(data stored in ACNUC30630 zone)

EMBL: BX251410.GLYQS

BX251410.GLYQS       Location/Qualifiers
FT   CDS_pept        complement(293012..296086)
FT                   /transl_table=11
FT                   /gene="glyQS"
FT                   /locus_tag="TW262"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Chlamydia pneumoniae glycyl-tRNA
FT                   synthetase GlyQS or GlyQ or cpn0946 or cp0913
FT                   SWALL:SYG_CHLPN (SWALL:Q9Z6W0) (1010 aa) fasta scores: E():
FT                   8.9e-78, 30.52% id in 1055 aa, and to Arabidopsis thaliana
FT                   aminoacyl-t-RNA synthetase precursor Edd1 SWALL:O23150
FT                   (EMBL:AJ003069) (1067 aa) fasta scores: E(): 1.1e-100,
FT                   39.47% id in 1021 aa"
FT                   /protein_id="CAD66938.1"
FT                   /translation="MQKHTPRMQDTILILQTYWAHRGCLVFQPMNTEVGAGTANPATLL
FT                   GVLGDKTWGVAYVEPCVRPDDSRYGINPSRLQCHTQFQVLLKPEPGNPQEMYLESLEAI
FT                   GIDLKKHDIRFVEDNWESPALGAWGLGWEIWLDGLEITQFTYFQQVGGVPLKTSAVEIT
FT                   YGIERIMMALQKVSHFKDIEYSKNISYGELFAQNEREMSAYYLEKANIERNKQLFEIYS
FT                   DEAKMLLRAGLPLPAYTFVLKCSHVFNILDARGAISTAERAKAFSLMRTLTKEISATWV
FT                   ESRSNGEVSDDTVHTKGIDIAIEKPPDMKDPVTKGPETVLFEIGTEEMPSTQEIITTVE
FT                   NTLREKLGRSQLKFEKYSVDATPRRIVIRIYKMHPRQSDSSVRIRGPKVEAAFDDDKKP
FT                   TDALTGFLKANGKSLDEIEIAVHKNRRHVFITKNIPGQSAAKLLEQIFAEIVLEIRSSR
FT                   NMRWNDPKLVFSRPIRWLVALYGQRQLNVRVSLLESGMHTRVLRNSKTPIVPVKAADNY
FT                   EEFLTRNGVILSRSKRREIIFESANLAAKSVSCEIDFSTQPIEEITDLVEAPSLVICRF
FT                   EKKYLELPEVVLNAIMKKQKYITLSEKCATCKRIQREKCDQKTISQHFITFANGLCDKE
FT                   TVRSGNEAVIRTRFEDALFFQEADSKLSPENLYKMLDGLVYEEKLGSYLQKSQRIQRIT
FT                   DELLALMKADKNLSNTARQSAAIAKFDLASQMVTEMPELSGFMAKIYAQRAGKPPEVAQ
FT                   ALEDMEAPRSAGKSLPVTQAGAILSIADRLDQLVAMTALGITSTGSSDLFGVRRTASGL
FT                   VDILRVLPQKYDLNPIDIRVAVGKVVDIMQGYIMEHRGISNVILDGVEDSIVDLILGRW
FT                   RHRISDSQSRTLSMDTASLQNIVYAAQKTVLSEADKTFSQLCQIRQKSQFLEIVQCLKR
FT                   IDRICKNFYFERNDAPLKSVHEQNLINTFEAIRQTNCTDLEGFYRAAKNLPEAVNNFFD
FT                   NTLVMTPEEEIRTARLGLLCAIRSYSWKYAAWDYI"
     gtgcagaaac acacacccag aatgcaagac acgattctca ttcttcagac atattgggct        60
     cacagagggt gtctcgtatt tcagccgatg aatactgaag ttggtgcggg gaccgcgaac       120
     ccggcaactc tgctgggagt gctgggtgac aagacctggg gtgttgcgta tgttgagcca       180
     tgtgttagac ctgacgactc gcgctatggt ataaacccga gcagactgca gtgccacacg       240
     caattccagg ttctcctaaa acccgaacct ggcaatccgc aagagatgta cttagaaagt       300
     ctggaagcca tcggaattga ccttaaaaaa cacgatatac gttttgttga ggataactgg       360
     gaaagtcctg cattgggcgc ttggggcctt gggtgggaga tatggcttga tggacttgaa       420
     ataacccaat tcacatattt tcagcaggtt ggtggggtgc cgctaaagac aagtgcggtt       480
     gaaataacct atggaattga aagaataatg atggcccttc agaaggttag tcacttcaaa       540
     gacatagagt attcgaagaa tataagctat ggtgaattgt ttgcgcagaa cgaacgcgag       600
     atgtcagctt attacctcga gaaagcaaat atcgagagaa ataaacagct cttcgagata       660
     tattccgatg aggctaagat gcttttacgc gctggccttc ctcttcccgc atacacattt       720
     gtactgaagt gcagccacgt tttcaatatt cttgatgcaa ggggtgcaat tagcaccgct       780
     gaacgcgcga aagcgttctc actgatgcgt acactaacca aagagatttc tgctacgtgg       840
     gtcgaaagta gatcaaatgg tgaggtgagt gacgatacag tacacacaaa aggcatcgat       900
     atagcgatag aaaaaccgcc agacatgaaa gaccctgtaa caaagggccc ggaaactgtc       960
     ctgtttgaaa tcggaacaga agaaatgccc agcacacaag aaatcatcac tactgttgaa      1020
     aacacgctta gagaaaaact gggaaggtcg caacttaagt ttgagaaata tagcgtggat      1080
     gcaacgccaa gaagaattgt tatacgaatc tataaaatgc accccaggca aagtgactcg      1140
     agtgtgcgaa taagaggacc aaaggtagaa gcggcatttg atgatgataa aaaaccaaca      1200
     gatgcactaa ccgggttttt aaaagcaaat ggtaagagtc ttgacgaaat agaaattgct      1260
     gtccacaaaa acagaaggca tgtcttcata acaaaaaaca ttccaggaca gtccgcagcc      1320
     aaactccttg agcagatatt tgccgaaatc gttctagaaa tccggagttc gcggaatatg      1380
     cgctggaatg acccaaaatt ggtattctcc aggccaataa gatggcttgt tgcattgtat      1440
     ggacaaagac agcttaatgt aagggtatct ttgttggaat ccgggatgca tacgcgtgtt      1500
     ttgcgcaata gtaaaacccc tatcgtgccg gtaaaggccg ccgacaatta cgaagaattt      1560
     cttacacgaa acggtgtaat cctctccaga agcaaaagac gagaaataat ctttgaatcc      1620
     gctaatctcg ctgctaaaag tgtttcttgt gaaatcgact tttcaactca gccaattgaa      1680
     gaaataacgg atttagttga ggcgccaagt ttggtgatat gcagatttga aaaaaagtat      1740
     ttggagctgc cggaagttgt cttgaatgca attatgaaaa agcaaaagta cataacgcta      1800
     tctgaaaaat gtgcaacttg caaacgtata cagcgtgaaa aatgtgatca aaaaaccata      1860
     agtcagcact tcataacctt cgcaaatggc ctgtgcgata aagaaactgt gcgatccggg      1920
     aatgaggctg taataagaac tcgctttgaa gatgccctct tttttcagga ggcagattct      1980
     aaactgtcac ccgaaaattt gtacaaaatg cttgacggcc ttgtgtatga ggaaaaactg      2040
     ggaagctatt tgcaaaaatc acagcgcata caaaggatta cagacgagct gcttgcactt      2100
     atgaaggctg ataaaaatct ttcgaataca gcaagacaat cagcggcaat agcaaaattc      2160
     gaccttgcct cacaaatggt aaccgaaatg ccagaacttt cgggttttat ggcaaaaata      2220
     tatgcacagc gggctggaaa gccgcctgaa gtcgcacaag cgctggaaga catggaggca      2280
     cccagaagtg cgggaaaatc actgcccgta acacaagccg gtgcgatatt gtcaatcgca      2340
     gatcgcttgg atcaattagt tgcgatgacc gctctgggga taacctcaac aggcagttcg      2400
     gatctgtttg gggtaaggcg taccgcaagt ggacttgttg acattctgcg tgttttgccg      2460
     cagaagtatg atcttaatcc aattgatatt cgggttgctg ttgggaaagt tgttgacatt      2520
     atgcagggtt acattatgga gcaccgcggc ataagcaatg tgattctgga tggtgtagag      2580
     gactctattg ttgacctgat cctgggaagg tggcgacatc gcatttcaga cagtcaatca      2640
     aggactttat ccatggacac agcttccctt caaaatatcg tatatgctgc ccaaaagaca      2700
     gtactttccg aagcagataa gacattttcg caactctgtc agattagaca gaaaagtcaa      2760
     tttctggaga tagtgcagtg tttgaaacgg attgacagga tctgtaaaaa cttctatttt      2820
     gagaggaatg atgcacccct caaatctgtg cacgagcaaa acctaataaa cacatttgaa      2880
     gcgatcaggc aaacgaattg cactgatttg gaaggattct accgtgcagc aaaaaattta      2940
     ccggaagctg tgaataattt tttcgataat acgcttgtta tgactccaga agaagaaatc      3000
     cgcacggcga gactgggact attgtgtgct atacgaagct attcatggaa atatgctgct      3060
     tgggactaca tataa                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page