(data stored in ACNUC30630 zone)

EMBL: BX251410.CLPX

BX251410.CLPX        Location/Qualifiers
FT   CDS_pept        320051..321322
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="TW285"
FT                   /product="ATP dependent Clp Protease ATP binding subunit"
FT                   /note="Similar to Bacillus subtilis ATP-dependent Clp
FT                   protease ATP-binding subunit ClpX SWALL:CLPX_BACSU
FT                   (SWALL:P50866) (420 aa) fasta scores: E(): 6.7e-66, 56.89%
FT                   id in 406 aa"
FT                   /db_xref="GOA:Q83MI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83MI6"
FT                   /protein_id="CAD66959.1"
FT                   /translation="MTDDTEYRCSFCGKEHHQVDDLIAGPDVRICSECVVLSCEIVEDR
FT                   RNEALAKQDAFIKRKQRSVLEGLPKPAEIYAFLDEYVIGQQKAKRDLSVAVYNHYKRLV
FT                   STKSESENEVELSKSNILLIGPTGCGKTYLAQTLARMLRVPFAVADATALTEAGYVGDD
FT                   VENVLLKLLQDADFDITRAEAGIVCIDEIDKISRKADSPSITRDVSGEGVQQALLKILE
FT                   GTAASVPLQGGKKHTQYEQASINTRNILFIVAGAFSGIEEIISSRIGRSNMGFGSDLLR
FT                   KDTDVFDQILPEDLRKFGLIPEFIGRLPIVTAISHLDGEDMIRVLTEPKNALVKQYKRL
FT                   FSLDGVSLGFDHEALEAIVELALKRKTGARALRSVMESILSPIMFDVPSRGDIESVRIT
FT                   AETVAGGGPHLTMRCARSNYIRSA"
     ttgacggatg ataccgaata tcggtgttct ttttgcggaa aggaacacca tcaggttgat        60
     gatctgatag ccggtccgga tgtgcgtata tgcagcgagt gtgttgttct gagctgcgag       120
     attgttgagg atagaagaaa tgaggctctt gcgaagcaag atgcttttat caagagaaaa       180
     cagcggtcag ttcttgaggg cttaccgaaa cccgctgaga tatatgcctt tcttgatgag       240
     tatgtaattg gtcagcagaa ggcaaagcgt gatttgtcgg ttgcggttta taaccattac       300
     aagaggcttg tctcgacaaa aagtgagagc gaaaatgaag ttgagctctc caagtcaaat       360
     attctactga ttggccctac aggttgtggc aaaacttacc tcgcacaaac cctcgctcgg       420
     atgcttcgtg ttccctttgc tgtcgccgat gcaacagctt tgacagaggc gggatatgtc       480
     ggggatgatg ttgaaaatgt cctcttaaaa cttttacagg acgctgattt tgatattact       540
     cgcgccgagg cgggtatcgt atgcatagat gagattgaca aaatatctcg caaggccgac       600
     agtccctcaa ttacgcggga tgtttcagga gagggtgttc aacaggctct cctgaaaatt       660
     ctagagggta cggcagcgtc tgttcctttg caaggtggta aaaagcatac ccaatacgaa       720
     caggccagca taaacacgag gaatattctt tttattgttg caggcgcttt ttccgggata       780
     gaggaaatta tttcatctcg tatcggcaga tctaacatgg gcttcgggtc ggatttgctt       840
     aggaaagata cggatgtatt tgaccagatt ttacccgagg acttgagaaa atttgggctt       900
     attccggagt ttattggccg ccttccgatt gttacagcaa tttctcatct tgacggagag       960
     gatatgattc gggttttgac cgagcctaag aatgcacttg taaagcagta caaaaggctt      1020
     ttttcgctcg atggggtttc tcttgggttt gaccacgaag cgcttgaggc aatagtagaa      1080
     ttggcactca aaagaaaaac tggcgcacga gcattgcgct ctgtcatgga atcgattttg      1140
     agccccataa tgtttgatgt tccatcaaga ggtgatatcg aaagtgtccg aataactgcc      1200
     gaaacagttg caggtggtgg cccgcatctt acgatgcgat gtgctaggtc taattacatc      1260
     agatcagcgt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page