(data stored in ACNUC30630 zone)

EMBL: BX251410.GCP

BX251410.GCP         Location/Qualifiers
FT   CDS_pept        209856..211061
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="TW170"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Similar to Pasteurella haemolytica
FT                   O-sialoglycoprotein endopeptidase Gcp SWALL:GCP_PASHA
FT                   (SWALL:P36175) (325 aa) fasta scores: E(): 1.5e-13, 36.97%
FT                   id in 384 aa, and to Streptomyces coelicolor probable
FT                   O-sialoglycoprotein endopeptidase Gcp or SCO4752 or
FT                   SC6G4.30 SWALL:GCP_STRCO (SWALL:O86793) (374 aa) fasta
FT                   scores: E(): 4.3e-20, 43.71% id in 398 aa"
FT                   /db_xref="GOA:Q83I95"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I95"
FT                   /protein_id="CAD66849.1"
FT                   /translation="MSIILGIETSCDETGVGIVSGSTVLANEVASSSLRHKPFGGVIPE
FT                   IAARAHLEYLPNLLELALETAQLCIKDIDGIAVTAGPGLVTSLSVGVSAAKALGLSTGT
FT                   PVYGVNHLVGHAVSAFLDDYTNDGLGVIHRRDSIGSNGIENDASSTHSHTHTTQVNRHS
FT                   NLCVYTPPRRVLRDVCKYMHVRDSVVLLASGGHSCLLKIHNNKISLLGETLDDAAGEAF
FT                   DKIARLMGLQYPGGPAIEMLASSGNPNAVEFPRALLTHFEEHNRYSFSFSGLKTAVGRV
FT                   VERIKSNPAHSIPKIEDIAASFQEAVADVLTAKTVAAALASDVDLIVMGGGVAANNRIR
FT                   EMLCERAKIHGLDVKIPPIALCTDNGAMIAAAGSWLMQLGYNPSHSRFSPVSIMPLTQM
FT                   VV"
     gtgtctatta tcctcggaat cgaaacatct tgcgatgaaa caggtgttgg catagtgtct        60
     ggttcaactg ttcttgcaaa tgaggttgcc tcatcaagct tacgccataa accttttggc       120
     ggtgttatcc ccgaaatagc tgctcgggcg catcttgagt atttgccaaa tttgcttgaa       180
     ttggcgcttg agacggcaca gctctgtatt aaagatattg atggtatagc tgttaccgca       240
     ggccctggac ttgttaccag tctttctgtt ggcgtttctg cggccaaggc tttgggatta       300
     tctacgggga cgcctgttta tggtgtaaat catcttgttg gacatgccgt atcggctttt       360
     ctggatgatt acactaatga tggccttggt gttattcacc gcagggacag tatcggatct       420
     aatggaattg agaatgacgc cagttcgaca cactcacata cgcatacaac gcaggtaaac       480
     agacattcaa acctgtgtgt ctatacacct ccccggcgtg ttttacgaga tgtttgtaag       540
     tatatgcatg tcagagattc agttgttttg cttgcatcag gtgggcattc ctgtctgttg       600
     aaaatacata acaataagat atcgctttta ggtgagacac tggatgatgc agccggtgag       660
     gcgtttgaca aaatcgcaag acttatgggc cttcagtatc ccggaggtcc tgcgattgag       720
     atgcttgcca gttcgggtaa ccccaatgcc gtggagtttc caagggcgct gttgacgcat       780
     tttgaagaac acaacaggta tagtttttct ttttcagggt tgaaaaccgc ggttggtagg       840
     gttgttgaaa gaataaagag taatccagcc cattcgatac ccaagataga agatattgct       900
     gcaagttttc aggaagccgt tgcagatgtt ttgacagcaa aaactgtagc ggctgccttg       960
     gccagtgatg tggatctaat agttatgggt ggtggggtag ctgcaaataa tcgcattaga      1020
     gagatgcttt gcgaaagagc gaaaatccac ggcttggacg taaagatccc acctattgcg      1080
     ctgtgcaccg ataatggtgc aatgattgcc gccgctggct cgtggcttat gcagctggga      1140
     tacaatccga gtcattcaag gttttcgccc gtatcgatta tgccgctaac ccagatggtt      1200
     gtgtga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page