(data stored in ACNUC30630 zone)

EMBL: BX251410.CLPP1

BX251410.CLPP1       Location/Qualifiers
FT   CDS_pept        318864..319406
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /locus_tag="TW283"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to Streptomyces coelicolor ATP-dependent Clp
FT                   protease proteolytic subunit 1 ClpP1 or SCO2619 or
FT                   SCC80.04c SWALL:CLP1_STRCO (SWALL:Q9F315) (219 aa) fasta
FT                   scores: E(): 5.1e-39, 58.82% id in 170 aa"
FT                   /db_xref="GOA:Q83I19"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I19"
FT                   /protein_id="CAD66957.1"
FT                   /translation="MSETKQTVFDRLLQERIVWLGEAIDDKLANEICAKILLLNADDPK
FT                   EDIFLYINSPGGSITAGMAIYDTMQFVSNDIVTVGIGMAASMGQVLLTSGTQNKRYIMP
FT                   NARVLLHQPLAGFGGTASDIQTQAKLILDMKYRLSQITASRTGKTVEQIMEDGDRDHWF
FT                   TAEEALEYGFVDHIRTE"
     gtgagcgaga caaagcaaac agtttttgat cgccttcttc aagagaggat tgtttggctt        60
     ggtgaggcta tagatgacaa gcttgcgaat gagatatgcg caaaaatatt gcttctgaat       120
     gctgatgacc cgaaggaaga catttttctg tatatcaatt caccgggcgg gtccataact       180
     gcagggatgg cgatttatga caccatgcag tttgttagca atgatattgt caccgttggt       240
     attgggatgg ccgcctcgat gggtcaggtg ttgcttactt cgggcaccca aaacaagcgc       300
     tacattatgc cgaatgctcg tgttttgctt catcagccat tggccggttt tggggggaca       360
     gcgagtgata tacagacaca ggcgaagttg attctagaca tgaagtatag gctcagtcag       420
     ataaccgcct ctagaacggg taaaactgtt gagcagatta tggaggacgg cgacagggat       480
     cactggttca ctgccgaaga ggcattggaa tacggttttg ttgatcatat acgtaccgag       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page