(data stored in ACNUC30630 zone)

EMBL: BX251410.DUT

BX251410.DUT         Location/Qualifiers
FT   CDS_pept        312051..312491
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="TW277"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Streptomyces coelicolor deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut or SCO5868 or
FT                   SC2E9.09 SWALL:DUT_STRCO (SWALL:O54134) (183 aa) fasta
FT                   scores: E(): 5.6e-21, 50% id in 130 aa"
FT                   /db_xref="GOA:Q83I22"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I22"
FT                   /protein_id="CAD66951.1"
FT                   /translation="MTVEVLFKGGYTPQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGI
FT                   AIALPDGYAGFIMPRSGLASENGITLVNSPGVIDAGYRGEISVVLINTDLHQAFHISQG
FT                   DRIAQLVIMPVCHASFIEVDTLPGSARGISAFGSSGRHDTRG"
     gtgactgttg aggtgttgtt caagggtggc tacacgccgc agcgcgcttt tgatggtgat        60
     gccggttttg atcttcagtc aagccacaca gcggttatac aaccgcgctg tcgacaggtt       120
     gtaaaaacag gtattgcgat cgcgttgccg gatggctatg ccggttttat catgccacgc       180
     agcgggttag cttctgagaa tggtattaca ctggtcaatt caccgggcgt gattgacgct       240
     gggtatcgtg gtgaaatatc ggttgtgctg atcaatacgg atttgcacca ggcttttcat       300
     atttcacagg gtgaccgaat tgctcagttg gttattatgc cggtttgtca tgcaagtttt       360
     atagaggtcg atactcttcc tgggagtgca aggggcatct ctgcttttgg ttcaagcgga       420
     aggcacgata cacgtggatg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page