(data stored in ACNUC30630 zone)

EMBL: BX251410.DXR

BX251410.DXR         Location/Qualifiers
FT   CDS_pept        complement(98907..100013)
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="TW099"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="Similar to Pseudomonas aeruginosa 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase Dxr or pa3650 SWALL:DXR_PSEAE
FT                   (SWALL:Q9KGU6) (396 aa) fasta scores: E(): 6.2e-42, 40.92%
FT                   id in 391 aa"
FT                   /db_xref="GOA:Q83IC8"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC8"
FT                   /protein_id="CAD66783.1"
FT                   /translation="MQRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLREQ
FT                   AQVFGTKNTAQGASEAAELIEATEADVVLNAITGAAGLLSTYATLKTGKRLALANKESL
FT                   IMGGKYFLDMTSFKGQITPVDSEHSAIAQAMKSGKFSEVNKLILTASGGPFYDRESLEG
FT                   ITLKDALDHPTWNMGPMISINSATMFNKGLEIIEAHLLFGIPYSQIDVVIHPQSIVHSM
FT                   VEYKDGSVIAQASVADMTLPIGYALSWPNRALNAVRPLEWGARQRWDFLPPTENSMRSI
FT                   NLARRAGEAGGVYPAVLNASNECAVEAFMAGKISFARIIHVTETVFNLYTKQHTNRESA
FT                   KNPIEVILEEDARTRELAKTVIENMSAD"
     gtgcagaggg taataattgt tggctcaacc ggatctatag gaacacaagc gattgacttt        60
     atcttaaaaa atcgcgatag ttttctggtt gtagggctcg ctgcgagcac gcaaacaagt       120
     cttcttcgag agcaagcgca agtatttggc acgaaaaaca cagcacaggg tgcgagcgaa       180
     gcggcagagc ttatagaagc taccgaggcg gatgttgtgc taaacgccat aaccggcgcg       240
     gctggattat tatctacata cgctacgctc aagaccggca aacggcttgc gctggcgaac       300
     aaagaatcat tgattatggg cgggaaatat ttcctagaca tgacaagctt caaaggtcaa       360
     ataacgccgg ttgattcaga gcattctgcg atagcgcagg ccatgaagtc cggaaaattc       420
     tccgaggtaa ataagctcat cctgacagct tcgggtgggc ctttttatga cagggaaagc       480
     ctggagggta taactcttaa agatgcccta gaccatccca catggaatat gggacccatg       540
     ataagtataa attccgcaac aatgttcaat aagggtcttg agattattga agcgcatcta       600
     ctatttggta ttccgtactc gcaaatcgat gttgtgattc acccacaatc aattgttcat       660
     tcaatggtcg agtataaaga cggatctgtt attgcacagg cctctgttgc agatatgacc       720
     ctgccaatag ggtatgccct gagttggcct aaccgagctt taaatgcggt tagaccactt       780
     gagtggggtg caaggcagag gtgggacttc ctgccaccaa cagaaaactc aatgaggagt       840
     atcaatctcg cacggcgagc cggtgaagcc ggaggggttt atcccgctgt cctgaatgcc       900
     agcaatgaat gtgcagtaga ggcatttatg gctggcaaaa tatcctttgc aaggataatc       960
     catgtaacag aaacggtttt taacctctat acaaaacaac atacgaaccg cgagtcggcg      1020
     aaaaatccaa ttgaggtcat tttagaagag gatgcccgaa ccagagagct agccaaaaca      1080
     gttatagaga atatgagcgc tgactga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page