(data stored in ACNUC30630 zone)

EMBL: BX251410.COAD

BX251410.COAD        Location/Qualifiers
FT   CDS_pept        234982..235512
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="TW196"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to Escherichia coli phosphopantetheine
FT                   adenylyltransferase CoaD or KdtB or b3634 or z5058 or
FT                   ecs4509 SWALL:COAD_ECOLI (SWALL:P23875) (159 aa) fasta
FT                   scores: E(): 3.8e-06, 33.13% id in 169 aa"
FT                   /db_xref="GOA:Q83I84"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I84"
FT                   /protein_id="CAD66873.1"
FT                   /translation="MSNRIAVVPGTFDPVTRGHMDILTRTSRIFNTLYVLVANNPDKTP
FT                   LLPMHDRVDLVGQALEEYGFPRSEPKCDSESDRNGPIVKIHRFEKGLLVDCCKQLGATV
FT                   IVRGLISADAHREASMAYANRNMSGIETVFILPDPPLSVVSSSMVRQLIALGGDISPYV
FT                   PACVTRFFGTHSG"
     atgagtaaca ggatagctgt tgttccgggt acgtttgacc ccgttacaag aggacacatg        60
     gatatcctta ccaggacttc aagaattttt aacacactct acgtcctggt tgcaaataat       120
     ccggataaaa ccccactttt acctatgcat gaccgagttg atctggttgg acaggctttg       180
     gaagaatacg gatttccccg cagtgagcca aaatgtgaca gtgaatcaga ccgtaatggg       240
     ccaatagtca agattcatcg ctttgaaaaa ggcctgttgg ttgattgctg taaacagctt       300
     ggcgcgaccg ttattgtaag gggacttatt tcggccgatg cacaccgaga ggcgtcgatg       360
     gcatatgcca atcggaatat gagtggcatt gagactgtgt ttattttacc tgacccccca       420
     ctgagcgttg tttcaagcag catggtcagg cagcttatcg cacttggtgg tgatatatcc       480
     ccgtatgtac cggcttgtgt aacgcgtttt tttgggacgc acagcggtta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page