(data stored in ACNUC30630 zone)

EMBL: BX251410.GLMS

BX251410.GLMS        Location/Qualifiers
FT   CDS_pept        184178..186028
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="TW158"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing]"
FT                   /EC_number="2.6.1.16"
FT                   /note="Similar to Escherichia coli
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing] GlmS or b3729 SWALL:GLMS_ECOLI (SWALL:P17169)
FT                   (608 aa) fasta scores: E(): 9.8e-90, 42.23% id in 618 aa,
FT                   and to Streptomyces coelicolor
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing] GlmS or SCO4740 or SC6G4.18 SWALL:GLMS_STRCO
FT                   (SWALL:O86781) (614 aa) fasta scores: E(): 1.5e-125, 53.73%
FT                   id in 616 aa"
FT                   /db_xref="GOA:Q83IA1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA1"
FT                   /protein_id="CAD66838.1"
FT                   /translation="MCGIIGYSGPRPAAEVLLKGLERLEYRGYDSAGIAVVTDKAYIES
FT                   VKKSGKLNVLKTCLERRTTPIVGSTGIGHTRWATHGEPSDRNAHPHMDTEQSLAIVHNG
FT                   IIENSDVLKRELLASGKSFTSETDTEVVAHLLSDAFKKTQDLVQAFVEVTQRLEGAFAV
FT                   VAIHKDQPNTIVAAKNNSPLLLGFGQGENFLASDIAAFAEYTQRVANIDQERIVALSGD
FT                   SVYITDFAGHPVDYEVHTVSWHPASVDSSGWSSFMLKEIFEEPQAVENTLKGRTEDGTV
FT                   ILPECDHIRDDLLAIDRVVLVGCGTAAYAAMTASYSIEAWAGLPVSVELSHEFRYREPV
FT                   LNSKTLAVFISQSGETMDSLMAVRYARQAGVKTISVCNVMDSSIPKESHAVIYTKAGPE
FT                   VAVASTKSFVCQIVVLYLLALYLGQLRGFRSIFPRQKAVCELNRLPVKLKQVLEIYESV
FT                   RQLAHWMSDSRSILFLGRHAGYPIALEAALKLKELAYIHAEGFAAGELKHGPIALIEPG
FT                   QPVFVIVPSPVGSPILHAKVISNIREIKSRGARIIAIAAEGDSAVLPHADSVLRIPLTR
FT                   YSFEPLLSIVPLQIFALELAADKGFDVDRPRNLAKSVTVE"
     atgtgtggga tcattggtta ttctggcccg cgccctgcgg cagaggttct gttaaaaggc        60
     ttagagcgcc ttgaatacag gggctacgat tctgcaggta tcgcggttgt aacagataaa       120
     gcttatattg agagcgtaaa gaaatccgga aagcttaatg tcctaaaaac atgccttgaa       180
     aggcgcacaa cacccattgt tgggtctaca ggaattggcc atacgcgatg ggcaacccac       240
     ggcgaaccca gtgatagaaa tgcgcatcca catatggata cagaacagag cttagcaata       300
     gttcacaacg ggatcataga aaacagcgat gttttaaaaa gggaactact tgcgtcggga       360
     aaaagcttca caagtgaaac agacacagag gtcgttgcgc atttactgtc tgacgctttt       420
     aagaaaacac aagatctggt tcaagcattt gtagaagtta cgcagcgact cgaaggtgcg       480
     tttgcagttg ttgcaattca caaagatcag ccgaatacca ttgttgctgc caaaaataat       540
     tcaccgctgc tattaggatt tggtcagggt gagaatttcc tggccagtga tattgctgca       600
     tttgcagaat atacacagcg tgtggcaaat attgatcaag agcgaatagt cgctctatca       660
     ggtgattctg tttacataac tgattttgct gggcaccctg tcgattatga agtacatacc       720
     gtaagctggc atccggcatc tgttgatagt tccggctggt catcttttat gcttaaagag       780
     atctttgaag aaccacaagc tgttgagaat accctgaaag ggcgcacgga ggatggcaca       840
     gtcatcctgc cagaatgtga tcacatccgg gatgacctgc ttgcaataga tagggtagtg       900
     cttgtgggct gcggaacggc cgcctacgcg gcaatgactg ctagttactc tatcgaagcc       960
     tgggcaggtt taccagtgtc tgttgagtta agccacgaat ttagataccg cgaaccggtt      1020
     cttaattcaa aaactttagc tgtatttata agtcagtccg gggaaaccat ggacagcctg      1080
     atggccgttc ggtatgcgcg gcaggctggg gtcaaaacca tttctgtttg taatgtaatg      1140
     gacagttcta ttccaaaaga aagtcatgct gtgatatata ccaaagccgg ccccgaagta      1200
     gctgttgcga gtacaaagtc ttttgtctgt caaattgttg ttttgtactt gttggcacta      1260
     taccttggac agttgcgtgg ctttcggtcg atttttccaa gacagaaagc ggtttgcgag      1320
     ttaaatcgct tgccggtaaa actgaaacag gttctggaga tttatgaaag tgttcgtcag      1380
     cttgcgcatt ggatgagcga ttctcgctca attctgtttt taggtcgaca tgcaggctat      1440
     ccgattgcac tagaagcagc actgaagcta aaagagctcg cgtatataca tgctgaggga      1500
     tttgctgccg gtgagctgaa acacggcccg attgccttga ttgagccggg acagccagtt      1560
     tttgtaatag ttccatcacc ggttggttcg ccaattttgc acgcgaaggt tatttcgaat      1620
     attcgagaaa taaaatcccg tggtgctagg atcattgcta ttgccgcaga gggcgactcg      1680
     gctgttttac cacacgctga tagcgttttg aggataccgc ttacgcgtta cagttttgag      1740
     ccacttttat ctatagtacc cctgcagatc tttgcccttg agctagccgc tgataagggg      1800
     tttgatgtcg atcgccccag aaatctggcc aaaagcgtta cagttgagtg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page