNAGSEAGTDVGPVVSRGAK
FT                   ARILSLIDAGVKEGAKLELDGRDVKVPGFEDGNFIGPTIFSAVTTDMTIYTHEIFGPVL
FT                   VVMEVDTLDEAIALVNANPMGNGVGLFTQSGAAARKFQSEIDVGQVGINIPIPVPVPFF
FT                   SFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDDTTAGPVNTTIRLH"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115789.1"
FT   misc_feature    complement(25980..27428)
FT                   /note="1-pyrroline-5-carboxylate dehydrogenase;
FT                   Provisional; Region: PRK03137"
FT                   /db_xref="CDD:167499"
FT                   /locus_tag="Bcep1808_3335"
FT   misc_feature    complement(25980..27410)
FT                   /note="Methylmalonate semialdehyde dehydrogenase and ALDH
FT                   family members 6A1 and 6B2; Region: ALDH_F6_MMSDH; cd07085"
FT                   /db_xref="CDD:143404"
FT                   /locus_tag="Bcep1808_3335"
FT   misc_feature    complement(order(25980..25985,25989..26006,26025..26027,
FT                   26067..26069,26073..26075,26085..26087,26112..26123,
FT                   26127..26129,26133..26138,26145..26147,26154..26159,
FT                   26163..26168,26172..26174,26691..26693,26697..26699,
FT                   26706..26708,26715..26717,26727..26729,27006..27008,
FT                   27015..27017,27024..27026,27039..27062,27087..27092,
FT                   27099..27101,27198..27200,27210..27212,27219..27221,
FT                   27231..27233,27237..27239))
FT                   /note="tetrameric interface; other site"
FT                   /db_xref="CDD:143404"
FT                   /locus_tag="Bcep1808_3335"
FT   misc_feature    complement(order(26193..26195,26271..26273,26277..26279,
FT                   26577..26579,26673..26681,26733..26735,26742..26753,
FT                   26802..26804,26892..26894,26901..26903,26946..26948,
FT                   26970..26981))
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:143404"
FT                   /locus_tag="Bcep1808_3335"
FT   misc_feature    complement(order(26577..26579,26586..26588,26679..26681,
FT                   26970..26972))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143404"
FT                   /locus_tag="Bcep1808_3335"
FT   gene            complement(27598..29310)
FT                   /db_xref="GeneID:4949547"
FT                   /locus_tag="Bcep1808_3336"
FT   CDS_pept        complement(27598..29310)
FT                   /locus_tag="Bcep1808_3336"
FT                   /gene_family="HOG000229982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bam:Bamb_4384 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:134292054"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="GeneID:4949547"
FT                   /translation="MTVQAFLDARDFLLRHRTDYETAYRDFEWPVLDAFNWALDYFDPM
FT                   ARGNDAPALWIVDAATGTGDPYSFAQMSERSSRIANWLRGIGVVRGDRILLMLPNRVEL
FT                   WDAMLAAMKLGAVVLPATTQLSADDVRDRVQIGGATYAIVDEHETAKFEQAGLGLKRKI
FT                   VAGAPRDGWLAMNDGYAASAAFEPDAVTRSNEAMLLYFTSGTTSKPKLVEHTHRTYPVG
FT                   HLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFVFNYARFEPKAVLDAL
FT                   VKYRVTTLCAPPTVWRMLVQQPLATFDVQLREIVGAGEPLNPEIIERVKKAWGITIRDG
FT                   YGQTETTCLIGNTPGQPVVAGSMGRPLPGYRIALLDPDGAPVGEGEVALPLGGGTGAMR
FT                   PVGLMNGYANNPDATAYAMRDGHYRTSDIAMRGDDGYYVYVGRADDVFKSSDYRLSPFE
FT                   LESVLIEHPAIAEAAVVPSPDPVRLSVPKTFITLRDGFEESPTLALEIFRFSREKLAPY
FT                   KRIRRLQFAELPKTISGKIRRVELRRREIERGDDATARMPGEYWEEDFAAELK"
FT                   /protein_id="YP_001115790.1"
FT   misc_feature    complement(27706..29229)
FT                   /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
FT                   [Lipid metabolism]; Region: Acs; COG0365"
FT                   /db_xref="CDD:30714"
FT                   /locus_tag="Bcep1808_3336"
FT   misc_feature    complement(27706..29112)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="Bcep1808_3336"
FT   gene            complement(29534..30667)
FT                   /db_xref="GeneID:4949548"
FT                   /locus_tag="Bcep1808_3337"
FT   CDS_pept        complement(29534..30667)
FT                   /locus_tag="Bcep1808_3337"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bam:Bamb_4385 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="GI:134292055"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:4949548"
FT                   /translation="MDELYTEDQRMIRDAARAFATEVLAPNAAQWDHDARLPDTVVAQL
FT                   GELGLLGMIVPQELGGAYTDYVAYALAMEEIAAGDAACATMMSVHNSVGCGPILGFGTP
FT                   AQKDRWLAEMAAGRVIGAFCLTEPHAGSEAHNLRTRAELHDGQWVLNGAKQFVTNGQRA
FT                   GVAIVFAMTDPDAGKRGISAFLVPTDTPGFIVGKPEKKMGIRASDTCPITLENCTLPAD
FT                   ALLGNRGEGLKIALSNLEGGRIGIAAQALGIARAAFDKARRYAGERVQFGKPIAEHQAI
FT                   QQKLADMATQINAARLLVHHAAKLRTAGLPCLSEASQAKLFASEMAERVCSDAIQIHGG
FT                   YGYLADYEVERHYRDARITQIYEGTSEVQRMVIARQL"
FT                   /protein_id="YP_001115791.1"
FT   misc_feature    complement(29537..30667)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="Bcep1808_3337"
FT   misc_feature    complement(29537..30649)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Bcep1808_3337"
FT   misc_feature    complement(order(29567..29569,29573..29575,29579..29587,
FT                   30194..30196,30200..30202,30293..30295,30299..30301,
FT                   30389..30391))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Bcep1808_3337"
FT   gene            30805..31839
FT                   /db_xref="GeneID:4949549"
FT                   /locus_tag="Bcep1808_3338"
FT   CDS_pept        30805..31839
FT                   /locus_tag="Bcep1808_3338"
FT                   /gene_family="HOG000217016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bam:Bamb_4386 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="GI:134292056"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:4949549"
FT                   /translation="MKQDERGTIAISLVAYSVALAARRGVAAEPLLAQAGIAPALLAQP
FT                   RARVSAQQYGALWNAIARALDDEFFGQDRHPMRSGSFIAMSQAALSAQDGLRAMARAVN
FT                   FMHCVLDDLHAELDANPQRVRLRFVHRNNGAAPAMFTYATYFIIVYGLTCWLIGRRIPV
FT                   LHASFRCDTPPADHEYPSMLCDDMRFNQPDSYVDFDPEFATLPVVQNAKTLKTFLRNAP
FT                   ASFIVKYRNPNALAQRVRAVLRGMPPASWPGADGMAARLHVAEATLRRKLHQEGQAYQS
FT                   IKDTLRRDLAFEALADPSRTIADVAAATGFAEPSAFYRAFRKWSGRSPAEYREEALARA
FT                   GGAR"
FT                   /protein_id="YP_001115792.1"
FT   sig_peptide     30805..30888
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.449 at
FT                   residue 28"
FT                   /locus_tag="Bcep1808_3338"
FT                   /product="hypothetical protein"
FT   misc_feature    31567..31791
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Bcep1808_3338"
FT   misc_feature    <31705..31791
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Bcep1808_3338"
FT   gene            31951..33504
FT                   /db_xref="GeneID:4949550"
FT                   /locus_tag="Bcep1808_3339"
FT   CDS_pept        31951..33504
FT                   /locus_tag="Bcep1808_3339"
FT                   /gene_family="HOG000217027" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bam:Bamb_4387 protein of unknown function DUF107"
FT                   /db_xref="GI:134292057"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="GeneID:4949550"
FT                   /translation="MRIHRHAPPAPAVRGARSRHPLSARVARAALFAALLVVCAAVAAP
FT                   GAAAPANAPAAAAPVVVIPVNGAIGPASADFIVRSLDRAASVHAPLAILQLDTPGGLDT
FT                   SMRQIIKAIVGSPVPVAAFVAPGGARAASAGTYIVYASHVAAMAPGTNLGAASPVQFGI
FT                   GGGAPGTPRSSPAAASGASGTSATSAELPNDTQSTEIRKATQDAAAYIRGLAQLRGRNA
FT                   DWAERAVREAVSLSANDARAQHVVDLIAQDPADLARRLDGRTVTTSAGTLRLATAHAPL
FT                   VVLAPDWRSRFLSIVADPNVALILLTIGIYGLFFEFANPGFVLPGVAGTICLLIGLFAM
FT                   QLLPVSYAGLGLVLLGLGCLVAEAFLPTFGVLGFGGIVAFTIGALMLIDTDVPGYGIPW
FT                   PLIAGLAAAGALLVAGVSSVALRARRRPVVTGAEAMLDSVGEVLDDGLRPDQPHGAAGP
FT                   APSAAGWARVHGERWRVASSTPLAAGCRVRVTGRHGLTLTVTPLYDVPAHEPQQRGAPS
FT                   "
FT                   /protein_id="YP_001115793.1"
FT   sig_peptide     31951..32097
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.388 at
FT                   residue 49"
FT                   /locus_tag="Bcep1808_3339"
FT                   /product="hypothetical protein"
FT   misc_feature    32164..32772
FT                   /note="Nodulation formation efficiency D (NfeD) is a
FT                   membrane-bound ClpP-class protease; Region:
FT                   Clp_protease_NfeD_1; cd07020"
FT                   /db_xref="CDD:132931"
FT                   /locus_tag="Bcep1808_3339"
FT   misc_feature    order(32347..32349,32554..32556)
FT                   /note="active site residues"
FT                   /db_xref="CDD:132931"
FT                   /locus_tag="Bcep1808_3339"
FT   misc_feature    32710..32712
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132931"
FT                   /locus_tag="Bcep1808_3339"
FT   misc_feature    33034..33453
FT                   /note="NfeD-like; Region: NfeD; cl00686"
FT                   /db_xref="CDD:120037"
FT                   /locus_tag="Bcep1808_3339"
FT   gene            33501..34274
FT                   /db_xref="GeneID:4949551"
FT                   /locus_tag="Bcep1808_3340"
FT   CDS_pept        33501..34274
FT                   /locus_tag="Bcep1808_3340"
FT                   /gene_family="HOG000217040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SPFH domain-containing protein/band 7 family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: band 7 protein; KEGG: bch:Bcen2424_4966 band 7
FT                   protein"
FT                   /db_xref="GI:134292058"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="GeneID:4949551"
FT                   /translation="MIGYTFGFGSVLIVFVVVLVASSIRVFREYERGVVFMLGRFWKVK
FT                   GPGLVLIIPIVQQVVRIDLRTVVFDVPAQDVITRDNVSVKVNAVVYFRVVDPEKAVIQV
FT                   ARFFEATSQLAQTTLRAVLGKHELDALLAEREQLNADIQKTLDAQTDAWGIKVSTVEIK
FT                   HVDLNETMIRAIARQAEAERERRAKVIHAEGELQASEKLLQAAQRLAQQPQAMQLRYLQ
FT                   TLTTIAADKNSTIVFPLPIDLLGALLDRLGAPPER"
FT                   /protein_id="YP_001115794.1"
FT   misc_feature    33582..34211
FT                   /note="Band_7_stomatin_like: A subgroup of the band 7
FT                   domain of flotillin (reggie) like proteins similar to
FT                   stomatin and podicin (two lipid raft-associated integral
FT                   membrane proteins). Individual proteins of this band 7
FT                   domain family may cluster to form...; Region:
FT                   Band_7_stomatin_like; cd03403"
FT                   /db_xref="CDD:48215"
FT                   /locus_tag="Bcep1808_3340"
FT   gene            complement(34335..35612)
FT                   /db_xref="GeneID:4949552"
FT                   /locus_tag="Bcep1808_3341"
FT   CDS_pept        complement(34335..35612)
FT                   /locus_tag="Bcep1808_3341"
FT                   /gene_family="HOG000217041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4967 hypothetical protein"
FT                   /db_xref="GI:134292059"
FT                   /db_xref="GeneID:4949552"
FT                   /translation="MQRRKFINTLAAATAATPLMLKAGMAGAKSATAPDALDPGRWSPF
FT                   NAARLQTVLDRHGVASAGYDAKRRPYAVFDWDNTCIMNDCEEALLMYQINHLQYKLTPD
FT                   EFVGVMWKDVPKGAFMKDYTTVDGKPVTMEDLAADVESDYRWLHANYQGFGGDKSLDEI
FT                   RETDQFKDFRAKLYFMYDAICDTHPLEVGYKWIIYFYKNMTTAELQAMAQASNNYGIGD
FT                   ALRKVRYESPKALPGKAGVVADTHFHGIRIHEEIRSVMHTLRANGIDVYVSTASLDDVV
FT                   RVFAGNPNYGYGVAPENVIGLRLDMQDGKYTSTYPAGWHFNWGPGKTVGIRNVLASKKG
FT                   YGPLLVFGDSDGDAWMLRDFKDTAAGVIVNRMKKGEIGADSKLASEQIGNPDARFLLQG
FT                   RDEHTGLMIPDEKSIKYGKTERKLLA"
FT                   /protein_id="YP_001115795.1"
FT   sig_peptide     complement(35526..35612)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.788 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_3341"
FT                   /product="hypothetical protein"
FT   gene            36117..36404
FT                   /db_xref="GeneID:4949553"
FT                   /locus_tag="Bcep1808_3342"
FT   CDS_pept        36117..36404
FT                   /locus_tag="Bcep1808_3342"
FT                   /gene_family="HOG000217087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4971 hypothetical protein"
FT                   /db_xref="GI:134292060"
FT                   /db_xref="GeneID:4949553"
FT                   /translation="MAMKKTDLEKNKALKLTQAMKQSGSARFGKGADEAAKLDRRAQRK
FT                   LDQEQGLVPFACKLNAELVEQLKARAATHPNGMTGLLSELLVNGLAQRDA"
FT                   /protein_id="YP_001115796.1"
FT   gene            36655..37029
FT                   /db_xref="GeneID:4949554"
FT                   /locus_tag="Bcep1808_3343"
FT   CDS_pept        36655..37029
FT                   /locus_tag="Bcep1808_3343"
FT                   /gene_family="HOG000217098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4394 hypothetical protein"
FT                   /db_xref="GI:134292061"
FT                   /db_xref="GeneID:4949554"
FT                   /translation="MDQASPLFDRPDSRRAGAIALPTVVIRFAVAPHTTLTWRAPSDAE
FT                   IRAHGAALWITRPPSVDDYWVQPGDVLRIARGDRIWLGTYDGRPAEASITTAYVRRGDR
FT                   LGRTVARVRGWLAARGRRRD"
FT                   /protein_id="YP_001115797.1"
FT   misc_feature    36736..36906
FT                   /note="Protein of unknown function (DUF2917); Region:
FT                   DUF2917; pfam11142"
FT                   /db_xref="CDD:151586"
FT                   /locus_tag="Bcep1808_3343"
FT   gene            complement(37193..37471)
FT                   /db_xref="GeneID:4949555"
FT                   /locus_tag="Bcep1808_3344"
FT   CDS_pept        complement(37193..37471)
FT                   /locus_tag="Bcep1808_3344"
FT                   /gene_family="HOG000217109" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4973 hypothetical protein"
FT                   /db_xref="GI:134292062"
FT                   /db_xref="GeneID:4949555"
FT                   /translation="MLNWISRWAMRHAPTPEKTAASMLVTARMELFTAEQRVIDAKLQA
FT                   DYWRTRVSFLEEVQKQGIDPWVTSQAAQRPDVDTTPRGTGPRLAAST"
FT                   /protein_id="YP_001115798.1"
FT   gene            38162..39463
FT                   /db_xref="GeneID:4949556"
FT                   /locus_tag="Bcep1808_3345"
FT   CDS_pept        38162..39463
FT                   /locus_tag="Bcep1808_3345"
FT                   /gene_family="HOG000244363" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /transl_table="11"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bam:Bamb_4396 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="GI:134292063"
FT                   /db_xref="InterPro:IPR002000"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="GeneID:4949556"
FT                   /translation="MESIKRYFGFAEAGTDFRTEILAGVTTFLTMAYIIFVNPAILGDA
FT                   GMPKESVFVATCLVAALASIIMGLYANYPIACAPGMGLNAYFAYTVVKGMGFTWQAALG
FT                   AVFISGCLFLLVTLLRVREAIVNGIPKSLRISITAGIGLFLGIISLKTSGVIVGSPATL
FT                   VTLGDLHKHDTILAIVGFFTIVTLDYLRVRGAILIGIIGVTVLSFFFGDNQFHGVFSAP
FT                   PSIDATLFKLDIGAALSTGIINVILVFFLVELFDATGTLMGVANRAGLLVEGKMDRLNK
FT                   ALLADSTAIVAGSVLGTSSTTAYIESASGVQAGGRTGVTAITVAVLFLACLFIAPLAGV
FT                   VPGYATAPALLYVSCLMLREMVDVPWDDATEAVPAALTALLMPFTYSIANGVAFGFIAY
FT                   GGLKLLTGQARTVKPIVWIIAAVFLFRYFYLGGE"
FT                   /protein_id="YP_001115799.1"
FT   misc_feature    38162..39454
FT                   /note="Permease family; Region: Xan_ur_permease; cl00967"
FT                   /db_xref="CDD:176823"
FT                   /locus_tag="Bcep1808_3345"
FT   gene            complement(39555..40442)
FT                   /db_xref="GeneID:4949557"
FT                   /locus_tag="Bcep1808_3346"
FT   CDS_pept        complement(39555..40442)
FT                   /locus_tag="Bcep1808_3346"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bam:Bamb_4397 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:134292064"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4949557"
FT                   /translation="MTRRRIPSNSALMAFEAAARHGSFARAADELALTEGAISRQIGRL
FT                   EAFLGVALFERVGNRVRVVPNGARYAAQVREVLDRLERDSQYLMGQAGDGGSIDIAVTP
FT                   TFATRWLIPRLGGFQAEHPNITVHLADRAEPFVLAGSGFDAAIHFEHPAWAGMHTYRLC
FT                   EEVLVPVCRPSLLAGGHPDALLGTLPRLHKRQTPDAWSAYVQETGLPVDNPAAGARHDL
FT                   YSMLIAAALAGLGVALVPRLYVEAEIAQGLLAAPWPDGRGVVKRFCLVVPEALELGDGP
FT                   LRTFARWVLRQAGA"
FT                   /protein_id="YP_001115800.1"
FT   sig_peptide     complement(40359..40442)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.520 at
FT                   residue 28"
FT                   /locus_tag="Bcep1808_3346"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(39558..40433)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:170976"
FT                   /locus_tag="Bcep1808_3346"
FT   misc_feature    complement(<40278..40412)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep1808_3346"
FT   misc_feature    complement(39576..40154)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Bcep1808_3346"
FT   misc_feature    complement(order(39747..39752,39756..39761,39777..39794,
FT                   40050..40070,40074..40076,40086..40088,40095..40100,
FT                   40104..40109))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bcep1808_3346"
FT   gene            40598..41137
FT                   /db_xref="GeneID:4949558"
FT                   /locus_tag="Bcep1808_3347"
FT   CDS_pept        40598..41137
FT                   /locus_tag="Bcep1808_3347"
FT                   /gene_family="HOG000267048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4398 hypothetical protein"
FT                   /db_xref="GI:134292065"
FT                   /db_xref="GeneID:4949558"
FT                   /translation="MIYAVECSIAEPAVEAEWNDFYSRVKLPALISVSGFRTSQRFRAL
FT                   GGDGPVYLALHTIDAPDVLTSAEYRAKGGGNFARWQPHIVEWRRNVYDSAAPAPAVADG
FT                   QWLAVSDDAAPFAQAGIAAAALHAVALDRRPAHRWLAVLDRDGARLASHAAGAAIRLYA
FT                   PIGEQLVGTPATAAAR"
FT                   /protein_id="YP_001115801.1"
FT   gene            41150..41476
FT                   /db_xref="GeneID:4949559"
FT                   /locus_tag="Bcep1808_3348"
FT   CDS_pept        41150..41476
FT                   /locus_tag="Bcep1808_3348"
FT                   /gene_family="HOG000267037" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4399 hypothetical protein"
FT                   /db_xref="GI:134292066"
FT                   /db_xref="GeneID:4949559"
FT                   /translation="MPSVTIFIAEAGMPAQTSLAALSSACDTLCTDVLNAAPGTVHVAF
FT                   VPVRHGCGHPVSAEIRFRLGPLRTAELIDRFMASLDREILRHTGLVARIRCFGHDSAHL
FT                   HARN"
FT                   /protein_id="YP_001115802.1"
FT   gene            41479..42342
FT                   /db_xref="GeneID:4949560"
FT                   /locus_tag="Bcep1808_3349"
FT   CDS_pept        41479..42342
FT                   /locus_tag="Bcep1808_3349"
FT                   /gene_family="HOG000267036" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bam:Bamb_4400 beta-lactamase domain protein"
FT                   /db_xref="GI:134292067"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:4949560"
FT                   /translation="MNPSIARPPFPCRQIGDFSVIALSDGTLSAGLDLLSNIDVDAAAG
FT                   IMQRAGVPAPSDVNINCYVIRGGGRTVLVDAGAGGFRNWGGLLPAALSQAGIDARDIDT
FT                   ILLTHAHPDHIGGLLDAREQPAFPRAEVLIHDRERAFWLDHDAYERASERARGNFELAR
FT                   RAFDACRAQLRTIAGGNVLPGIAAVPLPGHTPGHTGYRVESRGERLLIWGDLVHFAPVQ
FT                   VAHPDVSIAFDHDASLACATRAATLAHAAGENLMIAGMHLADTGFARIARAHGATDGAY
FT                   ALVATD"
FT                   /protein_id="YP_001115803.1"
FT   misc_feature    41650..>42129
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Bcep1808_3349"
FT   gene            complement(42494..42781)
FT                   /db_xref="GeneID:4949561"
FT                   /locus_tag="Bcep1808_3350"
FT   CDS_pept        complement(42494..42781)
FT                   /locus_tag="Bcep1808_3350"
FT                   /gene_family="HOG000186128" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4401 hypothetical protein"
FT                   /db_xref="GI:134292068"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="GeneID:4949561"
FT                   /translation="MQIHFTNEKPEYSGRDLMLGFTALVNGERVKCQITAEALEDHFGA
FT                   ASPRFEDMVGAYDQHRERIEAAARRLLSETRAQCVTLRSGYVRFYEANWR"
FT                   /protein_id="YP_001115804.1"
FT   misc_feature    complement(42533..42778)
FT                   /note="Protein of unknown function (DUF1488); Region:
FT                   DUF1488; pfam07369"
FT                   /db_xref="CDD:148784"
FT                   /locus_tag="Bcep1808_3350"
FT   gene            complement(43024..43215)
FT                   /db_xref="GeneID:4949562"
FT                   /locus_tag="Bcep1808_3351"
FT   CDS_pept        complement(43024..43215)
FT                   /locus_tag="Bcep1808_3351"
FT                   /gene_family="HOG000217131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0699 hypothetical protein"
FT                   /db_xref="GI:134292069"
FT                   /db_xref="GeneID:4949562"
FT                   /translation="MVRTELRVVLAAIATFIMLGGIGVAIHGLLFDAIDAVRYGAAAIA
FT                   VGATTAAIALNIWPTDPH"
FT                   /protein_id="YP_001115805.1"
FT   misc_feature    complement(43030..43215)
FT                   /note="Protein of unknown function (DUF2964); Region:
FT                   DUF2964; pfam11177"
FT                   /db_xref="CDD:151619"
FT                   /locus_tag="Bcep1808_3351"
FT   gene            43524..45422
FT                   /db_xref="GeneID:4949563"
FT                   /locus_tag="Bcep1808_3352"
FT   CDS_pept        43524..45422
FT                   /locus_tag="Bcep1808_3352"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fis family GAF modulated sigma54 specific
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: bam:Bamb_4403 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="GI:134292070"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4949563"
FT                   /translation="MPQPFVLPAAAGRNDLLAQAHARSTSLGLRADERPDFSPLSRLAL
FT                   RELLDTNHALFAHARPVMENLHAQIADTQSLVLLTDADGVILHSIGDADFIEKANRVAL
FT                   CTGVSWAEGTRGTNAIGTALASGQAVAVHGDEHFLRANHILTCSCAPIIDPFGRTLGTL
FT                   DVSGDPRGFSPHTLALVRMSAQLIENHLFANRCAEALRLRFHAHEDCVDSLFAGLVAFD
FT                   RDGGLIAANRSAQFQLGATFDALQHRGCDALFGMQFNQLAQQAARAPGAPFQLTLSTGV
FT                   RVLARCEFAEARKTTVAVTPPAPAPVAARPRAVDPEAITFATLDTGDARMAAVLDRVAK
FT                   IRGRDLPLLILGQTGTGKEWLARALHQASPRAEGPFVAVNCAALPDSLIEAELFGYEDG
FT                   AFTGARKRGSPGKIAQADGGTLFLDEIGDMPLAQQVRLMRVLQERAVMPLGGARAVQVD
FT                   VRVVCATHRDLRAMIAERTFREDLFYRINGLAVTLPPLAARTDLPVLVERILARLAHSE
FT                   PMPTRVAADVLDAFLRHRWPGNLRQMTNVLRTAGMLAEDEAEITLAHLPDDFWLDCEDA
FT                   PASSPAPAGTRAATTLQSHQAAVIDAVLARHGGNVSAAARELGLARNTVYRYLRRH"
FT                   /protein_id="YP_001115806.1"
FT   misc_feature    43641..45419
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    43698..44096
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    44502..44984
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    44577..44600
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    order(44580..44603,44793..44795,44919..44921)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    44781..44798
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    44976..44978
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Bcep1808_3352"
FT   misc_feature    45309..45419
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Bcep1808_3352"
FT   gene            45471..45824
FT                   /db_xref="GeneID:4949564"
FT                   /locus_tag="Bcep1808_3353"
FT   CDS_pept        45471..45824
FT                   /locus_tag="Bcep1808_3353"
FT                   /gene_family="HOG000217152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferredoxin"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; KEGG: bam:Bamb_4404 ferredoxin"
FT                   /db_xref="GI:134292071"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="GeneID:4949564"
FT                   /translation="MLGRSHRIAAALPPAFTMTDPERPPLVRVEPLGATFDAPDSLTLL
FT                   EAAAFAHVSLPRSCRNGTCRTCLCRIISGSVRYTIEWPGLSRDEKAEGYTLPCVAVATS
FT                   DLVLDVPDAQMIE"
FT                   /protein_id="YP_001115807.1"
FT   misc_feature    45549..45797
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_3353"
FT   misc_feature    order(45633..45638,45645..45647,45654..45656,45660..45671,
FT                   45759..45764)
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_3353"
FT   misc_feature    order(45645..45647,45660..45662,45669..45671,45762..45764)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Bcep1808_3353"
FT   gene            45926..46303
FT                   /db_xref="GeneID:4949565"
FT                   /locus_tag="Bcep1808_3354"
FT   CDS_pept        45926..46303
FT                   /locus_tag="Bcep1808_3354"
FT                   /gene_family="HOG000159249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4406 hypothetical protein"
FT                   /db_xref="GI:134292072"
FT                   /db_xref="GeneID:4949565"
FT                   /translation="MLSRRLRKIVSLIGMLAILMTTLAPTISQALTTQRRVDALLAGYC
FT                   TAGPSDADHGDAASSKSLQAHLQACGYCSLLAHTPALPAPELTFAANRAPLQHREATRF
FT                   ESLPRALPLTVAQPRAPPSAA"
FT                   /protein_id="YP_001115808.1"
FT   sig_peptide     45926..46018
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT                   /locus_tag="Bcep1808_3354"
FT                   /product="hypothetical protein"
FT   misc_feature    45953..46291
FT                   /note="Protein of unknown function (DUF2946); Region:
FT                   DUF2946; pfam11162"
FT                   /db_xref="CDD:151604"
FT                   /locus_tag="Bcep1808_3354"
FT   gene            46521..46886
FT                   /db_xref="GeneID:4949566"
FT                   /locus_tag="Bcep1808_3355"
FT   CDS_pept        46521..46886
FT                   /locus_tag="Bcep1808_3355"
FT                   /gene_family="HOG000127318" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper resistance protein CopC"
FT                   /transl_table="11"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bam:Bamb_4407 copper resistance protein CopC"
FT                   /db_xref="GI:134292073"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="GeneID:4949566"
FT                   /translation="MKITSFVRGALVVAGFVIAQAAHAHAHPKTLDPAADATLASAPHE
FT                   VAIDFSETLEPAFSSIVVTDSHGQSVADGKSTVDAGNRKRMHVALASLAAGTYTVAWVA
FT                   VASDGHRTQGRYTFTVK"
FT                   /protein_id="YP_001115809.1"
FT   sig_peptide     46521..46595
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.560 at
FT                   residue 25"
FT                   /locus_tag="Bcep1808_3355"
FT                   /product="hypothetical protein"
FT   misc_feature    46530..46883
FT                   /note="Copper resistance protein CopC; Region: CopC;
FT                   cl01012"
FT                   /db_xref="CDD:154145"
FT                   /locus_tag="Bcep1808_3355"
FT   gene            46939..47385
FT                   /db_xref="GeneID:4949567"
FT                   /locus_tag="Bcep1808_3356"
FT   CDS_pept        46939..47385
FT                   /locus_tag="Bcep1808_3356"
FT                   /gene_family="HOG000217164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   bam:Bamb_4408 protein of unknown function DUF461"
FT                   /db_xref="GI:134292074"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="GeneID:4949567"
FT                   /translation="MKRSIPASLLFALLALQAPATFAASAVQADGCWIRTMPATVPSSG
FT                   YFTLKNDGDKPATLTGIDTPAYGMAMIHETLTAGSSAKMVHVDAVEVPAHGTVTFKPKS
FT                   YHVMLEDARKPVAPGAKVPLALHFADGSTVSVTCDAKAPSYTGQ"
FT                   /protein_id="YP_001115810.1"
FT   sig_peptide     46939..47010
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.758 at
FT                   residue 24"
FT                   /locus_tag="Bcep1808_3356"
FT                   /product="hypothetical protein"
FT   misc_feature    47035..47349
FT                   /note="Protein of unknown function (DUF461); Region:
FT                   DUF461; cl01071"
FT                   /db_xref="CDD:154181"
FT                   /locus_tag="Bcep1808_3356"
FT   gene            47416..47592
FT                   /db_xref="GeneID:4949568"
FT                   /locus_tag="Bcep1808_3357"
FT   CDS_pept        47416..47592
FT                   /locus_tag="Bcep1808_3357"
FT                   /gene_family="HOG000217165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_4985 hypothetical protein"
FT                   /db_xref="GI:134292075"
FT                   /db_xref="GeneID:4949568"
FT                   /translation="MSHQRPTLADRIVRYRTPLNLAVLIVCGLWAAWVAWITRPAAIDS
FT                   PASIVASCVRDTR"
FT                   /protein_id="YP_001115811.1"
FT   gene            47679..48308
FT                   /db_xref="GeneID:4949569"
FT                   /locus_tag="Bcep1808_3358"
FT   CDS_pept        47679..48308
FT                   /locus_tag="Bcep1808_3358"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine exporter protein LysE/YggA"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0692 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="GI:134292076"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:4949569"
FT                   /translation="MSVQTWMLFAAAYLATTLSPGPNVLLVIRNTVRYGSRGTAATIAG
FT                   NLVAQGAVVGLVALGVGAVLAAMPPLFVAMKVVGAAYLIFIGIRQLRGDRHRRAPDSGA
FT                   TSVEPDRSKLFREALFVSGSNPKTMIFLSAFMPQFISHDRPLAMQFVAMYATIACTVIV
FT                   VHSLYSFGVRRLHRGFGVSPWLRAAKRASGLLFVALGIKLLTARQA"
FT                   /protein_id="YP_001115812.1"
FT   misc_feature    47679..48299
FT                   /note="LysE type translocator; Region: LysE; cl00565"
FT                   /db_xref="CDD:174287"
FT                   /locus_tag="Bcep1808_3358"
FT   gene            complement(48347..49672)
FT                   /db_xref="GeneID:4949570"
FT                   /locus_tag="Bcep1808_3359"
FT   CDS_pept        complement(48347..49672)
FT                   /locus_tag="Bcep1808_3359"
FT                   /gene_family="HOG000217186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: protein kinase; leucine-rich repeat protein;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; leucine-rich repeat-containing protein, typical
FT                   subtype; KEGG: bam:Bamb_4410 serine/threonine protein
FT                   kinase"
FT                   /db_xref="GI:134292077"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="GeneID:4949570"
FT                   /translation="MTTTLEQLQSGQLSGARELKLACGLTEFPREIFDLADTLEVLDLS
FT                   GNALSTLPDDLARLHRLRILFASGNRFTEFPAALGACPQLDMIGFKANRIRTVPRGALP
FT                   RALRWLILTDNEIDALPADIGDCSRLQKLMLAGNRLRALPAELAACRALELVRLSANRL
FT                   DALPDWLLRLPRLSWLAAAGNPLGAGPEAAASAEPGVAEIDWASLACEHRLGEGASGVI
FT                   YRAQWRAEGRATRAVAVKLFKGAVTSDGLPDCEMAACLHAGRHPNMIPVIGKLRGHPDG
FT                   AHGLVMELVDPALTNLAGPPSFASCTRDVYAADARFAPADAARLAHGIASVAAHLHARG
FT                   IMHGDLYAHNILHDGAGGALLGDFGAASLYDVNDRVRAARFERLEVRAFGYLLRELLER
FT                   CEPRAWAAAQALGALAAACVNDEVDARPSFEQIVAALAATMD"
FT                   /protein_id="YP_001115813.1"
FT   misc_feature    complement(<49139..>49615)
FT                   /note="Leucine-rich repeat (LRR) protein [Function
FT                   unknown]; Region: COG4886"
FT                   /db_xref="CDD:34495"
FT                   /locus_tag="Bcep1808_3359"
FT   misc_feature    complement(<48617..49036)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Bcep1808_3359"
FT   misc_feature    complement(order(48617..48619,48623..48628,48632..48634,
FT                   48638..48640,48761..48763,48767..48769,48803..48814,
FT                   48866..48868,48953..48955,48959..48961,49007..49009,
FT                   49019..49033))
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Bcep1808_3359"
FT   misc_feature    complement(order(48617..48619,48623..48628,48632..48634,
FT                   48638..48640,48767..48769,48803..48814,48866..48868,
FT                   48953..48955,48959..48961,49007..49009,49019..49033))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Bcep1808_3359"
FT   misc_feature    complement(order(48626..48628,48632..48634,48638..48640,
FT                   48761..48763,48767..48769,49019..49021))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Bcep1808_3359"
FT   gene            49820..49904
FT                   /note="tRNA-Leu7"
FT                   /db_xref="GeneID:4949571"
FT                   /locus_tag="Bcep1808_R0077"
FT   tRNA            49820..49904
FT                   /db_xref="GeneID:4949571"
FT                   /locus_tag="Bcep1808_R0077"
FT                   /product="tRNA-Leu"
FT   gene            50285..52096
FT                   /db_xref="GeneID:4949572"
FT                   /locus_tag="Bcep1808_3360"
FT   CDS_pept        50285..52096
FT                   /locus_tag="Bcep1808_3360"
FT                   /gene_family="HOG000142804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bur:Bcep18194_C7668 GAF sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="GI:134292078"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:4949572"
FT                   /translation="MTMHPESPIAAEQLKLVYGIVTLSVCGGTLLAATLVVSLERLGRV
FT                   DPLAGAAWLSYIVACSTAHACLAWRYHRSANRDTRRSRWAAGFVACSTAAGIGWGWSSI
FT                   ELAKGRGFEVESLAVTATLGVVAGAVPVFGTYLPAFLAFLLPATVPYVVAAALSDNRVQ
FT                   QATAPMMFLFVCVIAYLGLLANRSAAQNIRLRFRAEQLARDLRARNRTAKRLADDLLRQ
FT                   KQIAEEANLAKSRFLAAASHDLRQPSHALSLLVGALRGTKTDAERAQILVQIERSTDAL
FT                   DSLFGALLDVSRLDAGVVDVHRRPVHVDAVLEHACTDHMLDAAAKNLTLTRVPCRAIVD
FT                   TDPVLLERIVRNLVSNAVRYTDAGRIVVGCRRRGARVAIQVWDTGRGIAADQLELVFQE
FT                   YYQVGNPERDRANGLGLGLAIVRRLADLLECELKVRSAPGRGSCFEVWVSRCDHAAAQA
FT                   DASAEPADDVSHHSGLVVVVDDELAIRDGMARLLELWGYETIVSDSGDAAIERLSACAR
FT                   RPDLLVCDFRLRGAENGLTVIERLRSEYNDDIPALLISGDTAADRLAEAHASHCLLLHK
FT                   PIPNGKLRAAIGNLIAAGVRARSGEPE"
FT                   /protein_id="YP_001115814.1"
FT   misc_feature    50972..51163
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    order(50990..50992,51002..51004,51014..51016,51023..51025,
FT                   51035..51037,51044..51046,51092..51094,51104..51106,
FT                   51113..51115,51125..51127,51134..51136,51146..51148)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    51008..51010
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    51320..51628
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    order(51338..51340,51350..51352,51359..51361,51425..51427,
FT                   51431..51433,51437..51439,51443..51448,51527..51538,
FT                   51584..51586,51590..51592,51605..51610,51614..51616)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    51350..51352
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    order(51437..51439,51443..51445,51527..51529,51533..51535)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    51710..52057
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    order(51719..51724,51857..51859,51884..51886,51947..51949,
FT                   51995..51997,52010..52015)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    51857..51859
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    order(51866..51871,51878..51886)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3360"
FT   misc_feature    52010..52018
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3360"
FT   gene            complement(52143..52322)
FT                   /db_xref="GeneID:4949573"
FT                   /locus_tag="Bcep1808_3361"
FT                   /pseudo
FT   gene            52716..53357
FT                   /db_xref="GeneID:4949574"
FT                   /locus_tag="Bcep1808_3362"
FT   CDS_pept        52716..53357
FT                   /locus_tag="Bcep1808_3362"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component LuxR family transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: bur:Bcep18194_C7667 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="GI:134292079"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:4949574"
FT                   /translation="MKILIVDDHPILRDGVAALLRQNGEDVTVAQAGNADDAMRMLDQS
FT                   ADFDAIVLDLKLPGMNGLDAISAFAGKCPQLQIIVLSTSEDAADVRAAFARGALGYVPK
FT                   SAGPHTVLSAIRMVLDGERYVPPLMLDDSSSAAPGSPRPAPATRSAGPLTQRQIEVLRY
FT                   VAEGVPNKVIADRLNLSEKTVKAHVTAIFKALNVLNRTQAAAAARKAGLL"
FT                   /protein_id="YP_001115815.1"
FT   misc_feature    52716..53354
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    52725..53072
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    order(52734..52739,52875..52877,52899..52901,52959..52961,
FT                   53016..53018,53025..53030)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    52875..52877
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    order(52884..52889,52893..52901)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    53025..53033
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    53172..53321
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    order(53175..53183,53220..53228,53250..53255,53259..53264,
FT                   53268..53282,53313..53315)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_3362"
FT   misc_feature    order(53208..53210,53214..53216,53220..53222,53313..53321)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Bcep1808_3362"
FT   gene            complement(53618..54907)
FT                   /db_xref="GeneID:4949575"
FT                   /locus_tag="Bcep1808_3363"
FT   CDS_pept        complement(53618..54907)
FT                   /locus_tag="Bcep1808_3363"
FT                   /gene_family="HOG000227233" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_B0792 hypothetical protein"
FT                   /db_xref="GI:134292080"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="GeneID:4949575"
FT                   /translation="MNRSLRIVSAALAALACSAGHAPVPVHAATLTYTAPSHAFRPFHA
FT                   SRVRPAASVTLPAVIVKPAVDGSDQADALQTALNALQAGQTLILSPGRYTVSRSLSVAM
FT                   SGVVVSGYGATLAATNPADQTIVMSGADSTLVGVTLIGAGTTRLATPASTKVEVTGTGV
FT                   QVLGVTVQGGASAGIFVFGGRNVAIVGNTVRATLADGIHMTDGAANVLVQGNTVTGTGD
FT                   DLIAVVSYLSDGRVSNNVLIDHNTVSGNYWGRGIAVVGGQAVTISNNTVDGVQKAAGIL
FT                   VAQEDSWRTYGVSNVVVDNNVVSNVQNANVDNGLLPTQQGALELDTWSGTVSYVVVTRN
FT                   RVTGSGYTGFRALGNVCAFEAANNAFASIAQAPVSLLSRGCPASRIVVAGNTLDGVALV
FT                   APVGASPSGTIQATGAATATMPQVRTNLMR"
FT                   /protein_id="YP_001115816.1"
FT   sig_peptide     complement(54821..54907)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT                   /locus_tag="Bcep1808_3363"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(<54059..54688)
FT                   /note="parallel beta-helix repeat-containing protein;
FT                   Region: beta_helix_1; TIGR03805"
FT                   /db_xref="CDD:163517"
FT                   /locus_tag="Bcep1808_3363"
FT   misc_feature    complement(<54080..54355)
FT                   /note="Pectate lyase; Region: Pec_lyase_C; cl01593"
FT                   /db_xref="CDD:154492"
FT                   /locus_tag="Bcep1808_3363"
FT   gene            complement(55438..56322)
FT                   /db_xref="GeneID:4949576"
FT                   /locus_tag="Bcep1808_3364"
FT   CDS_pept        complement(55438..56322)
FT                   /locus_tag="Bcep1808_3364"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bam:Bamb_4417 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:134292081"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4949576"
FT                   /translation="MQGRKGANTLARSLDIDLLRSFVVIAEVRSLSRAAARVGRTQSAL
FT                   SQQMRRLEESVDQPLFQRTGRGVVLTHPGERLLLHAQRILRQHDEALADLCGTGLSGTI
FT                   RFGCPDDYAQVWLPSLLRQFSSHHPHAIVEVVCGPTPRLLEQLDKRAVDLAMISVPDEG
FT                   ATDDFIRREQLVWIGYPGLDTAQFERLPLALSDPDTLDHIAACDALARAGRDYRVAYAS
FT                   SSLAGLIALVRSGQAIAVMTQTAVPADLAIFAADRGLPPLPAVGITLRFDRKRPSHLTA
FT                   VFAEHIRSVLPLL"
FT                   /protein_id="YP_001115817.1"
FT   misc_feature    complement(55450..56283)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bcep1808_3364"
FT   misc_feature    complement(56098..56277)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bcep1808_3364"
FT   misc_feature    complement(55462..56016)
FT                   /note="The C-terminal substrate domain of LysR-like
FT                   regulator LrhA (LysR homologue A) and that of closely
FT                   related homologs, contains the type 2 periplasmic binding
FT                   fold; Region: PBP2_LrhA_like; cd08439"
FT                   /db_xref="CDD:176130"
FT                   /locus_tag="Bcep1808_3364"
FT   misc_feature    complement(order(55621..55626,55630..55635,55651..55668,
FT                   55912..55932,55936..55938,55948..55950,55957..55962,
FT                   55966..55971))
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176130"
FT                   /locus_tag="Bcep1808_3364"
FT   gene            56399..57700
FT                   /db_xref="GeneID:4949577"
FT                   /locus_tag="Bcep1808_3365"
FT   CDS_pept        56399..57700
FT                   /locus_tag="Bcep1808_3365"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bam:Bamb_4418 aminotransferase class-III"
FT                   /db_xref="GI:134292082"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:4949577"
FT                   /translation="MSANDDATFWHNATHHLIRYGGTFEPLIVERARGSFVYDADGRAI
FT                   LDFTSGQMSAVLGHCHPDIVAVIAEYAGKLDHLFSGMLSRPVVELATRLADLTPPGLDR
FT                   ALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRRGVGPAAVG
FT                   SFAIPAPFAYRPRFERNGAYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELP
FT                   DGYMAALKRKCDERGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLA
FT                   AVVTSAQIEERAHALGYLFYTTHVSDPLPAAVGLRVLDVVQRDGLVQRANLMGERLRRG
FT                   LLDLMERFECIGDVRGRGLLLGVEIVKDRRTKEPADGLGAKITRECMKLGLSMNIVQLP
FT                   GMGGVFRIAPPLTVSEAEIDLGLSLLEQAIARAL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001115818.1"
FT   misc_feature    56441..57685
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase...; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_3365"
FT   misc_feature    56456..57697
FT                   /note="4-aminobutyrate aminotransferase and related
FT                   aminotransferases [Amino acid transport and metabolism];
FT                   Region: GabT; COG0160"
FT                   /db_xref="CDD:30509"
FT                   /locus_tag="Bcep1808_3365"
FT   misc_feature    order(56726..56734,56810..56815,56819..56821,57026..57028,
FT                   57125..57127,57131..57136,57212..57214)
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_3365"
FT   misc_feature    order(56729..56734,56810..56815,57026..57028,57125..57127,
FT                   57134..57136,57212..57214)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_3365"
FT   misc_feature    57212..57214
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Bcep1808_3365"
FT   gene            57786..58649
FT                   /db_xref="GeneID:4949578"
FT                   /locus_tag="Bcep1808_3366"
FT   CDS_pept        57786..58649
FT                   /locus_tag="Bcep1808_3366"
FT                   /gene_family="HOG000182100" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: bam:Bamb_4421 transcriptional regulator, AraC family"
FT                   /db_xref="GI:134292083"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="GeneID:4949578"
FT                   /translation="MGRAADDGGTHEHWLVARRDPETGIESLRAHFSGHAYDPHDHDDM
FT                   LIGFTEQGVQRFQCHRSLHTSVPGRAILIEPGATHDGHAPEAGGFTYSMLYLPQAWVER
FT                   AARRIDLPGLSGVEAAFGHTLVDDRALVEAIRDAFVALHGNEGKLARDQTLDRLLTRLG
FT                   GQLRASSPTGVGGRDVPPAIARVRELLHMRMDGNPGLDELAELAGVDRFRLTRLFQRAY
FT                   GTSPHAYLVRLRLRAARRLLAAGRTPAQAAADVGFADQSHLGRWFRRAYRMTPAAYRRI
FT                   CTNVPD"
FT                   /protein_id="YP_001115819.1"
FT   misc_feature    57855..58223
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Bcep1808_3366"
FT   misc_feature    58314..58625
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Bcep1808_3366"
FT   gene            58694..59101
FT                   /db_xref="GeneID:4949579"
FT                   /locus_tag="Bcep1808_3367"
FT   CDS_pept        58694..59101
FT                   /locus_tag="Bcep1808_3367"
FT                   /gene_family="HOG000217293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bam:Bamb_4422 hypothetical protein"
FT                   /db_xref="GI:134292084"
FT                   /db_xref="GeneID:4949579"
FT                   /translation="MFDTKVALIVRDDLAAWQKLNVVAFLATGVAAGAPDALGEPYEDA
FT                   AGNRYGRMLGQPMLVFAADLNGLQAAHRQALSRELRIVPYVRAMFSTGHDAANRDAFRA
FT                   EDAANLDLVGLALHGPKKAVDKAVKGLSLHA"
FT                   /protein_id="YP_001115820.1"
FT   misc_feature    58700..59098
FT                   /note="Protein of unknown function (DUF2000); Region:
FT                   DUF2000; cl02074"
FT                   /db_xref="CDD:121069"
FT                   /locus_tag="Bcep1808_3367"
FT   gene            complement(59133..59483)
FT                   /db_xref="GeneID:4949580"
FT                   /locus_tag="Bcep1808_3368"
FT   CDS_pept        complement(59133..59483)
FT                   /locus_tag="Bcep1808_3368"
FT                   /gene_family="HOG000232019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B0660
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="GI:134292085"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:4949580"
FT                   /translation="MKVKRIVANVDTQSVDDAKRFYQQIFGLDLLMDLGWIATYGSAER
FT                   MRVQISFASQGGSGTPTPDLSIEVDDLDEALARIQAAGIAVEYGPADEPWGVRRFFVRD
FT                   PFGKLVNVLVHR"
FT                   /protein_id="YP_001115821.1"
FT   misc_feature    complement(59136..59471)
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_5; cd07238"
FT                   /db_xref="CDD:176662"
FT                   /locus_tag="Bcep1808_3368"
FT   misc_feature    complement(order(59166..59168,59199..59201,59274..59300,
FT                   59313..59339,59358..59381,59400..59402,59406..59408,
FT                   59418..59420,59430..59432,59439..59441,59445..59471))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176662"
FT                   /locus_tag="Bcep1808_3368"
FT   gene            complement(59575..60276)
FT                   /db_xref="GeneID:4949581"
FT                   /locus_tag="Bcep1808_3369"
FT   CDS_pept        complement(59575..60276)
FT                   /locus_tag="Bcep1808_3369"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5015 ABC transporter related"
FT                   /db_xref="GI:134292086"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4949581"
FT                   /translation="MLKLERVHTHYGAVEALAGVSIEVNKGEIVTLIGSNGAGKTTLMM
FT                   TVCGTPRASSGRVLFEGNDITAMSTHQIMRQGMAISPEGRRVFPSLTVLENLKMGGFFA
FT                   SRHEIDDGIEHVFKLFPRLKERAAQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPTLG
FT                   LAPLVIAQIFDIIRTIRDEGVTVFLVEQNANKALGVADRGYVLETGRVVLADTGANLLA
FT                   NDRIKQAYLGG"
FT                   /protein_id="YP_001115822.1"
FT   misc_feature    complement(59578..60276)
FT                   /note="leucine/isoleucine/valine transporter ATP-binding
FT                   subunit; Provisional; Region: livF; PRK11614"
FT                   /db_xref="CDD:171201"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(59608..60273)
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(60154..60177)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(order(59704..59706,59800..59805,60028..60030,
FT                   60151..60159,60163..60168))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(60028..60039)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(59848..59877)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(59800..59817)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(59782..59793)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   misc_feature    complement(59698..59718)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Bcep1808_3369"
FT   gene            complement(60276..61049)
FT                   /db_xref="GeneID:4949582"
FT                   /locus_tag="Bcep1808_3370"