(data stored in ACNUC30630 zone)

EMBL: BX251410.FTSH

BX251410.FTSH        Location/Qualifiers
FT   CDS_pept        213988..215988
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="TW173"
FT                   /product="FtsH-like putative cell division protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="Similar to Streptococcus pneumoniae cell division
FT                   protein FtsH or sp0013 SWALL:FTSH_STRPN (SWALL:O69076) (652
FT                   aa) fasta scores: E(): 2.5e-86, 54.38% id in 502 aa, and to
FT                   Streptomyces coelicolor cell division protein FtsH homolog
FT                   FtsH2 or SCO3404 or SCE9.11c SWALL:Q9X8I4 (EMBL:AL049841)
FT                   (668 aa) fasta scores: E(): 4.5e-119, 55.12% id in 664 aa"
FT                   /protein_id="CAD66852.1"
FT                   /translation="MSKITKSPVLYIVLLVVGVWVAVNLFLTNAYQSIRTEEGLELIKS
FT                   DSLVSVRIVDRDQRVDLELATPYKNHGTKVQFNYVSQRATEIVNAVNKAKIKDGFTDEV
FT                   PAPSVWGSIISMLLPIAAIGLFLWFMAGPQAAGGRGIAQFSRMRSRLVSKEMPKVRFTD
FT                   VAGADEAVEELQEIKDFLSDPDKYRKLGARIPKGVLLFGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFEQAKQNSPSIIFIDEIDAVGRRRGSGFGGGHDER
FT                   EQTLNQLLVEMDGFDVKTNIILIAATNRSDVLDSALLRPGRFDRHVAIDAPNLQGRLKI
FT                   LQVHARTKPVSKSVDLEVLARKTPGFTGADLANVLNEAALLTARSNAQIIDDRALDEAV
FT                   DRVMAGPQRRSRVMTDHEKLVTAYHEAGHALTAAAMRYSDPVTKVTILPRSRALGYTMV
FT                   MPVQDRYSVTRNELLDKLAYAMGGRAAEELVFHDPTTGASNDIEKATSIARKMVTEFGL
FT                   SKDLGAVKFGNAHNETLMGVGQMTARDYSEVTAERIDVQVRALIQNARDEAWEVISNNR
FT                   NLLDDLALNLLEKETLNQDEIAEIFKGVRKLPERHVWQSAPNREPSNKPPVKYSAMGPD
FT                   SEVTAKSPKRTSNRRRLPSARRPRKDSETQE"
     ttgtcgaaga taacaaaatc ccctgtgctc tatatcgtgc tccttgttgt gggggtttgg        60
     gtcgctgtca atctgtttct cacaaatgca tatcaatcta tacgcaccga agaggggtta       120
     gagctgataa aaagcgactc cctggtgtcc gtgaggatag ttgacagaga tcagagggtt       180
     gatctggagc ttgcgacccc ctacaagaac cacggaacaa aagtacagtt caattatgtc       240
     agtcagcgtg ctaccgagat cgtaaatgcc gtaaacaaag caaaaataaa ggatggcttt       300
     acagatgaag tgccagcgcc cagtgtctgg gggtctatta tcagcatgct attgccaatt       360
     gctgcaattg gactatttct ctggtttatg gcaggtccgc aagctgccgg cggccggggg       420
     attgcccagt tttctaggat gcgctcacgt cttgttagca aggaaatgcc caaggtgcgt       480
     tttacagatg ttgcaggcgc cgatgaagcc gttgaggagc ttcaggagat aaaggatttt       540
     ctaagcgacc ctgataaata ccgcaaactc ggtgcgcgta tcccaaaggg ggttttactg       600
     ttcggacctc cggggaccgg aaaaaccctt ttggctcgtg cagttgccgg tgaggccggc       660
     gtcccgtttt tctcaatttc cggttctgat tttgttgaga tgtttgttgg tgttggtgca       720
     agtcgcgtca gggatttgtt tgagcaagcg aagcagaatt ctccttcgat aatatttata       780
     gacgaaattg acgccgtggg tcgccgccgt gggtcaggct ttggtggtgg tcatgatgaa       840
     cgcgaacaga ccctcaatca gcttttggtt gagatggatg gattcgatgt taaaacaaac       900
     ataatactca ttgccgcaac aaacaggtct gatgttctcg actctgcgct attgcgcccc       960
     ggtcgttttg accgacatgt tgcaattgat gcgccaaatt tgcagggtcg cctaaaaata      1020
     cttcaagttc atgcacgcac gaagcctgtt agtaagtcgg ttgatcttga agtgttagct      1080
     cgtaaaaccc ctggctttac aggcgcagat cttgccaatg ttttaaatga ggctgcgctt      1140
     cttacagcca ggagcaatgc ccagataatc gatgaccgcg cgcttgatga ggctgttgat      1200
     cgggttatgg cagggcctca acgccgcagc agggttatga cggatcacga aaagcttgtt      1260
     acggcttatc acgaagctgg acacgccttg accgccgcgg ctatgcgtta ttcggatccg      1320
     gttacgaagg tcactattct tccgcgcagc agggccctag gttacacgat ggttatgccg      1380
     gtccaggatc gctactcagt tacgcgcaat gaattacttg acaagttggc atatgcaatg      1440
     ggaggtcgcg ccgcagagga gcttgtcttt catgacccca cgacaggtgc aagtaatgat      1500
     attgagaagg caaccagtat cgcccgcaag atggtaaccg aatttggtct tagtaaagat      1560
     ttgggtgcag tgaaatttgg taacgcacat aacgaaacgc ttatgggtgt aggtcaaatg      1620
     accgctcgtg attattctga agttactgcg gaaaggattg atgtccaggt tcgggcgctt      1680
     atacagaatg cccgtgacga ggcttgggaa gtgataagca ataatagaaa cctcttggac      1740
     gatttagccc taaatcttct tgagaaagaa actctgaatc aggatgaaat tgctgagatt      1800
     ttcaaaggtg ttcgcaaatt gcctgagcgt catgtttggc agtccgcccc taatcgcgag      1860
     ccgagtaata aaccacccgt aaagtacagt gcgatggggc ccgattccga agtgaccgca      1920
     aaatcgccaa agagaacttc caacagacgt aggttgcctt cagcaaggcg cccgaggaag      1980
     gattcggaga ctcaggaata a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page