(data stored in ACNUC30630 zone)

EMBL: BX251410.GCVP

BX251410.GCVP        Location/Qualifiers
FT   CDS_pept        155275..158181
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="TW144"
FT                   /product="glycine dehydrogenase [decarboxylating]"
FT                   /EC_number="1.4.4.2"
FT                   /note="Similar to Escherichia coli glycine dehydrogenase
FT                   [decarboxylating] GcvP or b2903 SWALL:GCSP_ECOLI
FT                   (SWALL:P33195) (956 aa) fasta scores: E(): 4.4e-106, 48.71%
FT                   id in 973 aa, and to Mycobacterium tuberculosis probable
FT                   glycine dehydrogenase [decarboxylating] GcvP or GcvB or
FT                   Rv1832 or mt1880 or mtcy1a11.11C SWALL:GCSP_MYCTU
FT                   (SWALL:Q50601) (941 aa) fasta scores: E(): 2e-114, 51.27%
FT                   id in 981 aa"
FT                   /db_xref="GOA:Q83IA7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA7"
FT                   /protein_id="CAD66824.1"
FT                   /translation="MHERHIGPSQEEIDHMLGFLGYKSLDDLMHAALPNGVQSPPDIKI
FT                   PSHDELTCLTQLAAFAKMNRIKTSMLGQGFYNCITPAVIRRNILENPSWYTSYTPYQPE
FT                   ISQGRLEMLINFQTMICDLTGLEIANASMLDEASCAAEAMLLAKRVSRSSSNKYLVHNG
FT                   VFPHIRRVLETRADAVGVEIVDLPEGQSIDFDHFGVYAQYQSASGKLLDLRPLFSRSKR
FT                   AGAICVIGCDLLMLTLFTSPGELGADIAFGSAQRFGIPMNFGGPLASFLAARKAMERSL
FT                   PGRLVGVSVDADSNHAYRLTLQTREQHIRREKATSNICTATVLMAIAAVAFAQHHGPKG
FT                   LRAIAHRINTVAVGFARLLKQTAFRVSSLDIFDTIEINNPTQVCVEAESKYDLLFWKVD
FT                   DNKLRITFDEVTARLDGDLPERLSKVFGISPDKIRDLGCNYDSCDCSFYGDLQQAREGL
FT                   SSVASRNISVHSDLARHPLRRFSGYLKHPVFNNYTGEVALMRYLKALSDKDFALDRGMI
FT                   PLGSCTMKLNAAFQLEPVLWPEFANLHPFAPLGDADGTLQIIDQIETWLANLSGYDAVS
FT                   LQPTAGSQGELAGLLAIRGYYKSLNLDRDVCLIPASAHGTNAASAVLAGMRVVVVACDQ
FT                   QGNIDLDDLRLKASKNAHALAALMVTYPSTHGVYEDNISEVCSVVHKYGGQVYVDGANS
FT                   NALIGYLRTGDFGGDVSHLNLHKTFGIPHGGGGPGIGPVVAKAHLAPFLPFRNRVHKPS
FT                   TDLPAVKHMGGPIASSDYGFAGALYISWAYIFCLGSQGMKRCTAVAVLVANYIAKQLSD
FT                   TFPVLYTGKNNLVAHEFIMDFREVTRVSGITVDDVCKRLIDYGFHAPTMSFPVPGTLMV
FT                   EPTESEPFSEIQRFIKTIRSIRAEIDRVIDKTYDPDNNPLKRAPHTLEQIASDKWDRPY
FT                   SRRTGIVYTSGKYWPASARIDNAYGDRNIFCTCPDLPD"
     atgcatgaga ggcatatcgg cccgagccaa gaagagattg atcacatgct tggctttctt        60
     ggttataaga gccttgatga tctcatgcat gctgcgcttc caaacggcgt acagtcgcca       120
     ccagatatca agatcccgtc acacgatgag ctaacctgcc tcactcagct agcggcgttt       180
     gcgaagatga atcggataaa gacatcgatg cttggccagg ggttctataa ctgtattact       240
     cccgcggtta tacgcagaaa tatccttgaa aatccgtctt ggtacacgtc ttatacgccg       300
     tatcaacctg agatttctca gggtcgcctt gagatgctga tcaattttca aaccatgatt       360
     tgcgatctaa ccggcctgga aatagctaat gcatcaatgc tagatgaggc gtcatgcgcc       420
     gcagaggcga tgcttctggc aaaaagagtc tctagatcta gttccaataa gtatctcgtt       480
     cataacggtg tatttcccca tatccgaagg gttcttgaaa ctcgtgccga tgctgttggc       540
     gtggaaattg tggatctgcc cgagggtcaa tcaatagatt ttgaccattt cggtgtttat       600
     gcacaatacc agtcggcttc tggtaagttg cttgatttgc gccccctgtt ttctaggtcg       660
     aaacgtgcag gcgcaatttg tgttatcggg tgtgacctgc tgatgcttac acttttcaca       720
     agtcccggtg agcttggtgc agacatagca tttggctcag ctcagcgctt tggtattccg       780
     atgaatttcg gtggaccctt ggcatctttc cttgcggccc gtaaagcaat ggaacgctct       840
     cttccgggtc ggcttgttgg tgttagcgtt gatgctgact cgaaccatgc ctacagactg       900
     actttacaga caagagagca acatattcgc cgcgagaagg caacatcgaa tatttgtacg       960
     gcaaccgttc taatggcaat tgccgctgtg gcttttgcgc aacatcatgg cccaaagggt      1020
     ttgcgtgcaa tagctcatag gataaacacg gttgctgtgg gttttgcccg cctcttgaag      1080
     caaacggctt tcagggtgtc atccttggat atattcgaca ctatcgaaat aaacaatcca      1140
     acacaggtct gcgtcgaggc tgaatcaaaa tacgatctct tgttctggaa agtcgatgat      1200
     aataaactca ggattacctt tgatgaggta acggctagac tggacggaga tttgccagag      1260
     agactgtcaa aagtcttcgg catatccccc gacaagatta gagatcttgg gtgtaattac      1320
     gattcatgtg attgttcttt ttatggcgat ttgcagcagg cccgcgaagg cttgagttca      1380
     gttgcatcgc gaaatatttc tgttcattca gatctcgccc ggcatccact caggcgcttt      1440
     tcaggttatc taaaacatcc tgttttcaat aactacactg gcgaggttgc tctaatgcgg      1500
     tatttgaagg ctttgtcgga taaagacttt gcccttgaca ggggaatgat accgctcggg      1560
     tcgtgcacta tgaagctaaa tgcggcgttc caattagaac cggtgttatg gccagaattt      1620
     gcaaatctac atcccttcgc acctctggga gatgctgacg ggacactgca aataatcgat      1680
     caaatagaaa cgtggcttgc aaatttaagt ggatatgatg ctgtatcttt acaacccacc      1740
     gccggcagtc aaggcgaact cgctgggttg ttggccattc gcggctacta caagtcttta      1800
     aaccttgatc gggatgtctg cctaattcct gcaagcgcac atggtaccaa cgcggccagt      1860
     gcggttctcg ctggcatgcg cgttgttgtg gttgcctgcg atcaacaggg caatatagat      1920
     cttgatgatc taaggcttaa ggcgtcaaaa aacgcacatg cgcttgcagc tctcatggta      1980
     acttacccct caacacatgg ggtctatgag gacaatattt ccgaggtatg ctctgtggtt      2040
     cacaaatacg gaggacaggt ttatgttgac ggtgcaaatt ccaatgccct gatcggatat      2100
     ctgaggacgg gtgattttgg cggtgatgtg tcacatctga atcttcacaa gacatttggc      2160
     attccccacg gcgggggtgg tccaggaatt ggccccgtcg ttgccaaagc acacttggct      2220
     ccctttttac ccttcaggaa ccgagtgcat aaaccatcta ctgacttacc tgctgtgaaa      2280
     catatgggtg ggcccattgc gtcgagtgat tacggctttg ccggcgcttt gtatatcagc      2340
     tgggcctata tattttgcct cggctcgcag ggaatgaagc gttgcactgc tgttgccgtt      2400
     ttggttgcta attacatcgc aaaacagctt tccgatacat ttccggtttt atatacaggg      2460
     aaaaataatc ttgttgcgca tgagttcatt atggacttta gggaagtaac aagggtaagc      2520
     ggaattacgg ttgatgatgt gtgtaaacga cttatcgatt acggttttca tgccccaaca      2580
     atgtcttttc cggttcctgg aaccttaatg gttgagccaa cagaatccga gccattttct      2640
     gaaattcagc ggttcataaa aactatccgt tcaattcggg ctgaaatcga ccgggtaata      2700
     gacaagacgt atgatccaga taataacccc ctgaagcgcg ccccacacac tctggagcag      2760
     attgcatcgg ataaatggga taggccatat tcacggcgta caggcattgt ttatacctcg      2820
     ggaaagtact ggcccgcatc tgcgcggatt gataatgcat atggtgatag aaatatcttt      2880
     tgcacatgcc ctgatttgcc ggattaa                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page