(data stored in ACNUC30630 zone)

EMBL: BX251410.DKGA

BX251410.DKGA        Location/Qualifiers
FT   CDS_pept        15432..16280
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="TW016"
FT                   /product="2,5-diketo-D-gluconic acid reductase A"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Yersinia pestis 2,5-diketo-D-gluconic
FT                   acid reductase A DkgA or YPO0676 or y3501 SWALL:DKGA_YERPE
FT                   (SWALL:Q8ZI40) (277 aa) fasta scores: E(): 5.3e-50, 46.71%
FT                   id in 274 aa, and to Corynebacterium sp.
FT                   2,5-diketo-D-gluconic acid reductase A DkgA
FT                   SWALL:DKGA_CORSP (SWALL:P06632) (277 aa) fasta scores: E():
FT                   1.1e-55, 51.5% id in 266 aa"
FT                   /protein_id="CAD66708.1"
FT                   /translation="MVFVLTYVPSVLLGDGVSIPQFGLGTYELPPNETSSVVQSAIELG
FT                   YRHIDTASLYANEREVGRAIASSGIKREEFFVTTKLWNSDQPKPREAFERSLDLLSLDY
FT                   VDLYLIHWPCPPSELYINVWEVLLELKESGRAKSVGVSNFLSEHINKIKEAGFPLPSVN
FT                   QIELHPWLQQRELVLSCRNYGIQIESWGPFARFSKDLDAFPELTRPAKEYGKTPAQVIL
FT                   RWHIQKGYVVFPKTVHAERLRQNIDIFDFDLTPDEISGIDSLDAGFRTGPDPSSFRAGL
FT                   D"
     gtggtgtttg tattgactta tgttcctagc gttctcttgg gtgacggtgt atcgattccc        60
     cagtttggat tgggtaccta tgagcttcct cccaacgaga catcttcggt ggtgcagtct       120
     gcgatcgagt tgggctatcg ccatatcgat acggcttcac tctacgctaa tgagcgagag       180
     gttggccgcg ctattgctag cagcggaata aagcgtgagg agttttttgt cacaacaaag       240
     ctatggaatt ctgatcaacc taagccgaga gaggcgttcg agcgcagcct tgacctcctc       300
     tcacttgatt atgttgattt gtatcttatc cattggcctt gcccgccgag tgagctgtat       360
     ataaatgtct gggaagtgct attggagctc aaggagtcgg gccgtgccaa gtctgttggt       420
     gtgtcaaatt ttttgtccga gcatatcaat aaaataaaag aagcgggctt tccgctgccc       480
     tctgtaaacc aaatagaact tcatccgtgg cttcaacagc gtgaacttgt cttgtcttgc       540
     agaaattatg gcatacaaat cgagtcctgg ggacctttcg cgcgtttttc taaggatctt       600
     gatgcgttcc cggaactgac acgcccagca aaagaatatg gaaaaacccc ggctcaggtc       660
     attttgcgtt ggcatattca gaaggggtat gttgtcttcc caaagacagt gcatgcggaa       720
     cggttgcggc agaatattga tatattcgat tttgacttga ctcctgacga aatatctggg       780
     attgatagcc ttgatgcggg ctttaggacc ggtccggatc cgagcagctt tcgagccggc       840
     ctcgattga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page