(data stored in ACNUC30630 zone)

EMBL: BX251410.DDLA

BX251410.DDLA        Location/Qualifiers
FT   CDS_pept        286979..288022
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="TW257"
FT                   /product="D-alanine--D-alanine ligase A"
FT                   /EC_number="6.3.2.4"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 D-alanine--D-alanine ligase A DdlA or b0381 or
FT                   z0477 or ecs0431 SWALL:DDLA_ECOLI (SWALL:P23844) (364 aa)
FT                   fasta scores: E(): 5.1e-32, 32.86% id in 353 aa"
FT                   /db_xref="GOA:Q83I36"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I36"
FT                   /protein_id="CAD66933.1"
FT                   /translation="MRSLLLLFGGRSQEHSVSYASARALLEHICDEWTVIPVGITKHGD
FT                   FVYCSTVSEQDYGEVIDNGNRVVWPSRAGCKKIEVVQARGKSFFVEFDLVFPLLHGVFG
FT                   EDGTIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCSHAGIPVLPWYLIKGHAWHKNR
FT                   DSFLKQISDRFTFPLFVKPVDAGSSFGCTFVDFFEQLPVAIEHALQHGKSAIVEPALDA
FT                   PEVFCSLIENNGVLQCSELVFVKHSGSKFYDYSAKYLNPVEFVIPAQFDNTDGYAEIAS
FT                   KVFFELGCRHYARIDFFVTESGLVLNEINTSPGLTQKSIFPSSFKSMQYSQVIETILAS
FT                   AYCQVKR"
     atgcgcagct tgctcttatt atttggtggt cgctcacaag agcattcggt tagttatgca        60
     tcggccaggg cgttgcttga acatatatgc gatgaatgga ctgtaattcc tgttggcata       120
     acaaaacacg gcgattttgt atactgcagc actgtgtcag agcaggatta tggcgaagtc       180
     attgataatg gtaatagagt tgtttggccc agccgcgcgg ggtgcaaaaa aattgaggta       240
     gtccaggctc gcggcaaaag cttttttgtt gagttcgatc tcgtatttcc tctccttcat       300
     ggggtgtttg gtgaagacgg aacaatccag gggatgcttg acctgcttga tattccttat       360
     gttggttccg gagtatttgc aagtgcagct gcgatggata agcactatac aaaaatactg       420
     tgttcccacg cgggcattcc ggttctgccg tggtatctca ttaaggggca tgcttggcat       480
     aagaacagag attctttttt gaagcaaatt tctgacagat ttacctttcc tctgtttgtg       540
     aagcctgttg atgctggctc gagttttggt tgcacttttg ttgatttttt cgagcaattg       600
     ccagtggcta tagaacatgc tcttcaacac ggaaaatctg ctattgttga gcctgccctt       660
     gatgctccag aagttttttg ctcactcatt gaaaataatg gggtattgca gtgctctgaa       720
     ctcgtttttg taaaacatag tggcagtaag ttttatgatt attccgccaa atacctgaac       780
     ccggttgagt ttgtgattcc agctcagttt gacaataccg acggatatgc cgagattgct       840
     tcaaaagttt ttttcgagct tggctgtcgc cactacgctc ggattgattt ttttgttaca       900
     gaatcgggtc ttgttctaaa tgagattaac acatcacccg gcctcactca gaaatcgatt       960
     tttccatcaa gctttaagtc gatgcaatac agtcaagtta tagagactat tcttgcctca      1020
     gcctactgcc aggtcaaacg ctaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page