(data stored in ACNUC8465 zone)

HOGENOMDNA: BURXL_3

ID   BURXL_3; SV 1; empty ; DNA; empty ; PRO; 1471779 BP.
XX
AC   NC_007953;
XX
PR   Project: 57823;
XX
DE   Burkholderia xenovorans LB400 chromosome 3, complete genome.
XX
OS   Burkholderia xenovorans LB400
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-1471779
RX   PUBMED; 17030797.
RA   Chain,P.S., Denef,V.J., Konstantinidis,K.T., Vergez,L.M., Agullo,L.,
RA   Reyes,V.L., Hauser,L., Cordova,M., Gomez,L., Gonzalez,M., Land,M., Lao,V.,
RA   Larimer,F., LiPuma,J.J., Mahenthiralingam,E., Malfatti,S.A., Marx,C.J.,
RA   Parnell,J.J., Ramette,A., Richardson,P., Seeger,M., Smith,D., Spilker,T.,
RA   Sul,W.J., Tsoi,T.V., Ulrich,L.E., Zhulin,I.B. and Tiedje,J.M.;
RT   "Burkholderia xenovorans LB400 harbors a multi-replicon, 9.73-Mbp genome
RT   shaped for versatility";
RL   Proc. Natl. Acad. Sci. U.S.A. 103 (42), 15280-15287 (2006)
XX
RN   [2]
RP   1-1471779
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (11-APR-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1471779
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Kyrpides,N., Lykidis,A. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (13-MAR-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000272.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351477
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: Jim Tiedje (tiedjej@pilot.msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1471779
FT                   /strain="LB400"
FT                   /mol_type="genomic DNA"
FT                   /organism="Burkholderia xenovorans LB400"
FT                   /chromosome="3"
FT                   /db_xref="taxon:266265"
FT   gene            477..1370
FT                   /db_xref="GeneID:4009808"
FT                   /locus_tag="Bxe_C0001"
FT   CDS_pept        477..1370
FT                   /locus_tag="Bxe_C0001"
FT                   /gene_family="HOG000262203" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780072"
FT                   /db_xref="GeneID:4009808"
FT                   /translation="MSCIAGLFGSAAQRSAGSAWLLFAGCGVLQVALSYLFCTPLERFW
FT                   PLLRWPVRQPMATDIVYTFIVRIVLFPLAAYFEYGLVKALVERWLLAHQWPVPSLLTRI
FT                   ADVAGTPLAGFLIGFVILDCADYWRHRISHRLGWWYGLHTLHHAELQMTFWSDDRSHLL
FT                   EDIITYVWLFVVAIAIGMPALQFPFVILGFRFVGSFAHANTRARYGWLGERLLISPQFH
FT                   RAHHCPEIARRKSCNFGTVLPWWDMLFGTANFTHDARETGDPTADQIIATGNWWQQHVG
FT                   GVRRMIQLARRRRPAH"
FT                   /protein_id="YP_555279.1"
FT   misc_feature    504..1310
FT                   /note="Fatty acid hydroxylase superfamily; Region:
FT                   FA_hydroxylase; cl01132"
FT                   /db_xref="CDD:174545"
FT                   /locus_tag="Bxe_C0001"
FT   gene            1472..2221
FT                   /db_xref="GeneID:4009809"
FT                   /locus_tag="Bxe_C0002"
FT   CDS_pept        1472..2221
FT                   /locus_tag="Bxe_C0002"
FT                   /gene_family="HOG000121700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780073"
FT                   /db_xref="GeneID:4009809"
FT                   /translation="MAISPEAEKSKVISTPWTARILNVEASNSADLPAGWRDAYRSYRE
FT                   TLDRPDYPCFFGQAAERRGEMFYAFDGERPDVARMTMRRFVELGRDAALARHSLAMFCT
FT                   PDPALVSHAEFLRRFWYILRQLHEADDMPMRPADPDDPLWEFSFGGRKMFVVGTGPTYR
FT                   RRRSRVVGNGIVLLFQPRELFTDPTTGKPISAEVRRQIHARMLAYDAMPVHPDIGFYGD
FT                   PRNREWKQYCLPDDNTPVTGRCPFASR"
FT                   /protein_id="YP_555280.1"
FT   misc_feature    1580..2218
FT                   /note="YqcI/YcgG family; Region: YqcI_YcgG; cl01349"
FT                   /db_xref="CDD:154347"
FT                   /locus_tag="Bxe_C0002"
FT   gene            complement(2190..2561)
FT                   /db_xref="GeneID:4009810"
FT                   /locus_tag="Bxe_C0003"
FT   CDS_pept        complement(2190..2561)
FT                   /locus_tag="Bxe_C0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780074"
FT                   /db_xref="GeneID:4009810"
FT                   /translation="MAISIFIGPPIRPTVPPASRREQGAWQAHPGGHGIRLQVGTVDEI
FT                   RLFRSGSGHLGPGCFSYGKQARNFWLIPIPWLPKATPAAIGAKAAFAFPLPRTFERPFC
FT                   QEKAILRHAISGWRTGNAR"
FT                   /protein_id="YP_555281.1"
FT   gene            2708..6364
FT                   /db_xref="GeneID:4009811"
FT                   /locus_tag="Bxe_C0004"
FT   CDS_pept        2708..6364
FT                   /locus_tag="Bxe_C0004"
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780075"
FT                   /db_xref="GeneID:4009811"
FT                   /translation="MEARQNTNHREQVTSDKRWQFWVDRGGTFTDIVARKPDGQLVTHK
FT                   LLSENPGRYKDAVVQGIRDLLGLGDDEALPQERIEVVKMGTTVATNALLERKGARTLLA
FT                   ITRGFADQLRIGYQDRPDIFARHIELPTQMYERVVELDERIDAHGDVLTPLDEAAAGAA
FT                   LQEACKAGVTSIAIVLMHGYRYPQHELRVAELAREAGFTQISVSHQVSPLMKLVGRGDT
FT                   TVVDAYLSPVLRDYVDRVSQHTGNVPLMFMQSSGGLAEAARFRGKDAILSGPAGGIVGA
FT                   VKTCEAVGERKVIGFDMGGTSTDVAHYDGAYERIFETQVAGVRVRAPMMDIHTVAAGGG
FT                   SICSFENGRFKVGPESAGAYPGPACYRNGGPLTVTDCNVMLGRVQAEHFPYVFGPNGDQ
FT                   PLDADVVCRKFTELALQVRRETGREMSAEAVAEGFLTVAVDNMAQAIKTISVERGHDVS
FT                   GYAICAFGGAGGQHACAVAEALGMRRILLHPFAGVLSAFGMGLADLRVLRERAVEAPLD
FT                   AVSVASLAQPYDALEQDALGEILAQRIPRERAHVTRAARLKYQNTDSTLEVPFGDACVM
FT                   RDAFETLHRKRYGFVMANKSLIVESIVVEAVGLTESPTLQRAAPRVANTAPADAQVTMF
FT                   VGGRAKRVPLQVRRELAMGSRIDGPALITEEISTIVLQPGWSATVLEDGTLRLDRLADT
FT                   ATDAAQRAAQAITTARHPVHLEIFNNVFMSIAQQMGVTLEKTSYSVNMKERLDFSCAIF
FT                   DPAGGLIANAPHIPVHLGSMSDSVLSVIREHGATMQRGDVYMLNVPYNGGTHLPDITVV
FT                   MPVYGDDGALLFYVAARGHHGDVGGITPGSMPPNSTSIEEEGVLLDNVKIVEAGTFLEM
FT                   PVRALFSAGEYPSRNVDQNIADLTAQIAACECGATELLRTVSRYGADVVLAYMGHVQDN
FT                   AEEAVRAAIAALGDGEFAYEMDDGAVIRVKVSIDHARRQARVDFTGTSEQRVTNFNAPR
FT                   SVCKAAVLYVFRTLLTDGIPMNEGVLRPIDIVIPHGSMLNPVYPAAVVAGNVEVSQSIT
FT                   DALYGALKVMAGSQGTMNNFTFGDEAQQYYETIAGGSGAGRTHPGTSAVQTHMTNSRMT
FT                   DPEVIEWRFPVIVEEHAIRAGSGGSGRQPGGDGAVRRIRFRQTMTANILANRRRVAPFG
FT                   LAGGENGQVGRNWIVRANGNVELFGATHTTTVQPGDVFVIETPGGGGYGRVE"
FT                   /protein_id="YP_555282.1"
FT   misc_feature    2753..6352
FT                   /note="5-oxoprolinase; Region: PLN02666"
FT                   /db_xref="CDD:166307"
FT                   /locus_tag="Bxe_C0004"
FT   misc_feature    2768..3307
FT                   /note="Hydantoinase/oxoprolinase N-terminal region; Region:
FT                   Hydant_A_N; pfam05378"
FT                   /db_xref="CDD:147519"
FT                   /locus_tag="Bxe_C0004"
FT   misc_feature    3362..4222
FT                   /note="Hydantoinase/oxoprolinase; Region: Hydantoinase_A;
FT                   cl00668"
FT                   /db_xref="CDD:163895"
FT                   /locus_tag="Bxe_C0004"
FT   misc_feature    4841..6352
FT                   /note="N-methylhydantoinase B/acetone carboxylase, alpha
FT                   subunit [Amino acid transport and metabolism / Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: HyuB; COG0146"
FT                   /db_xref="CDD:30495"
FT                   /locus_tag="Bxe_C0004"
FT   gene            6440..7225
FT                   /db_xref="GeneID:4009812"
FT                   /locus_tag="Bxe_C0005"
FT   CDS_pept        6440..7225
FT                   /locus_tag="Bxe_C0005"
FT                   /gene_family="HOG000167539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780076"
FT                   /db_xref="GeneID:4009812"
FT                   /translation="MQSAVNLYPLFGVVVIVAGFLLRFNPMLIVTVAAIITGLAAHFPV
FT                   DRILIAIGSGFVKTRVIPLIILFPLAVIGLLERHGLRERAQTWIGGIRAATPGRLLIAY
FT                   LFVREITAALGLTGLGGHPQMVRPLVAPMAEGAALARFGKLRDPARFRLRAFAAATDNV
FT                   GLFFGEDIFVAFGAIVLMVTFLKETGIVVEPMRVALWGMPTALAAFLVHSFRLYRLDGW
FT                   LGRHAAADEDAASANEPSVDAPGNPRRDGVVGAGQGEQA"
FT                   /protein_id="YP_555283.1"
FT   misc_feature    6458..7114
FT                   /note="Protein of unknown function (DUF969); Region:
FT                   DUF969; cl01573"
FT                   /db_xref="CDD:154480"
FT                   /locus_tag="Bxe_C0005"
FT   gene            7222..8178
FT                   /db_xref="GeneID:4009813"
FT                   /locus_tag="Bxe_C0006"
FT   CDS_pept        7222..8178
FT                   /locus_tag="Bxe_C0006"
FT                   /gene_family="HOG000167650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780077"
FT                   /db_xref="GeneID:4009813"
FT                   /translation="MILSLNVLFWLLGILLVVIGGLIVGDRAHPKRFFAGGFWIVYGLI
FT                   FLVGDRLPADVVGVLVVAMALVAGFGGVVGARPRLRSDDERRASAQRLGNQLFLPALTI
FT                   PFVTVIGTLLTPHLVFGGIALIDPKNATLVSFGVGCVVALVLACRLTRDTLGQAVKEAR
FT                   RLVDSLSWAVVLPQMLGMLGLVFADAGVGKAVAHLTTSYIDLDYRFVAVVVYCAGMALF
FT                   TIIMGNGFAAFPVMTGGVGVPVLIGVFHGNPAPMVAIGMFSGYCGTLLTPMAANYNIVP
FT                   AALLELPDKYGVIRAQVPTALVLLVINIFLLNTLMYI"
FT                   /protein_id="YP_555284.1"
FT   misc_feature    7234..8124
FT                   /note="Protein of unknown function (DUF979); Region:
FT                   DUF979; cl01572"
FT                   /db_xref="CDD:154479"
FT                   /locus_tag="Bxe_C0006"
FT   gene            8232..9206
FT                   /db_xref="GeneID:4009516"
FT                   /locus_tag="Bxe_C0007"
FT   CDS_pept        8232..9206
FT                   /locus_tag="Bxe_C0007"
FT                   /gene_family="HOG000135913" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780078"
FT                   /db_xref="GeneID:4009516"
FT                   /translation="MSAFWPFRLTTGCNVNLKFLETFIWVAKLRSFSLAADKLHSTQAA
FT                   ISSRISVLEQELGAKLFTREPKGVALTRAGERVLQHAEQVNESMTRLYASLQDEKFAFG
FT                   TIRIGAMDSAIHSWFVNFVSDVMHYYPNLDIEVTSETALNLNEQLRRGMLDMVIQTDML
FT                   RDETIRSIEVLELSMGWVAAANSPIVSQEAYDTPTAALRGLGRERLITYSRHSRPHQDL
FT                   LRLMQSYGIGESRVSCVNSVAAMIQLTQAGFGVAAMPPALVPELLNSGVLRQLEGLEAP
FT                   PPLPFVIAWRSGTNWTERLVEVAVETVSKYAARLGQDAARLVV"
FT                   /protein_id="YP_555285.1"
FT   misc_feature    8277..9116
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Bxe_C0007"
FT   misc_feature    8280..8459
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bxe_C0007"
FT   misc_feature    8544..9110
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bxe_C0007"
FT   misc_feature    order(8589..8594,8598..8603,8610..8612,8622..8624,
FT                   8628..8648,8940..8945,8946..8954,8970..8975,8979..8984)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Bxe_C0007"
FT   gene            9459..10556
FT                   /db_xref="GeneID:4009517"
FT                   /locus_tag="Bxe_C0008"
FT   CDS_pept        9459..10556
FT                   /locus_tag="Bxe_C0008"
FT                   /gene_family="HOG000114654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OmpC family outer membrane porin"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780079"
FT                   /db_xref="GeneID:4009517"
FT                   /translation="MKKLIFGASVALMCSGAYAQSSVTLYGLIDEAIRFQTSGSGNTLG
FT                   MNEGAINGNRFGLKGKEDLGGGSYAIFQLESGFNVANGKFDQQSQLFGRFAWVGLQNDT
FT                   YGTLKAGRQYGGIYNFYAFNFDPIGGGNINATDWSLFLTGIRFDNTVEYDNRFGPVALQ
FT                   VQHSFGGQAGSASSGSTTTASLIYNFNGGKVGVDGAESKDGTGHKLLVGSAGGTYAWGP
FT                   VGLYLYGINARRDAGFSVAATNSGLPLSNTNLISNATTAFGPQTKARDDMFVRAGVTYQ
FT                   AAPQWKLTASYAYDHANNVAPGQNGTIQTVYGIVDYLLSKRTDVYLEVDHSHLAGASID
FT                   DPNGPLTFGGKANNFGAGLSLRTLF"
FT                   /protein_id="YP_555286.1"
FT   misc_feature    9519..10553
FT                   /note="Porins form aqueous channels for the diffusion of
FT                   small hydrophillic molecules across the outer membrane.
FT                   Individual 16-strand anti-parallel beta-barrels form a
FT                   central pore, and trimerizes thru mainly hydrophobic
FT                   interactions at the interface...; Region: gram_neg_porins;
FT                   cd00342"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bxe_C0008"
FT   misc_feature    order(9519..9521,9525..9527,9543..9545,9549..9557,
FT                   9636..9650,9666..9668,9672..9680,9684..9686,9690..9701,
FT                   9735..9740,9744..9758,9786..9794,9894..9896,9900..9905,
FT                   10413..10418,10425..10427,10539..10541,10545..10547,
FT                   10551..10553)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bxe_C0008"
FT   misc_feature    order(9540..9542,9621..9623,9738..9740,9828..9830,
FT                   9894..9896)
FT                   /note="eyelet of channel; other site"
FT                   /db_xref="CDD:30071"
FT                   /locus_tag="Bxe_C0008"
FT   gene            10717..12252
FT                   /db_xref="GeneID:4009518"
FT                   /locus_tag="Bxe_C0009"
FT   CDS_pept        10717..12252
FT                   /locus_tag="Bxe_C0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780080"
FT                   /db_xref="GeneID:4009518"
FT                   /translation="MSQLPASLPDSISGLAPTVATAHAASARTLRTSNTARLWLAVRTA
FT                   LAPSTRMSGRRIRGLIEDLRMASTRIGVEAARLGQCIATTSGLVREQRELANAAETRSV
FT                   TVAQAVAGARRHVDTVCHETANNLLVIQDVHRDLTGVSTLNHTTSERLGDVVQGIGTLQ
FT                   RRTTRIRDVVQLIEGVSAQTKLLAINASIEAARAGVAGRGFAVVAAEVKLLAQRVQDAN
FT                   RSISDIAKQTMTDIDVLRGQIEHVHTDSGNCTQVIERSVRHFVEVVKALESTDHNMALV
FT                   GRAFEEIYHANIALSSQIRDINLRSAGVVDAMTTAQTSSGVLRDETENLHGIGSTLPVR
FT                   GSAHDSLLADVEAFRDRVQRYLDDAARSGLDVFDQCYREVPGTSPQKYTTSYDEAVEAE
FT                   LQRLFDAMLEARPELIFAVAYDSNCYMAAHHRRFSAPLTGDPQTDLRASRHKRIFADDT
FT                   GKRSATFRGHHLLQTYLRDTGEVACVFSMPITIGGRHWGCVRVAFEPQLLLDA"
FT                   /protein_id="YP_555287.1"
FT   misc_feature    10960..11706
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Bxe_C0009"
FT   misc_feature    11176..11715
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Bxe_C0009"
FT   misc_feature    <11749..>12183
FT                   /note="oligoendopeptidase, pepF/M3 family; Region:
FT                   M3_fam_3; TIGR02290"
FT                   /db_xref="CDD:162797"
FT                   /locus_tag="Bxe_C0009"
FT   gene            complement(12370..13275)
FT                   /db_xref="GeneID:4009519"
FT                   /locus_tag="Bxe_C0010"
FT   CDS_pept        complement(12370..13275)
FT                   /locus_tag="Bxe_C0010"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780081"
FT                   /db_xref="GeneID:4009519"
FT                   /translation="MKRILPPLNALRAFEAAGRLGSFKEAAAELHVTHGAVSQHVRLLE
FT                   EWLGASLFDRYNRRVTLTPAAKVYLEEIGPLFERLSQATARYGVAETVSRTLSVNAPAT
FT                   FTLRWLVPRLAKFRAAHPDVDVNVETSNRPLESLKEDYDIVIRGGPDTFYGYSMRPFLS
FT                   EERLPVCSPALLQRVPLRSPGDLQQHTLLHTSSLPRLWPDWLASAQIPALRPAATLTFD
FT                   HFYLTLQAAIDGIGIAMGPTALVSADLAAGRLAAPFAGPRLPSRSYCTYVPDAKFGDER
FT                   VMLFRSWLEREGTCRRFADS"
FT                   /protein_id="YP_555288.1"
FT   misc_feature    complement(12400..13269)
FT                   /note="DNA-binding transcriptional activator GcvA;
FT                   Provisional; Region: PRK11139"
FT                   /db_xref="CDD:170976"
FT                   /locus_tag="Bxe_C0010"
FT   misc_feature    complement(13075..13254)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Bxe_C0010"
FT   misc_feature    complement(12409..12990)
FT                   /note="HvR and beta-lactamase regulators, and that of other
FT                   closely related homologs; contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
FT                   cd08432"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bxe_C0010"
FT   misc_feature    complement(order(12886..12906,12910..12963,12967..12990))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bxe_C0010"
FT   misc_feature    complement(order(12544..12546,12604..12612,12961..12963,
FT                   12967..12972))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176123"
FT                   /locus_tag="Bxe_C0010"
FT   gene            13396..14238
FT                   /db_xref="GeneID:4009520"
FT                   /locus_tag="Bxe_C0011"
FT   CDS_pept        13396..14238
FT                   /locus_tag="Bxe_C0011"
FT                   /gene_family="HOG000185787" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780082"
FT                   /db_xref="GeneID:4009520"
FT                   /translation="MLSYTGGTVLFAALLHASWNAMLHGNRDRFLSMTWMSIAIAVVAT
FT                   LVVLSTPWPASAAWPCIVASGLVHILYNVSLVRSYRRNNLAQAYPIARGSSPLLVTLGA
FT                   ALFAHEAIGPLHALGIAMISGGIIAIALQGRRVSRAGALTALTTGATIALYTVIDGIGV
FT                   RLSNGQPLTYTAWMFLFYWLMPVLFVAVRGLAPLWTPVRAEPLSVGSSLVGGLVSIAAY
FT                   GIVIWALQSGAMGAVSALRETSVVFAVLIGRVFLREAVSGTRWLACMVVAAGAVCLGL"
FT                   /protein_id="YP_555289.1"
FT   misc_feature    13420..14229
FT                   /note="phosphonate utilization associated putative membrane
FT                   protein; Region: phn_DUF6; TIGR03340"
FT                   /db_xref="CDD:163219"
FT                   /locus_tag="Bxe_C0011"
FT   misc_feature    <14077..14235
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Bxe_C0011"
FT   gene            14332..15093
FT                   /db_xref="GeneID:4009521"
FT                   /locus_tag="Bxe_C0012"
FT   CDS_pept        14332..15093
FT                   /locus_tag="Bxe_C0012"
FT                   /codon_start="1"
FT                   /product="putative short-chain dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780083"
FT                   /db_xref="GeneID:4009521"
FT                   /translation="MDTVSQAPLILITGGGRGIGAATARLAAAQGYDVAISFVSNESAA
FT                   LAVAADVEAVGRRALPMRADSADPEQVAQLFAALDRQFGRLDVLVNNAAIIAQQSRLED
FT                   LGFERLQRIFAVNSIGPILCAQQAVKRMSRRHNGRGGAVINISSASAQLGSPNEYVDYA
FT                   ASKGALETFTTGFAKEVARDGIRVNCIRAGHIYTDMHASGGEPGRVDRVKDSIPMGRGG
FT                   QPEEVARAILWLAGAEASFITGTFLDVTGGK"
FT                   /protein_id="YP_555290.1"
FT   misc_feature    14419..15090
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Bxe_C0012"
FT   misc_feature    14419..15087
FT                   /note="3-oxoacyl-(acyl-carrier-protein) reductase; Region:
FT                   3oxo_ACP_reduc; TIGR01830"
FT                   /db_xref="CDD:162551"
FT                   /locus_tag="Bxe_C0012"
FT   gene            15595..17154
FT                   /db_xref="GeneID:4009522"
FT                   /locus_tag="Bxe_C0013"
FT   CDS_pept        15595..17154
FT                   /locus_tag="Bxe_C0013"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative monooxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780084"
FT                   /db_xref="GeneID:4009522"
FT                   /translation="MHSHHQHIYDVVIAGAGPVGLFLACELRLLDLSVLVLERAEDPHS
FT                   PLKRLPFGMRGLSAATLEAFYRRGLLVELIAAQRANDGAGKTGAAAHWMHQPRRPAGHF
FT                   AGIQFYHDDIDSSKWPYRLPSPADTSMAVELETLETVLARRASAMGAEIRRGFSVDDFL
FT                   ASDADVTVRAGGETFRGRWLVGCDGGRSTIRNAGGFEFFGTDPEFTGYSAEVEMADPQA
FT                   LRAGRHYTPTGTYTYTRPGTIAMVEFDGGAFHRIQPITLEHVQAVLRRVSGIDLTLTGL
FT                   HLATTWTDRACQATAYRKGRVLLAGDAAHIHSPLGGQGLNLGLGDALNLGWKLASTIRG
FT                   DAPAGLLDSYQVERHPVGAQVLDWSRAQVALMRPTQSTRALEAIVRDLIQTRDGATYFA
FT                   GRVWGISLRYELGGSHPLAGRSVPDFEFADGTNCGNLLREGKGLLLDFDTNASLQSLAN
FT                   HWRDRVTYAAGEVRDRLGLRAVLVRPDGFVAWASEATPDNEEAAQIISRWFGEPEDRVG
FT                   SA"
FT                   /protein_id="YP_555291.1"
FT   misc_feature    15625..17139
FT                   /note="hypothetical protein; Provisional; Region: PRK06834"
FT                   /db_xref="CDD:168694"
FT                   /locus_tag="Bxe_C0013"
FT   gene            complement(17213..17641)
FT                   /db_xref="GeneID:4009523"
FT                   /locus_tag="Bxe_C0014"
FT                   /pseudo
FT   gene            17726..20269
FT                   /db_xref="GeneID:4009524"
FT                   /locus_tag="Bxe_C0015"
FT   CDS_pept        17726..20269
FT                   /locus_tag="Bxe_C0015"
FT                   /gene_family="HOG000136246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780085"
FT                   /db_xref="GeneID:4009524"
FT                   /translation="MAQAQIAGTLVQVLAQIPDAVVLVDEDGAIGFFNPAAEALWGLTA
FT                   AAVLGADAGMLLPRGIQPAGHGVQTGNVDGPGLALQIERNDGVMRRGQMSIHGFEVAGR
FT                   RFRAAFIRDITDQHRQCEEWQQLLRVVNGSDNAIIVASLDGSISFINSGVTRMLGYAAA
FT                   EVQGLRLVEPFAGVHTNMAAVERIQSAAREPSTPDHPFRQDLLVYTKGGRPLWVNVGIT
FT                   VITDNAGAPVNLLAVLTDITLTRMREELQQKVLDAMARELPATEVAGILCREVERIAPE
FT                   VVATFLRVDDGRLFTLAAPRLPVTVTRAMDGESIGPCAGSCGTAAWRGTPVVVTDIASD
FT                   PLWTGYRDLVLPLGLAACWSYPVKGADGSVLGTFAFYYRENHGPVAFHQSLVDMGLSLC
FT                   ALLLEREKARMRIHQLAFHDTLTGLPNRNMFETQAQQLLNDARRTERELALVFIDLDHF
FT                   KRVNDTRGHATGDEVLCETGRRFKSVLRDGDLLGRLAGDEFVAILPHCGVHQATGIVER
FT                   LLAATAPPVVVAGAPIHASASIGIAMYPADGEHVPTLLRQADIAMYHAKARGRGHFCFF
FT                   REEMSRNIQEQAMLEADLRVALKHDLLDLWYQPQFDAANGHVLSGVEALLRWNHATLGS
FT                   VPPVRFVVLAEECGLIGELGKWVTQRACRQLADWRARGVEIPRVSINLSASDFRDSTLA
FT                   ERVARTLLAHGLQPHDLTLEMTESVMLGDEPGVLSMIDELHRLGIQLSLDDFGTGYSSL
FT                   GYLHRLPLDELKLDRSFVRDLDHSDSARALTSTVLRIGESLNIKVVAEGVETDTQRQFL
FT                   VEHGCPVLQGYLLARPMAPHLLEEWLRAAHAGSRI"
FT                   /protein_id="YP_555292.1"
FT   misc_feature    17747..20257
FT                   /note="cAMP phosphodiesterase; Provisional; Region:
FT                   PRK11359"
FT                   /db_xref="CDD:171081"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    18125..18448
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    order(18173..18175,18185..18187,18203..18205,18242..18253,
FT                   18344..18346,18359..18361)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    order(18233..18235,18245..18247,18284..18286,18293..18298,
FT                   18380..18382,18386..18388)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    18464..18952
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    18974..19447
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    order(19085..19087,19214..19216)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    order(19100..19102,19109..19114,19124..19126,19136..19138,
FT                   19202..19204,19208..19219)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    order(19190..19192,19274..19276)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Bxe_C0015"
FT   misc_feature    19499..20221
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Bxe_C0015"
FT   gene            20514..21803
FT                   /db_xref="GeneID:4009525"
FT                   /locus_tag="Bxe_C0016"
FT   CDS_pept        20514..21803
FT                   /locus_tag="Bxe_C0016"
FT                   /gene_family="HOG000153538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780086"
FT                   /db_xref="GeneID:4009525"
FT                   /translation="MKSVFDRTKQRHSRPALPAFVTSRVERYYRERVQETWGGGHIMRG
FT                   RIAGPDALHLSSNDYLAIARHPDIIGSMAATLLENGNGLLMSGIFLHGDCPQLQFENRL
FT                   ATFMQAEAGVLCQSGYAANTGLIQSIASEQTPVYIDMMAHMSLWEGVRSAGAVPVAFRH
FT                   NDAAHLEQQIGRYGQGIVLVDSVYSTTGSVCRLVSLADVCERHACVFVVDESHSLGTHG
FT                   PRGAGLVVELGLQSRVAFRTASLAKAFAGRAGFISCPVDFQEYFKFESNPAIFSSTLLP
FT                   HEISGLDATLSVIECADRRRTRLASSAAWLRQRLTELGYNLNGSRSQIIALEAGTEQRT
FT                   IVLRDALESRGIFGSVFCAPATARNRALIRLSIHAALSDAQVEKIASVCRDIRSEVELD
FT                   KWPSTRRLGDELSARRRQRETASEETAVTA"
FT                   /protein_id="YP_555293.1"
FT   misc_feature    20649..21689
FT                   /note="7-keto-8-aminopelargonate synthetase and related
FT                   enzymes [Coenzyme metabolism]; Region: BioF; COG0156"
FT                   /db_xref="CDD:30505"
FT                   /locus_tag="Bxe_C0016"
FT   misc_feature    20664..21689
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Bxe_C0016"
FT   misc_feature    order(20868..20873,20880..20882,21063..21065,21150..21152,
FT                   21159..21161,21243..21245,21252..21254)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bxe_C0016"
FT   misc_feature    21252..21254
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Bxe_C0016"
FT   gene            complement(21847..22848)
FT                   /db_xref="GeneID:4009526"
FT                   /locus_tag="Bxe_C0017"
FT   CDS_pept        complement(21847..22848)
FT                   /locus_tag="Bxe_C0017"
FT                   /gene_family="HOG000278020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780087"
FT                   /db_xref="GeneID:4009526"
FT                   /translation="MHTIKPFYFPTTVTFVDDSAAFLSNLCLQLDPQLAFRLFSSPGEA
FT                   LEFVNSRPRPGPSDEPLFAPFRDRTDEDLAHQVIALSVNTVRKQVHNAQRFLATSVVVV
FT                   DYDMPGMNGLEFCRRMTDPAVRKIMLTGKADEHIAVQSFNEGIIHRFIRKQDASAVPAL
FT                   NRAVRDLQNAYFDDVCQSILDTLAVSEYAFLRDEALAARVAELAASLGIVEHYLSYCPG
FT                   GLLMLDSAGKSYLLIVHTDETLRGLREIAVEQEAPAEFLAALDSRRSLPYFWQTEGHYP
FT                   ADCTAWENYMHPATQFSGRQNYVYAVIPNPPGLDLSQVLSYDRYLERLDRDL"
FT                   /protein_id="YP_555294.1"
FT   misc_feature    complement(22387..>22548)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bxe_C0017"
FT   misc_feature    complement(order(22387..22389,22396..22398,22456..22458,
FT                   22510..22512,22534..22536))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bxe_C0017"
FT   misc_feature    complement(22534..22536)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bxe_C0017"
FT   misc_feature    complement(order(22510..22518,22522..22527))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bxe_C0017"
FT   misc_feature    complement(22387..22389)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Bxe_C0017"
FT   gene            complement(22851..24080)
FT                   /db_xref="GeneID:4009527"
FT                   /locus_tag="Bxe_C0018"
FT   CDS_pept        complement(22851..24080)
FT                   /locus_tag="Bxe_C0018"
FT                   /gene_family="HOG000278019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="seriplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780088"
FT                   /db_xref="GeneID:4009527"
FT                   /translation="MRPFAMVAIVGFPLYFYVWHALFPQPYENLPLRLVGSALFIPILF
FT                   SDRWPARTRKFLPYYWYATIFYSLPFFFTFMLLKNNGSNVWIESALIAAFVMVLLLDWF
FT                   MLLLNFVTGIGVAYLAYWLTTDPVVLHAAYAAHLAIFSFAVAIGVVANYDMDRIRIEQE
FT                   RAMLATASSIAHELRTPLLAIRAGASGLGHYLPSLLETYSIAQQSDLPVPKIRLVHLQS
FT                   MDGVLSRIEQEAIHSNAIIDMLLANARFTGGYTHGAAVCSIAQSVRTALERYPFREGER
FT                   ERVLTDLAMDFTFHGSEMLMVHVLFNLLKNALRGMASVDSALISIRLVSGPRTNQLLFR
FT                   DTGAGIAPDVLPHIFTRFYTSSAGIDDASIGTGIGLAFCRDVMRGVGGAIDCKSVEGMF
FT                   TEFVLTFPRP"
FT                   /protein_id="YP_555295.1"
FT   misc_feature    complement(23334..23594)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(order(23349..23351,23361..23363,23370..23372,
FT                   23382..23384,23391..23393,23451..23453,23520..23522,
FT                   23529..23531,23541..23543,23550..23552,23562..23564,
FT                   23574..23576))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(23556..23558)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(22863..23180)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(order(22875..22877,22881..22886,22899..22901,
FT                   22905..22907,22953..22964,23043..23048,23052..23054,
FT                   23058..23060,23064..23066,23139..23141,23148..23150,
FT                   23160..23162))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(23148..23150)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bxe_C0018"
FT   misc_feature    complement(order(22956..22958,22962..22964,23046..23048,
FT                   23052..23054))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Bxe_C0018"
FT   gene            24930..26252
FT                   /db_xref="GeneID:4009528"
FT                   /locus_tag="Bxe_C0019"
FT   CDS_pept        24930..26252
FT                   /locus_tag="Bxe_C0019"
FT                   /gene_family="HOG000225789" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780089"
FT                   /db_xref="GeneID:4009528"
FT                   /translation="MGPKAPVTEKDLFRHPLREQINLKHPLVRLAGLINWERLSASMSA
FT                   SFVSGKGRPASSPRLIAGLLYLQHAFDLSDEDVVWQWVENPYWQVFTGETYLQTEPPID
FT                   PSSLTRWRKRLGEAGVEELLAETIDAAKRAGVIKASSAKRVIVDTTVMPKAIAHPTDSR
FT                   LLERCREHLVKAAARHGLKLRQNYNREAPRLATQISRYAHAKQYRRMRKAVRTLRSRVG
FT                   RVMRDVERQLDTVVDNRRADLQELIARTKRILTQKTKDKNKLYALHAPEVECLAKGKAR
FT                   TPYEFGVKVSITTTHREGLVVGARSMPGNPYDGHTLEEALEQAAILSDVKPEIAIVDRG
FT                   YRGAEPDGVKVYHPGLRRGITRTLRAMIRRRSAIEPAIGHMKADGKLDRNWLKGALGDA
FT                   INAVLCGAGHNLRMILRKLRRFYVLVLAALLNRSAASASTP"
FT                   /protein_id="YP_555296.1"
FT   misc_feature    25083..25271
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Bxe_C0019"
FT   gene            26316..27263
FT                   /db_xref="GeneID:4009529"
FT                   /locus_tag="Bxe_C0020"
FT   CDS_pept        26316..27263
FT                   /locus_tag="Bxe_C0020"
FT                   /gene_family="HOG000264508" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780090"
FT                   /db_xref="GeneID:4009529"
FT                   /translation="MAFGASSSRAFAQELALYTGPLTGEHSHSYSWSIDYTEGFGRYFA
FT                   SSITWLNEGHIPDHHRDGPVVQLWGRLPLMERRFVVALGVGPYRYFDTEAATQGAGYSN
FT                   THGWGVVYSARASWYSSQRWTANLQLNHVQVTNGASTTAVMFGVGYQLDAPGTPGARDF
FT                   ALPRASKVTNNEITLMAGATILNSLESQTSTAQAIEYRRGLTNYLDATLGYLHEGNGLS
FT                   ARRDGATAQLWLTRAFLNDHLALGVGVGAYAAIHHGDSSDNRDTGDGILSGLVSISASY
FT                   RITQHWSARLTWNRVMTRYSRDTDVILGGVGYRF"
FT                   /protein_id="YP_555297.1"
FT   gene            complement(27563..28561)
FT                   /db_xref="GeneID:4009530"
FT                   /locus_tag="Bxe_C0021"
FT   CDS_pept        complement(27563..28561)
FT                   /locus_tag="Bxe_C0021"
FT                   /gene_family="HOG000006439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative integrase"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780091"
FT                   /db_xref="GeneID:4009530"
FT                   /translation="MMQIHPQARTTPVVRAEIARSTEPTSVVARRYGISAETVRKWRKR
FT                   GEQACQDRSSRPKRLRWRASEEERAIICAVRRATGFPLDDLGFVLGHFLPHLNRDSIYR
FT                   VLKSEGLNRRPPKPTSLPEKGQGRFKEYDLGYVHIDVKHLPKLRTADGEVRKRYLYVAI
FT                   DRCSRFVHLAVYDAENTTNAIAFLAQARKAFPFRITHVLTDRGSCFTADDFERACAKLK
FT                   VTRRVTKPYTPQTNGMVERFNGRVASEVLGINIAGHADLEVLLKSFNRAYNRRRQRVLK
FT                   GSSPIDKVDQRLKLNGCLANPLYKPPADQEYLLSKVDRILVYANEVSQPDR"
FT                   /protein_id="YP_555298.1"
FT   misc_feature    complement(28184..28480)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="Bxe_C0021"
FT   misc_feature    complement(27830..28162)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Bxe_C0021"
FT   gene            28889..29749
FT                   /db_xref="GeneID:4009531"
FT                   /locus_tag="Bxe_C0022"
FT   CDS_pept        28889..29749
FT                   /locus_tag="Bxe_C0022"
FT                   /gene_family="HOG000205102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780092"
FT                   /db_xref="GeneID:4009531"
FT                   /translation="MNDRQDIAPDSTAARVALWRALHVELDPPPHVMEDEIGLQLLAPG
FT                   EDWRHRGDMDPRFTRPFRASIVARARFVEDLVVEQAGRGLTQYVILGAGLDSFAQRRPE
FT                   IASRLRVFEIDRPGPQAWKRQRLVELGFGMPDWLRFVPVDFGAGQGWRGGLATAGFDDS
FT                   KPAIVVSTGLSMYLTRDANAATLREVAALAPGSTLAMTFLLPLERADPELRPALEMAEK
FT                   GARAGGTPFLSFFTPAELVALAHQSGFGEARHVSAADLTRRYFADRTDGLRPPNNAEEL
FT                   LVAKT"
FT                   /protein_id="YP_555299.1"
FT   misc_feature    28925..29458
FT                   /note="Leucine carboxyl methyltransferase; Region: LCM;
FT                   cl01306"
FT                   /db_xref="CDD:163969"
FT                   /locus_tag="Bxe_C0022"
FT   gene            complement(30007..30768)
FT                   /db_xref="GeneID:4009532"
FT                   /locus_tag="Bxe_C0023"
FT   CDS_pept        complement(30007..30768)
FT                   /locus_tag="Bxe_C0023"
FT                   /gene_family="HOG000261675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780093"
FT                   /db_xref="GeneID:4009532"
FT                   /translation="MTTHLTGTREQWLAARRELLKAEKEWTRRGDELARQRQALPWVQV
FT                   DQTYRFETDEGDASLAGLFKGRSQLLIYHFMFGPDFQAGCPSCSAIADGFDGFAVHLAN
FT                   HDVMLWAVSRAPLAKLLAYKRRMGWTFPWASSVGDFNFDFNVSFTDEQQRNGDIEYNYE
FT                   RGGHAMDTTPAPQPVVEFAAMSGTDAATYSRERPGVSAFALEEGVVYHTYSAYARGVDA
FT                   LWGMYQWLDRAPKGRNESGIWWRRHDEYDGR"
FT                   /protein_id="YP_555300.1"
FT   misc_feature    complement(30019..30768)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="Bxe_C0023"
FT   gene            30904..32124
FT                   /db_xref="GeneID:4009533"
FT                   /locus_tag="Bxe_C0024"
FT   CDS_pept        30904..32124
FT                   /locus_tag="Bxe_C0024"
FT                   /gene_family="HOG000261686" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780094"
FT                   /db_xref="GeneID:4009533"
FT                   /translation="MDSLITAAARALAAGDPLGALDRIALRDDAPALALRGIAMAQLGD
FT                   LVRAKALVRSAARAFGADGAVARARCIVAEAEIALASRELGWPAKALDAARATLEAHGD
FT                   RLNAAHARYLEVRRLALVNRLREAEQTLAGLAPALLPPALRAVHELAVAELALRRLRTK
FT                   AARTALARAARAARRAGIPALTAEVEHASLVLSTPAARLIAHGEERLLLLDEVEALLAS
FT                   RGLVVDACRHAVRDADTVISLASRPVLFALARALGEAWPDDVPRDTLVARAFRARRADE
FT                   SYRARLRVEIGRLRAELGTLAGVSATRRGFALTPRGPAEVVVLAPLVEGEHAQVLAFLA
FT                   DGESWSSSALALVLGASQRTVQRALDSLATAGKVQSFGRGRARRWITPPVPGFATTLLL
FT                   PTFLSDD"
FT                   /protein_id="YP_555301.1"
FT   gene            32134..32820
FT                   /db_xref="GeneID:4009534"
FT                   /locus_tag="Bxe_C0025"
FT   CDS_pept        32134..32820
FT                   /locus_tag="Bxe_C0025"
FT                   /gene_family="HOG000261697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780095"
FT                   /db_xref="GeneID:4009534"
FT                   /translation="MNRSAATIIREYGPFPGVDKVHGVTYDGQQVWIAGGDRLNAIDPA
FT                   SGETLRSIELAADAGTAFDGKHLFQIGGGRIQKIDPNTGRVLATIPAPGGGGDSGLTWA
FT                   EGTLWVGQYPARKIYQIDPETGAILRTIESNRFVTGVTWADGELWHGTWEDGASELRRV
FT                   DPRTGEVLESIGMPVGAGVSGLESDGGDGFFCGGGDSGKVRAVRRPTGEHAHSSGSGIP
FT                   VDSASD"
FT                   /protein_id="YP_555302.1"
FT   misc_feature    32311..>32670
FT                   /note="Glutamine cyclotransferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region:
FT                   COG3823"
FT                   /db_xref="CDD:33616"
FT                   /locus_tag="Bxe_C0025"
FT   gene            33148..33414
FT                   /db_xref="GeneID:4009814"
FT                   /locus_tag="Bxe_C0026"
FT   CDS_pept        33148..33414
FT                   /locus_tag="Bxe_C0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780096"
FT                   /db_xref="GeneID:4009814"
FT                   /translation="MATRTMGADRFAATLSWLERGAVRGVRWDRRIPADRISRNPVAEK
FT                   AKVSVAANGAPSAQERAAIGLVRELAGRYRETADAASTGPRWP"
FT                   /protein_id="YP_555303.1"
FT   gene            33416..34015
FT                   /db_xref="GeneID:4009815"
FT                   /locus_tag="Bxe_C0027"
FT   CDS_pept        33416..34015
FT                   /locus_tag="Bxe_C0027"
FT                   /gene_family="HOG000061231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780097"
FT                   /db_xref="GeneID:4009815"
FT                   /translation="MARTDLAVLAGVAILALACLVVCSMYVYWSSDRYRDRQRRLEPQA
FT                   TGTPTRARATGRNDARFSGVGATMGTQLSHRCKTSLYRAVLGGARHESIAFLMADSRDD
FT                   ARTRAISAVAAIHGIAPRDVPLCKLASFRELIDIGVSEDEELRIFEMAWKGMDVSGWAE
FT                   HPLFLTDDPSLLGKWAELYADLARQLATSAIDRARG"
FT                   /protein_id="YP_555304.1"
FT   gene            complement(34233..35036)
FT                   /db_xref="GeneID:4009816"
FT                   /locus_tag="Bxe_C0028"
FT   CDS_pept        complement(34233..35036)
FT                   /locus_tag="Bxe_C0028"
FT                   /gene_family="HOG000004381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CO metabolism transcriptional regulator RcoM2"
FT                   /transl_table="11"
FT                   /db_xref="GI:91780098"
FT                   /db_xref="GeneID:4009816"
FT                   /translation="MKSSESAAATASERRAETFQHKLEQFNPGIVWLDPQGHVSAFNDV
FT                   ALHILGPAGEQSLGVAQDHLFGIDVVQLHPEKSRDKLRFLLQSRDAGGCPVRSPPPVAM
FT                   MINIPDRILMIKVSKMTGAAGTCGSCMIFYDVTDLTTEPSSQPAGASVPAPRRLFKIPV
FT                   YRKSRVILIDLKDIVRFQGDGHYTTIVTKDERYLSNLSLADLELRLDSSVYLRVHRSHI
FT                   VSLPYAVELVKLDESVNLVMDDAEQTQVPVSRSRTAQLKELLGVV"
FT                   /protein_id="YP_555305.1"
FT   misc_feature    complement(34248..34538)
FT                   /note="LytTr DNA-binding domain; Region: LytTR; cl04498"
FT                   /db_xref="CDD:156100"
FT                   /locus_tag="Bxe_C0028"
FT   gene            35467..36333
FT                   /db_xref="GeneID:4009817"
FT                   /locus_tag="Bxe_C0029"
FT   CDS_pept        35467..36333
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /gene_family="HOG000244728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="Bxe_C0029"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="GI:91780099"
FT                   /db_xref="GeneID:4009817"
FT                   /translation="MIPRPFEYHVPRTLPEALALLGEYGDEAKLLAGGHSLLPMMKLRF
FT                   AEPGHLIDLGKLAELKGIREADDEIRIGAMTTENELIWSELLQTRCPLIVEGARQISDP
FT                   QVRYRGTLGGDLSHGDPGNDHPALMMALGASFVLAGEQGERVVSAASFFVSTYTTLLEP
FT                   GEIMTEIRIPTPPAGTGYCYAKLKRKTGDFATAAAAVTLRIGTAAVGEVRIALTNVAET
FT                   AIRATAAEQYLQGKPLDEPAIAEAARLAMAVCAPVADLRGDVEYKTAMAGEMTRRALIT
FT                   AYARAAH"
FT                   /transl_table="11"
FT                   /protein_id="YP_555306.1"
FT   misc_feature    35476..36327
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM homologs [Energy production and
FT                   conversion]; Region: CoxM; COG1319"
FT                   /db_xref="CDD:31510"
FT                   /locus_tag="Bxe_C0029"
FT   misc_feature    35476..35991
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Bxe_C0029"
FT   misc_feature    36007..36312
FT                   /note="CO dehydrogenase flavoprotein C-terminal domain;
FT                   Region: CO_deh_flav_C; pfam03450"
FT                   /db_xref="CDD:146206"
FT                   /locus_tag="Bxe_C0029"
FT   gene            36380..36901
FT                   /db_xref="GeneID:4009818"
FT                   /locus_tag="Bxe_C0030"
FT   CDS_pept        36380..36901
FT                   /product="carbon monoxide dehydrogenase, small subunit"
FT                   /gene_family="HOG000166647" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="Bxe_C0030"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="GI:91780100"
FT                   /db_xref="GeneID:4009818"
FT                   /translation="MSRKIMVSFKLNGKETDVVVEPRELLIHTLREKCLHTGPHIGCET
FT                   SHCGACTVDFDHMSVKSCTMLTVQAEGAEVLTVEGLAQAGELHALQEGFMQEHGLQCGF
FT                   CTPGMLMRAYRLLQENPDPGEADIRYWMAGNLCRCTGYQNIVKAVQYAARKLRGEAVET
FT                   SHPLMTADTH"
FT                   /transl_table="11"
FT                   /protein_id="YP_555307.1"
FT   misc_feature    36389..36850
FT                   /note="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs [Energy production and
FT                   conversion]; Region: CoxS; COG2080"
FT                   /db_xref="CDD:32263"
FT                   /locus_tag="Bxe_C0030"
FT   misc_feature    36608..36829
FT                   /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
FT                   /db_xref="CDD:145127"
FT                   /locus_tag="Bxe_C0030"
FT   gene            36918..39329
FT                   /db_xref="GeneID:4009819"
FT                   /locus_tag="Bxe_C0031"