(data stored in ACNUC30630 zone)

EMBL: BX251410.DNAN

BX251410.DNAN        Location/Qualifiers
FT   CDS_pept        1767..2900
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="TW002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Streptomyces coelicolor DNA polymerase
FT                   III, beta chain DnaN or SCO3878 or SCH18.15c
FT                   SWALL:DP3B_STRCO (SWALL:P27903) (376 aa) fasta scores: E():
FT                   7.5e-42, 35.46% id in 375 aa"
FT                   /protein_id="CAD66694.1"
FT                   /translation="MKLIVDRGLLSSSVNFVTRMIPARPPSPILSGMLIEAKNEKVTLS
FT                   TFNYETSAKVEFSANVIEGGKVLVPGTLISSISQKLPDEPVEISKEDEKISLTCGPVNY
FT                   ILNLMPIAEYPPLPNLENAEQYRIPSEDFVKSVSQVTTSAAKDDISAVITGINLRLSNE
FT                   SIELTGTDRYRVAVKTLNSVSGHPSDSSVIVSSKTLFEVSKTLGNLESEISVFIKNDGE
FT                   NKVIGFESGNKTVTSLLISGNYPPVAKLFTEETGHYAILKTSDFLESTKRVSVVVERDE
FT                   PIEFSFVKNTVTIKGSGIALASEKVECELFGDEISIMLRPQFLCDGLIACQEDFIKVAF
FT                   TKPSVKNRPGPVLITPKLSNKEKIDFKYLLQPNLFAK"
     atgaagctga ttgtcgatag aggtctcctt agttcctcgg taaatttcgt aacccgtatg        60
     attcctgcaa gacctccatc accaatactg tctgggatgt taattgaggc aaagaatgag       120
     aaagttactc tttcaacttt taattacgag acatcagcaa aagtcgaatt cagcgcaaat       180
     gtaatagaag gcggaaaggt cttagtaccg ggaactctta ttagtagtat ttcgcagaaa       240
     ttgcctgatg aaccagtaga gataagcaaa gaagatgaaa aaatttctct tacctgcgga       300
     cctgtaaatt acatacttaa tctaatgccg atagcagagt atccgccact acctaacctt       360
     gagaatgcag agcagtatag gataccttct gaagattttg ttaaatcagt ctcgcaggtt       420
     acaacatcgg ccgcaaaaga tgatataagc gcagttataa caggaataaa cctaagactt       480
     tctaatgaat caattgaact aacaggaaca gaccgttata gagtcgcggt gaagacctta       540
     aatagcgtat ctggacatcc atctgattca tctgttattg tgtcgtctaa aacccttttt       600
     gaggtttcaa aaacgctcgg gaatttggaa agtgaaatat cagtttttat aaaaaatgac       660
     ggagaaaata aagttatcgg atttgaatcg ggaaataaga cagtaacgtc gctcttaatc       720
     tcggggaatt atccgccagt tgcaaagcta tttacagaag aaacaggtca ttatgcaatc       780
     ctgaaaacaa gtgatttcct ggaatcgaca aaaagggtct ctgtcgtagt tgagagagat       840
     gagccaattg agttttcttt tgtaaaaaat acagttacga taaaaggctc agggatagca       900
     cttgcaagtg aaaaagttga gtgtgaacta tttggtgacg aaataagtat tatgttgagg       960
     ccgcagtttt tatgcgacgg acttattgct tgtcaagagg actttataaa ggttgcattc      1020
     acaaagccaa gcgttaaaaa taggccagga cctgttctta taacaccaaa attatccaat      1080
     aaagaaaaaa tagactttaa gtacctttta cagccaaatt tatttgcaaa ataa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page