(data stored in ACNUC30630 zone)

EMBL: BX251410.CLPP2

BX251410.CLPP2       Location/Qualifiers
FT   CDS_pept        319418..320041
FT                   /transl_table=11
FT                   /gene="clpP2"
FT                   /locus_tag="TW284"
FT                   /product="ATP dependent Clp protease proteolytic subunit 2"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to Streptomyces coelicolor ATP-dependent Clp
FT                   protease proteolytic subunit 2 ClpP2 or SCO2618 or
FT                   SCC80.03c SWALL:CLP2_STRCO (SWALL:Q9ZH58) (218 aa) fasta
FT                   scores: E(): 3e-48, 67% id in 197 aa"
FT                   /db_xref="GOA:Q83I18"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I18"
FT                   /protein_id="CAD66958.1"
FT                   /translation="MYPNSRYILPSLDERTAYGYKQVDPYTKLFEDRIVFLGVQIDDAS
FT                   ADDVMAQLLVLEGQDAERDIIMYINSPGGSFTAMTAIYDTMQYIRPQIQTVCLGQAASA
FT                   AAVILSAGTPGKRLALPNARILIHQPVVASSGYGQASDIEIQAREIMRMREWLEKTLAQ
FT                   HSNKSVKQVSKDIDRDKILSSEQALEYGLIDQILVSRKAGLGKK"
     atgtacccaa attcaagata tattttgccg agtctcgacg agcgtactgc ctatgggtat        60
     aaacaggttg atccgtacac aaagctgttt gaagatcgca tagtttttct tggagttcag       120
     attgatgatg catctgctga tgatgttatg gcacagctct tggttcttga aggtcaagat       180
     gctgaacgcg acataattat gtatatcaat tcacctggcg ggtcttttac agccatgaca       240
     gccatatacg acacgatgca gtatatacgt ccgcagatac agacagtgtg tcttgggcag       300
     gccgcctcgg ctgctgccgt gatcctgtcg gccggaactc caggaaagag acttgccttg       360
     ccaaacgcaa gaatactaat tcaccagccc gttgtcgcct cttccggtta cggtcaggca       420
     agtgatatag agatacaggc tcgtgaaata atgcgcatgc gcgaatggct agaaaaaaca       480
     cttgcccaac attccaataa gtctgtaaaa caagtcagta aggatattga tcgtgataag       540
     atcctttctt ccgagcaggc tttggaatat ggcttgattg atcagatatt ggttagtcgt       600
     aaagctggcc tgggtaagaa atag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page