(data stored in ACNUC30630 zone)

EMBL: BX251410.ACOL

BX251410.ACOL        Location/Qualifiers
FT   CDS_pept        complement(290066..291418)
FT                   /transl_table=11
FT                   /gene="acoL"
FT                   /locus_tag="TW260"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Similar to Bacillus subtilis dihydrolipoamide
FT                   dehydrogenase AcoL SWALL:DLD3_BACSU (SWALL:O34324) (458 aa)
FT                   fasta scores: E(): 2.9e-46, 35.07% id in 459 aa"
FT                   /protein_id="CAD66936.1"
FT                   /translation="MDYDLIVLGAGSAGYATAIRATQLGMKVALAEGDKVGGTCLHRGC
FT                   IPTKSLVQCAKAAHIAKNASKFGVINSFSGVDINAVNVFKNGIVESKYRGLQSLLRSYG
FT                   IHVYPNFATLSSQNSVRIGTEDITGKNIVIATGSRPKGIPGLSGGCIFDSDSILEIDHL
FT                   PSSLAIIGGGVIGVEFASIFNYLGVDVSILEAQETLIPSEERGVSKQLERVFRRRGIKL
FT                   YLGHKIMDVSQTDGVVVSLDSNEKVNADLLLVAIGRAPATDAIGKVGIEIDGGAISVDE
FT                   KLRTTVPNVFAAGDVVGGLQLAHRGYQQGIYLAEQIAGLDPSAVADINIPRVIYTSPEV
FT                   ASVGYTEAGAAEIYGVNEIVTYEYNLAGNAKSSIMGAAGSIKVVQHKNKDVLGVHMVGD
FT                   GVSELVSEAQLIVNWEANPSDVASLIHPHPTQAEAIGEAMLALAGKPLHGI"
     atggactacg atctgatagt tcttggtgcg ggaagtgccg gttacgcgac tgctatacgc        60
     gcaacgcaat taggtatgaa ggttgcactt gctgaggggg ataaagttgg cgggacatgc       120
     ctgcataggg gatgtatccc aacaaaatcg cttgtacaat gtgcaaaagc tgcccatatt       180
     gccaaaaatg cgtcaaaatt tggggttata aatagttttt ctggtgttga tataaatgct       240
     gtaaatgtct tcaagaatgg cattgttgaa agtaagtacc gtgggctaca gtcacttttg       300
     agatcctacg gtatccatgt ctacccgaat tttgcaacgc ttagttcaca aaactctgtt       360
     cggatcggca cagaagatat tacagggaaa aacatagtga tcgcaacagg ttctagaccg       420
     aaaggcatac cgggattaag cggggggtgc atctttgaca gcgattctat tctcgagata       480
     gatcatctcc cgtcgagtct tgccattatt ggcgggggtg taataggcgt cgagtttgca       540
     agtatcttta attatctcgg tgttgatgtg agcatactcg aggctcaaga aactcttatt       600
     ccttccgagg agcgaggtgt tagcaaacag ctcgaacggg ttttcaggcg aagaggtata       660
     aagctttatc tggggcacaa aataatggat gtgtcacaga cagatggtgt ggtggtatcc       720
     cttgattcaa acgaaaaagt aaatgctgac ctgcttctgg tggcaattgg cagggcaccc       780
     gcaacagatg caataggcaa agttggaata gaaattgatg gaggtgccat ctctgttgat       840
     gaaaaactaa ggacaactgt gcctaatgta ttcgctgcgg gagatgttgt aggtggtcta       900
     cagcttgcgc acagggggta tcagcagggc atatatttgg ctgaacaaat tgctggtctt       960
     gacccatccg ctgtggcaga cattaatatc ccgagggtga tttacacaag cccagaagtc      1020
     gcatctgtcg gatatacaga agctggggca gcagagatat atggcgtgaa tgaaatagtt      1080
     acctatgaat acaatctcgc tggcaatgca aaaagttcca ttatgggggc tgcgggaagc      1140
     attaaggtgg tccagcacaa aaacaaggac gtccttgggg ttcatatggt cggcgatggg      1200
     gttagtgagc ttgtatccga ggctcaattg attgtaaatt gggaagccaa cccatcagat      1260
     gttgcatcgc ttattcatcc acatccaacc caggcagaag ctatcggcga agcgatgctt      1320
     gcactcgcag ggaaacccct acatggtatt tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page