(data stored in ACNUC30630 zone)

EMBL: BX251410.AROA

BX251410.AROA        Location/Qualifiers
FT   CDS_pept        complement(231435..232766)
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="TW194"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Similar to Mycobacterium tuberculosis
FT                   3-phosphoshikimate 1-carboxyvinyltransferase AroA or Rv3227
FT                   or mt3324 or mtcy20b11.02 SWALL:AROA_MYCTU (SWALL:P22487)
FT                   (450 aa) fasta scores: E(): 1.6e-52, 42.4% id in 441 aa"
FT                   /db_xref="GOA:Q83I86"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I86"
FT                   /protein_id="CAD66871.1"
FT                   /translation="MAKTEMYQPPLGNRALFKMSIPGSKSLTNRHLIIAAIASGETTIH
FT                   NLLESRDTNLMIEGLRRIGCKIEKLNHTGTHDTGVISPHCTCLNDLIQPSDVRIIPSKH
FT                   YTCSTKIDCGLAGTVMRFLPVLAGLCKGSVEFFGDDQAIRRPMDGTLHALRKLGVQVDG
FT                   DRIPFTVHGRGEIEGGALETTEHSSSQFISGLLLSACRFKNGLTLKHIGNPLPSRPYID
FT                   MTVEVMREWGINVTHSDGVWAVTPKELTGKHITIEPDLSNAAPFMIGAIVTGGSATIQN
FT                   WPSKTSQPGKYLEAILPQFGAEITKTANTITVSGTGNITGIRADLGHIGELVPNLVALA
FT                   TLAETPSVFYNIGHIRYHETDRIEALVNEISSLGGTITAGKDYIKITPTTLTRSGVWKT
FT                   YKDHRMATSGAIIGLRHKLTIEDIECTSKTFPRFADLWSGAFGK"
     atggcgaaaa ctgaaatgta ccaaccacct ctaggcaata gagcactctt taagatgtcg        60
     atacccggat caaaatctct aacaaataga cacttgataa ttgcagcgat tgcgagtggg       120
     gaaactacaa tacataactt gcttgagtct cgtgatacga acctcatgat cgaaggtcta       180
     aggcgtatcg ggtgcaaaat agagaagctc aatcacaccg gtacgcatga taccggcgtg       240
     atatcgccac actgtacatg cctcaacgat ctgatacagc cgagcgacgt gaggataatc       300
     ccatcaaagc attacacctg cagcacaaaa attgactgtg gccttgccgg taccgtaatg       360
     cgatttttac cggttttggc agggctatgc aagggatcag ttgaattttt cggtgacgat       420
     caggcaattc gaagaccaat ggatggaaca cttcatgctc taagaaaact tggtgttcaa       480
     gttgatgggg atcgtattcc atttaccgta cacggaaggg gggagataga gggtggggct       540
     cttgaaacca ccgaacattc ttcaagtcaa tttatctccg gtcttctttt atctgcatgc       600
     agattcaaaa atgggcttac tctaaaacat atcggtaacc cccttccaag ccgtccatat       660
     atcgatatga cagttgaagt tatgcgcgag tggggaatca atgtaacaca ctccgatggt       720
     gtatgggcag taacacccaa agaattaact ggtaaacata tcaccattga gccagatcta       780
     tccaatgcgg ctccatttat gattggtgca attgttaccg ggggcagtgc aacgatacag       840
     aactggccaa gcaaaacatc gcaacctgga aaatatttgg aagctatttt gccgcagttt       900
     ggtgcggaga taacaaaaac cgcaaatact attaccgtca gtggaacagg aaatataaca       960
     ggaattaggg cagatcttgg gcatattgga gagcttgtgc ccaatcttgt tgcactggcc      1020
     actctggcag aaacgccaag tgtgttttat aacataggcc acatccgata tcacgaaact      1080
     gacagaattg aagcgcttgt taatgaaata agttcactgg gcgggacgat aacagctggg      1140
     aaagactata taaaaatcac cccaaccact cttacaagaa gtggtgtatg gaaaacctac      1200
     aaagaccaca gaatggcaac gtcaggcgca ataatcggcc ttcgtcataa actgactata      1260
     gaagatatcg agtgcacgag taaaacattc cctcggtttg cagatctctg gagcggtgcg      1320
     tttggtaaat ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page