(data stored in ACNUC30630 zone)

EMBL: BX251410.GROS

BX251410.GROS        Location/Qualifiers
FT   CDS_pept        82958..83341
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="TW084"
FT                   /product="10 kDa chaperonin"
FT                   /note="Similar to Streptomyces coelicolor and Streptomyces
FT                   lividans 10 kDa chaperonin GroS or SCO4761 or SC6G4.39
FT                   SWALL:CH10_STRCO (SWALL:P40172) (102 aa) fasta scores: E():
FT                   3.9e-21, 68.42% id in 95 aa"
FT                   /protein_id="CAD66769.1"
FT                   /translation="MLRFGRILFSRGFLPSIDLEVLVHGRGSAVSFAIKPLGDRVVIRP
FT                   ADAEQVTASGLVIPDTAQERPQEGEVVAVGPGSLNDDGNRVPLDVSVGDRVIYARYGGT
FT                   EVKLGDDEYTILASRDVLAVVHR"
     ttgttacgct ttggtagaat attgttctcg cggggctttc tgccttcgat tgatttggaa        60
     gtcttagtac atggaagagg ttcagctgtg tcatttgcaa ttaaaccact cggcgatcgt       120
     gtagttatca gaccggccga tgcggagcag gttacagcaa gcggtttggt tattcccgat       180
     accgcgcagg agcgccctca ggagggtgaa gttgttgccg tcggtcccgg ttctcttaac       240
     gacgatggga atcgtgtccc gcttgatgtt tctgtcggcg atcgcgttat ctacgcgcgc       300
     tatggtggta ccgaggttaa actgggcgat gacgagtaca cgatcttggc ttcaagggat       360
     gtgctcgcgg ttgttcatcg gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page