(data stored in ACNUC30630 zone)

EMBL: BX251410.GND

BX251410.GND         Location/Qualifiers
FT   CDS_pept        305928..307358
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="TW272"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="Similar to Escherichia coli 6-phosphogluconate
FT                   dehydrogenase, decarboxylating Gnd or b2029
FT                   SWALL:6PGD_ECOLI (SWALL:P00350) (468 aa) fasta scores: E():
FT                   1.8e-86, 49.57% id in 468 aa"
FT                   /protein_id="CAD66946.1"
FT                   /translation="MRADIGVYGLAVMGSNLARNFAGKGIRVAIHNRSSDRSNSLAQQH
FT                   SECNFIVAKDDKDFIDSLSSPRTVLLMVKAGSIVDEVIARLSTFMQPGDVIIDGGNSLY
FT                   TDTIRREEELKARGLHFIGLGVSGGEVGALEGPSLMPGGSDYAYSIVGPMLEKIAARAN
FT                   GEPCVAHIGHNGAGHFVKMVHNGIEYADMQIIAESYDLLRRGLGLSPTRISDIFREWNS
FT                   GELESYLVGVTADILSHRDKRTGKPFVDIVLDQAGAKGTGAWTAQNALDLGVPAGSVSE
FT                   AVFARSLSSDEQRCQVQQKLSRSQASSHEAPLKEAEFIDAVRNALYLAKILAYSQGFRI
FT                   ISVAAAKHDWGIDLSACARIWRAGCIIRAVFLDKVAHEYSKNPDLTSLMCSPGFSDELV
FT                   GRLRFLREVVASAARLAIPAPVFSSLLSYIDALASDRLPACLIQAQRDDFGAHTYRRVD
FT                   VPGIFHTLWSSDLSEVPA"
     gtgcgggctg atatcggtgt atatggtctt gcggttatgg gcagtaatct tgcgagaaat        60
     tttgccggca aaggtatccg ggttgctatt cataaccggt catccgacag atctaattcc       120
     ctcgcacagc agcacagtga gtgtaatttt attgttgcga aggatgataa agattttata       180
     gattcactca gttcgcccag aactgtcctt ctgatggtta aggctggatc tattgtggat       240
     gaagttatag ctcgactctc cacctttatg caaccaggag atgtgataat cgacggtggt       300
     aattctctgt acaccgatac aatcaggcgt gaggaagaac tcaaggcaag ggggttgcac       360
     tttatagggc ttggtgtttc gggcggagag gtgggcgccc tcgaaggccc cagtcttatg       420
     cccggaggat ctgattacgc ttattcgatc gttggtccta tgctcgagaa gatagccgct       480
     agggcgaatg gtgagccctg tgttgcgcac ataggtcata atggcgcggg acactttgtg       540
     aagatggtcc acaatggcat tgaatacgct gatatgcaaa taattgccga gtcttatgat       600
     cttttaagac ggggtttggg gctctctccg acgcgtatat ccgatatttt tcgtgagtgg       660
     aacagcggtg agcttgagtc gtatttagtt ggagtaacag ctgacatact ttctcataga       720
     gacaagagaa ccggaaagcc gtttgttgat attgttctcg accaggctgg tgcaaaggga       780
     accggtgctt ggacagcgca gaacgcactt gaccttggtg ttcccgccgg ttccgtgtct       840
     gaagcagttt ttgcgcgcag tctttcatcg gatgaacagc gttgccaggt gcaacagaaa       900
     ctttctagat cacaagcatc aagtcatgaa gcacccttga aggaggcgga gtttatcgat       960
     gctgtacgca atgcccttta cttggcaaag atacttgcgt actctcaggg ttttagaatt      1020
     attagtgttg cagccgccaa gcatgactgg ggcatagacc tttctgcctg tgcacgaatc      1080
     tggcgtgcgg gctgtataat ccgggcagtt tttctggata aagttgccca tgagtacagt      1140
     aagaatccgg acctcacaag tcttatgtgt tctccgggtt tttctgatga attggtaggc      1200
     aggttacggt ttttgaggga agttgttgct tctgcagccc gcctggctat tccagcacct      1260
     gttttttcat ctctcttgtc atatatcgac gcgcttgctt cagatcgctt gcctgcatgt      1320
     ctgattcagg cgcagagaga tgattttggt gcccacactt acaggcgtgt cgacgttccg      1380
     gggatttttc ataccctttg gtcatcagac ctgagcgaag tgcccgcctg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page