(data stored in ACNUC30630 zone)

EMBL: BX251410.DXS

BX251410.DXS         Location/Qualifiers
FT   CDS_pept        313747..315636
FT                   /transl_table=11
FT                   /gene="Dxs"
FT                   /locus_tag="TW280"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /EC_number="4.1.3.37"
FT                   /note="Similar to Streptomyces sp. 1-deoxy-D-xylulose
FT                   5-phosphate synthase Dxs SWALL:DXS_STRC1 (SWALL:Q9RBN6)
FT                   (631 aa) fasta scores: E(): 3.4e-117, 49.75% id in 621 aa"
FT                   /db_xref="GOA:Q83I20"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I20"
FT                   /protein_id="CAD66954.1"
FT                   /translation="MCTKRQYGLLESIRSPRDLDSFTPHQLDELECQVRDFLIQSVAKT
FT                   GGHLGSNLGVVELSIALHRSFRSPEDCIIFDVGHQCYVHKLITGRHDFKALRCKNGLSG
FT                   YPSRHESNHDIVENSHASAALSWADGVSRARTLLGNDNYVIAVVGDGSLTGGMCWEALN
FT                   NISDDNNRRLVIVVNDNGRSYARTIGGIARFLNAVRASKSYLWLRESSEAVFSHMGSPG
FT                   RRLYQGIRGAIHGFLSRFSSSNKLFSNLDIRYLGPINGHNRKALEKAFKQAKQYARPII
FT                   VHVITEKGHGYPPALEDALDCLHTVGVIDPSTGKSASVQGQVRQDTWTGVFGEELLRLA
FT                   ESNTNIVAVTAAMLHPTGLSMFAEKFPHRVFDVGIAEQHAVASAAGLAYEGLHPVVAIY
FT                   STFMNRAFDQVMMDVALHGAPVTFVLDRAGITGPDGASHHGIWDLSLLRIVPGIKLYAP
FT                   RDASTLRNTLALVCSEDCPTAIRFPRGSVCDDLPALRSLDDGIDVLYGSCDREDIVIVA
FT                   IGVMAHACVRAAQLLAESGIESTVINPVCFWPLHRQVLARVSKAKLVVLAEEGAKSPGL
FT                   GDYIAGRRLLEFVIPGDFQPQGSRDELLDAIGLNGEHIARKIKARFNQIINCV"
     atgtgtacaa aacggcagta tggtctactt gaaagtatac gaagcccaag agaccttgac        60
     tcttttaccc cgcatcagct tgatgagctt gagtgtcagg tgcgcgattt tctcatccaa       120
     agtgtcgcaa aaaccggtgg gcatctgggg tcgaatcttg gcgttgtcga gctgagcata       180
     gcgctacaca ggtcatttag atctcccgaa gactgcataa tctttgatgt cggtcatcag       240
     tgctatgttc acaagctaat aaccggcagg cacgatttca aagctttacg gtgcaagaat       300
     gggctatccg gttatccgtc acgacatgaa tcaaaccacg atattgtcga aaactctcat       360
     gcttccgctg cacttagctg ggcggatggc gtgtcacgtg ctcggactct gttaggtaat       420
     gacaattatg ttattgctgt tgtcggcgat gggtcactga caggcgggat gtgctgggag       480
     gcgctaaata acatcagcga cgacaataac cgccggcttg taatagttgt caacgataat       540
     ggacggtcgt atgctcgtac aattggcggt atagcacgat ttttgaatgc ggttcgtgca       600
     agtaagagtt atttgtggct cagggagtca agcgaagcgg tgttttcgca tatggggtca       660
     cccgggcggc gcctgtacca ggggattaga ggggcaatac atgggttctt gagccgcttt       720
     tcaagctcaa ataagctttt ctcgaatctt gatatccggt atttaggacc gataaatggc       780
     cataatcgca aagctcttga gaaggcattc aaacaggcga agcaatatgc acgcccaatt       840
     attgttcacg tgataacaga aaagggtcat ggatatcccc cagcgctcga ggatgctctg       900
     gattgtcttc acactgttgg tgtaatagat cccagcactg gtaaatccgc ctctgtgcag       960
     ggccaagtgc gtcaagatac atggactggc gtctttgggg aagagctttt gcggcttgcc      1020
     gagagcaata caaacattgt tgctgtcacc gctgccatgc tacacccaac tggcctttcc      1080
     atgtttgctg aaaaatttcc acacagggtt ttcgatgttg gtattgcgga gcagcatgcc      1140
     gttgcatctg ccgctgggct tgcgtatgaa gggctacatc cggttgttgc gatttattca      1200
     acctttatga atagggcctt tgatcaggtt atgatggatg ttgccttaca tggcgcaccg      1260
     gtaacgttcg tccttgatag ggcagggata acaggtcctg atggggctag ccaccacgga      1320
     atttgggacc tttcgctttt gcgaattgtg ccaggtatta aactttatgc tccacgggat      1380
     gctagcacat tgagaaatac cctcgcgctt gtctgctccg aagattgtcc tactgctata      1440
     cgtttcccaa gagggagtgt ttgcgacgat cttccggctt tacgttctct ggacgacgga      1500
     attgatgtgc tctatggatc ttgcgatcgc gaagatatcg ttattgttgc cattggcgtt      1560
     atggcacatg catgcgttag agctgcccaa ttactggcag agtctggaat agaatcaact      1620
     gttataaatc ctgtttgctt ctggccccta cataggcagg tcctggccag ggtgtcgaag      1680
     gcaaagctgg ttgtgcttgc tgaagaaggg gcgaaatcac ccggtcttgg tgactatatt      1740
     gccggaagac gattgttaga atttgtgatc ccaggggatt tccaacccca gggatcacgc      1800
     gatgagttac ttgatgcaat tggtttaaat ggggagcata ttgcccgtaa gataaaggcc      1860
     cggttcaatc aaattatcaa ttgcgtgtaa                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page