(data stored in ACNUC30630 zone)

EMBL: BX251410.FTSY

BX251410.FTSY        Location/Qualifiers
FT   CDS_pept        242928..243596
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="TW205"
FT                   /product="putative SRP54-type protein"
FT                   /note="Similar to Escherichia coli cell division protein
FT                   FtsY or b3464 SWALL:FTSY_ECOLI (SWALL:P10121) (497 aa)
FT                   fasta scores: E(): 4.8e-30, 47.32% id in 224 aa"
FT                   /protein_id="CAD66882.1"
FT                   /translation="MREYLECRLSSFDPTLRLTNHPSVILIVGVNGVGKTATAGKLANL
FT                   LHLRGKKVLLAAADTFRAAAVEQLSIWAQRAGVEIITPPKPRIDPASVAYSSVKKAIDD
FT                   NYDVVVIDTAGRLHNKANLMAELERIARVTEKLVSIDEVLLVLDATTGQNGLTQARSFL
FT                   EAVSVTGIVLSKTDSSAKAGFIFQVQESTGVPVKLIGTGEAIDDIAGFAPYAFVAQIFG
FT                   "
     ttgcgggagt atcttgaatg ccggctatct tcctttgatc ctacgctgcg actcacaaat        60
     cacccgtctg ttatccttat cgtcggcgtt aatggggttg gcaagactgc gaccgctgga       120
     aagcttgcaa atcttttaca tctacgaggc aagaaggtcc tgttagctgc tgctgacacc       180
     tttcgagctg ccgctgttga gcagcttagt atctgggctc agcgcgcagg tgttgaaata       240
     attacccccc ccaagccacg catagatccg gcatccgttg catattcttc cgtcaaaaag       300
     gcgattgatg ataattatga tgttgtggtt attgacaccg cggggcgtct tcacaataag       360
     gcaaatctca tggctgagct cgagagaata gcgcgggtta ccgaaaagct tgtcagcata       420
     gatgaggtct tactggtgct tgatgcaact accggacaaa atggcctgac tcaggctaga       480
     tcattccttg aggctgtgag tgtaaccgga atagtcttat ccaagactga ctcgtccgca       540
     aaggcgggtt ttatttttca agtgcaggag agcacgggcg tgcctgtaaa gctcattggc       600
     acaggtgaag caattgatga tatagcaggt tttgcaccat acgcatttgt tgcgcagatc       660
     ttcggttag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page