(data stored in ACNUC30630 zone)

EMBL: BX251410.ALR2

BX251410.ALR2        Location/Qualifiers
FT   CDS_pept        complement(300658..301320)
FT                   /transl_table=11
FT                   /gene="alr2"
FT                   /locus_tag="TW267"
FT                   /product="alanine racemase II"
FT                   /EC_number="5.1.1.1"
FT                   /note="Provides the d-alanine required for cell wall
FT                   biosynthesis. Similar to the C-terminal region of alanine
FT                   racemases eg. Corynebacterium glutamicum alanine racemase
FT                   Alr or cgl0588 SWALL:BAB97981 (EMBL:AY077456) (361 aa)
FT                   fasta scores: E(): 1.8e-07, 34.82% id in 112 aa."
FT                   /protein_id="CAD66943.1"
FT                   /translation="MISRLATITLESIKNNALLCLEADGDITVDLRADAFGHGLVKIAY
FT                   TLYSTGVRKCFVRKAHEKIFLEEIGFTVDVSDAPIKPFSHDIYGLGDNTECKAALHLES
FT                   CVVTCKKLPAGAGVSYCHTYRTQSEENVALIGIGYADGLPFQAQGSVEIKKRKYPIIGR
FT                   IAMDYMVAKVTPDSYKHGTRVTVWGESGAKTWGLSAGIDPLCLTAGLAYRVEKRWLT"
     atgatatcgc gtttagcaac tattacattg gagagtataa agaataatgc ccttctgtgc        60
     ctggaggccg atggtgatat aacggtcgat ctgcgtgccg acgcatttgg gcacgggctt       120
     gtgaaaattg cttacacctt gtacagcaca ggggtcagaa agtgtttcgt gcgcaaagcc       180
     cacgaaaaga tctttcttga agaaattggg ttcacagtgg atgtatcaga tgcgcctata       240
     aagccattct cacacgatat atacggcctg ggtgataata cagagtgcaa agctgctttg       300
     catcttgaaa gctgcgtagt aacgtgcaag aaactgccgg caggagcggg tgtaagttat       360
     tgtcacacat acagaacaca gtcagaggaa aatgttgcac tcataggcat aggatatgca       420
     gacggactgc cctttcaggc tcaaggatct gttgaaataa aaaagagaaa ataccccatt       480
     atcggaagaa tagccatgga ctacatggtt gcgaaggtta cacctgactc gtataaacat       540
     ggaacaagag ttaccgtatg gggagaaagc ggtgcaaaga cttggggttt gtcagcggga       600
     atagaccccc tctgccttac cgcaggacta gcatacaggg ttgagaaacg ctggcttaca       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page