(data stored in ACNUC30630 zone)

EMBL: BX251410.COAA

BX251410.COAA        Location/Qualifiers
FT   CDS_pept        complement(180517..181272)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="TW156"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="Similar to Escherichia coli pantothenate kinase CoaA
FT                   or Rts or PanK or b3974 or z5545 or ecs4901
FT                   SWALL:COAA_ECOLI (SWALL:P15044) (316 aa) fasta scores: E():
FT                   4.5e-12, 39.66% id in 242 aa"
FT                   /protein_id="CAD66836.1"
FT                   /translation="MGIEVFKKDITKTYTEMLKDIRKRVRERGKVGKSFIIGITGSVAA
FT                   GKSTLASDLAKMLDGISVEVISTDGYLYPNKILEQKGLMLKKGFPESYDTAHLASLVKN
FT                   IKAGAKTIGIRQYAHPIHDVTGVIKTVNKPEILIIEGLNVMRHPVKTVVDLGIYIEAPK
FT                   RSVFKWYVKRFFELRAQHEKNTYFRKYANLPRRQCIKMLKQVWRDVNRKNFTENILPVK
FT                   HTADFIVYKNPRHKMTLYRNEASSSGFPV"
     ttgggaattg aagtgttcaa gaaagatata acaaaaacgt ataccgaaat gctaaaggat        60
     atacgaaaga gggttaggga aagaggaaag gttggcaaaa gttttatcat tggcataaca       120
     ggttctgttg ctgctggtaa atctacactc gcaagcgatc tagccaaaat gttggatggg       180
     ataagtgttg aggttatatc aactgacgga tatttgtatc caaataaaat cctggagcaa       240
     aaggggctga tgcttaaaaa gggatttcct gagtcgtatg ataccgcaca cctcgcatca       300
     cttgtaaaaa atattaaagc tggggcaaaa acgattggga taagacagta tgcacatccg       360
     atccatgatg taacgggggt gataaaaact gttaataagc cggaaatatt aatcattgaa       420
     gggctaaacg ttatgcggca tccggtaaaa acagtggttg acctgggtat ttatattgaa       480
     gcaccgaaga gatctgtatt caaatggtat gtaaaaagat tttttgaact gagggcgcaa       540
     catgagaaaa acacatattt tcgaaagtat gcgaatctcc ccagaagaca gtgtataaaa       600
     atgctaaaac aagtttggcg cgacgtaaac cgaaaaaact tcacggaaaa tattttgcca       660
     gtgaaacata cggcagactt tattgtgtat aaaaatccga gacataaaat gacactttac       720
     agaaatgaag ctagctcttc tggatttcct gtttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page