(data stored in ACNUC30630 zone)

EMBL: BX251410.ALR1

BX251410.ALR1        Location/Qualifiers
FT   CDS_pept        complement(299448..300608)
FT                   /transl_table=11
FT                   /gene="alr1"
FT                   /locus_tag="TW266"
FT                   /product="alanine racemase I"
FT                   /EC_number="5.1.1.1"
FT                   /note="Provides the d-alanine required for cell wall
FT                   biosynthesis. Similar to Streptomyces coelicolor alanine
FT                   racemase Alr or SCO4745 or SC6G4.23 SWALL:ALR_STRCO
FT                   (SWALL:O86786) (391 aa) fasta scores: E(): 1.2e-19, 29.5%
FT                   id in 400 aa, and to Lactobacillus plantarum alanine
FT                   racemase Alr SWALL:ALR_LACPL (SWALL:O08445) (375 aa) fasta
FT                   scores: E(): 0.0001, 24.13% id in 377 aa"
FT                   /protein_id="CAD66942.1"
FT                   /translation="MTQRTALSNSHAQAFISLGTLKKNLLWLQNEVAPAKVFMVIKANA
FT                   NGHGTMRVAEVAKMSGIRNFAVLLPKEALLIKRALSPGVRVFTWHITPDCEDLPSLIEN
FT                   NIEIGIGAEWQLRYIASCVKKTMTCEVLSGYKPALIHLKLDTGLSRGGCGVKDWQNLVC
FT                   LAQDFQEMGLIKITGFWSHLSNTSPEEDRRSLKIFTENVTPYLASYSRRARPIMHIAAS
FT                   VAALGLPESRLDYVRLGLSCFGYYEKEELKGVMTLVAPIIKFLPEQGRAIIACGFADGI
FT                   SPLAVRNNVPLTGRSNRARLIEVGPETSVIEICQDIDRRQDNLQNSYDHVPQDPFLNAL
FT                   RVSQNHVILFGSGGLSELTARQWAESCGTTIDDVLSRVKAELIYLE"
     atgacacaaa gaactgcttt atccaattcc cacgctcaag cgtttattag tctcgggact        60
     ttgaaaaaga atcttctgtg gttgcaaaat gaagtcgcac cggcaaaagt tttcatggtt       120
     ataaaggcaa atgcgaatgg acacgggacg atgcgtgttg ccgaggtggc aaaaatgagt       180
     ggaattcgca attttgccgt tcttctccca aaagaagccc tactgataaa acgagcctta       240
     tcgccgggag tgcgagtatt tacttggcat attaccccag actgtgaaga cctgccgagc       300
     ctaattgaga acaatattga aattggcata ggtgcagaat ggcagttgcg atatatcgca       360
     tcgtgtgtaa aaaagacaat gacatgcgag gtgctgtctg gttataaacc agctctaatt       420
     catctaaagc ttgataccgg cctcagtcgg ggtgggtgtg gcgtgaagga ctggcaaaat       480
     cttgtctgtc ttgcacaaga ctttcaggag atgggcctta taaagataac tggattttgg       540
     tcccacctgt ctaacacttc tccagaggaa gatagacgtt ccctaaagat attcacggaa       600
     aacgtcacgc catatctcgc aagttacagc cggcgtgcca ggccaataat gcatatcgca       660
     gcgtccgttg cggcattggg cctgccggag agcaggctag attacgtaag gctaggcctc       720
     tcatgttttg gttattacga aaaagaagaa ctaaaaggcg ttatgacatt agttgcgcca       780
     attataaaat ttcttcccga gcaggggcgt gcaataattg catgtgggtt tgctgatgga       840
     atcagcccgc ttgcggtgcg caataatgtt cctcttacag gacgaagtaa ccgggcaaga       900
     ctaatcgagg ttgggcccga aacatctgtt atagagatct gtcaagatat cgatcgacgg       960
     caagacaatt tgcaaaatag ttatgatcac gtaccgcaag accccttttt aaatgcactg      1020
     cgtgtcagcc aaaaccatgt tattcttttc ggatccggag ggctttcaga gctaactgcc      1080
     agacaatggg cagagtcttg tgggacaaca atagatgatg tcttatcgcg tgtaaaagct      1140
     gagcttattt acctggaata a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page