(data stored in ACNUC30630 zone)

EMBL: BX251410.GUAA

BX251410.GUAA        Location/Qualifiers
FT   CDS_pept        87199..88710
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="TW089"
FT                   /product="GMP synthase [glutamine-hydrolyzing]"
FT                   /EC_number="6.3.5.2"
FT                   /note="Similar to Bacillus subtilis GMP synthase
FT                   [glutamine-hydrolyzing] GuaA SWALL:GUAA_BACSU
FT                   (SWALL:P29727) (513 aa) fasta scores: E(): 2.2e-94, 50.49%
FT                   id in 509 aa"
FT                   /db_xref="GOA:Q83ID3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83ID3"
FT                   /protein_id="CAD66774.1"
FT                   /translation="MRPVLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSP
FT                   IAIFLSGGPASAYKDNAPKLDEEIFNCGIPIFGICYGFQLLAQAFGGSVKKANAPEYGP
FT                   ADITIVNKAFFSGQPDRQTVWMSHGDSVIRAPKNFCILSTSQDAVLSFCNRDRTIAGVQ
FT                   WHPEVKHSRFGKHTIKAFLSSFAAPNWDPEQTICGTVDSIRKTVGCKRVLCALSGGVDS
FT                   VVAATLTHRAIGDRLRCVFVDHGLLRLNEREQVEEYCSSLGLNVSTYDASDCFLSALSG
FT                   IRDSEQKRKVIGREFIACFSKLQERFDIKPHFLLQGTLYPDLVESGATPGGATIKSHHN
FT                   VGGLSDNLGFELLEPLKYLFKDEVRKIGLQLGIPKHIVHRQPFPGPGLAIRIIGEVTNK
FT                   KLSILRAADAIVRHELRDWTDIWQCPVILLSDVQSVGVRGDSRSCGFPIVIRPVSSDDA
FT                   MTADWYRLPYDVLARISGRITNEIPEIVRVVLDITPKPPATIEWE"
     atgagacctg ttcttgtcgt tgattttggc tctcaatatt cgcagcttgt agtccgtgcg        60
     ataagagagt gcgggtatta tgcagagttt gcgtccccga gtatttctgc tgctgaatgt       120
     cttgccttgt ccccgattgc catatttctc tctggagggc ctgctagtgc atacaaagat       180
     aatgccccca agcttgacga agagattttt aattgtggca ttcccatttt tggcatttgc       240
     tacggctttc aactgcttgc acaggcattc ggtggatctg tcaaaaaagc aaatgctccg       300
     gaatacggcc ctgcggatat aacaattgtc aacaaggcgt ttttttctgg ccaacccgac       360
     cgccagacag tgtggatgag ccatggtgat agtgttatac gcgctcccaa aaatttttgc       420
     attctttcaa cttctcagga tgctgttctt tcattttgca accgtgatag aacaattgct       480
     ggcgtgcaat ggcacccgga agtaaagcac agccggtttg gtaaacacac aataaaagcc       540
     tttttatcaa gttttgccgc gccaaactgg gatccagaac agacaatttg tgggacagtt       600
     gacagtatcc gcaaaactgt tggttgtaag agggttttgt gtgctcttag cggaggagtt       660
     gactctgtcg ttgccgcaac actcacacac cgtgcgatag gcgataggct gcgatgtgtt       720
     tttgttgatc atggtcttct tcggttgaat gagagggagc aggttgagga gtattgttca       780
     tctcttggtc ttaatgtgtc tacttatgat gcctcagatt gttttttgag cgccctttca       840
     gggatacgtg attctgagca aaagcgtaag gtaattggtc gcgagtttat tgcctgtttt       900
     tcaaaattgc aagagcgatt tgatataaag ccgcactttc tcttacaggg cacgctttat       960
     ccggatctcg ttgaatccgg agcaaccccg ggtggcgcga ctataaaaag tcatcataat      1020
     gttggtggct tgtcggataa tcttggtttt gaattattag aaccgctgaa gtatcttttc      1080
     aaggatgaag tgcgaaaaat tggccttcaa ctcggtatac ctaagcacat agtgcacaga      1140
     cagcccttcc ctggccctgg ccttgctata agaataattg gtgaggttac aaacaagaag      1200
     ctgtctattc tgcgtgcggc cgatgcaatt gtcaggcatg agttgcgaga ctggactgat      1260
     atctggcagt gcccagttat cttactatct gacgtgcaat cagtaggcgt tcgcggagat      1320
     agtagatcat gcggctttcc gattgttatc cggcccgttt cgtctgatga tgcaatgacc      1380
     gcggattggt accgattacc atacgatgtt cttgcacgaa tttctggtcg tataacaaac      1440
     gaaattcctg aaatcgtgcg tgttgttctt gatatcacac ccaagccccc agcaacgata      1500
     gagtgggagt ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page