(data stored in ACNUC30630 zone)

EMBL: BX251410.ADK

BX251410.ADK         Location/Qualifiers
FT   CDS_pept        254348..254908
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="TW226"
FT                   /product="adenylate kinase"
FT                   /note="Similar to Xanthomonas campestris adenylate kinase
FT                   Adk or Xcc3291 SWALL:AAM42561 (EMBL:AE012446) (187 aa)
FT                   fasta scores: E(): 3.3e-21, 37.96% id in 187 aa, and to
FT                   Homo sapiens adenylate kinase isoenzyme 1 Ak1
FT                   SWALL:KAD1_HUMAN (SWALL:P00568) (194 aa) fasta scores: E():
FT                   3.7e-14, 32.78% id in 183 aa"
FT                   /db_xref="GOA:Q83I60"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I60"
FT                   /protein_id="CAD66903.1"
FT                   /translation="MRAIMVGPPGSGKGTQCGLIQSRLGISVIATGDVFRERMKTDMAL
FT                   RDIVSSGGYVSDSTTNRIVEDCLDKEDVSSGFVLDGYPRTLQQLDFLEGFLKRRALTLD
FT                   AVFSLEVATDLLIERLRARSKESGRTDDRDSVIARRLEIYTEMTLPIIDACEEKGLLHR
FT                   IDASKGIEEVFQSIKDVFDRVTI"
     atgcgggcta taatggtcgg ccctccgggg tctggaaaag gtacccagtg tggtcttatt        60
     cagagcagac ttggtatatc tgtcatcgca accggtgatg tgtttcgtga acgcatgaaa       120
     actgatatgg cactaaggga cattgtgtca tcaggtggtt atgtttctga ttcgacgacc       180
     aatcgcattg tagaggactg ccttgacaag gaggatgtgt cctccgggtt tgtccttgat       240
     gggtatccac gaaccctgca acagctggac tttctagagg gctttttaaa acgacgtgcc       300
     cttacgctgg atgccgtctt tagcttggag gttgcgacag atctcctaat tgagaggctg       360
     cgtgcccgat caaaggagtc tggccgtact gacgacagag attctgtgat tgctcgtaga       420
     ttggaaatct ataccgaaat gaccttgccg attatcgatg cctgcgaaga aaagggactg       480
     cttcacagga tagatgcttc caagggtata gaggaagttt ttcagtccat caaagatgta       540
     tttgacaggg tgacaattta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page