(data stored in ACNUC30630 zone)

EMBL: BX251410.GUAB2

BX251410.GUAB2       Location/Qualifiers
FT   CDS_pept        84872..85993
FT                   /transl_table=11
FT                   /gene="guaB2"
FT                   /locus_tag="TW086"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   inosine-5'-monophosphate dehydrogenase SCO4771 or SCD63.03
FT                   SWALL:Q9L0I6 (EMBL:AL161755) (374 aa) fasta scores: E():
FT                   7.1e-82, 58.64% id in 370 aa, and to Escherichia coli and
FT                   Escherichia coli O157:H7 inosine-5'-monophosphate
FT                   dehydrogenase GuaB or b2508 or z3772 or ecs3370
FT                   SWALL:IMDH_ECOLI (SWALL:P06981) (488 aa) fasta scores: E():
FT                   7.5e-05, 32.94% id in 170 aa"
FT                   /protein_id="CAD66771.1"
FT                   /translation="MEVGFSRNARRAFSLDEVAVVPSRRTRHSSEVSIEWKMDAFSFDT
FT                   PIISSPADSVVSPSTIVELSEFGCLGILDLEGVWTRYENPEPVLREISALPEEKACLGL
FT                   QKIYSEPIKRHLLERRLQELRDAGVIVAGCLSPQTTNALYKSVISAGVDIFVIRGGTVS
FT                   AEHVSKSDNVLNLKRFIYELDVPVMVGGVATYTAALHMMRTGAAGVLVGFGGCAGSTNH
FT                   ASLGIKVPMATAIADVAAARKDYLDESGGRYVQVIADGSMNTSGMAVNALALGADAVMM
FT                   GTPLVRSTTSPGFGYHWGREAHHMTLPRGRRAYIGQTASLQEIIQGPGHSPDGTVNFAG
FT                   AIRRAVALAGFQDLKNFQRVEMVVIQDQRRCCA"
     atggaagtcg gtttttccag aaatgccaga agagcttttt cgctcgatga agttgctgtt        60
     gttccgagca ggcgtacccg tcactctagt gaggtatcaa tcgagtggaa gatggatgct       120
     ttctcttttg acacaccgat tatttcttct ccagcggact ctgttgtctc accaagcacg       180
     attgttgaac tgtccgaatt tggctgtctt ggtattttgg atctcgaagg tgtttggaca       240
     cgttacgaga atccagaacc tgtcctgcgc gagatttctg cactgccgga ggaaaaagcg       300
     tgtcttggcc ttcagaaaat atactcggag ccaattaaac ggcacctact ggaaaggcgc       360
     ttgcaggagc ttcgcgatgc aggggtgatt gttgcaggtt gcctttctcc gcaaaccaca       420
     aatgcgcttt acaagagtgt aatctcagcg ggcgtagata tttttgtcat tcgtgggggc       480
     actgtatccg ctgaacatgt ttcaaagagt gacaatgttc taaacctgaa gaggtttata       540
     tacgagctag atgttccagt tatggtgggc ggtgttgcaa cctatactgc ggccttgcac       600
     atgatgcgca ccggcgcggc cggggttttg gtcggttttg gcggatgcgc aggatcaacg       660
     aaccatgctt cacttggaat aaaggtgcct atggcaactg caatagcaga tgttgcagcg       720
     gcaagaaaag attatttgga tgaatctgga gggcgatatg ttcaagtaat tgccgacggg       780
     agcatgaaca ccagcggtat ggctgtgaat gcattagctc tcggtgctga tgcggtaatg       840
     atgggaactc cacttgtacg ctcgacaacc tctccgggat tcgggtacca ctggggtaga       900
     gaggcccatc acatgacttt accgaggggt cgacgcgcct acatagggca aactgcctct       960
     ttgcaggaga ttatccaggg cccgggacat tccccagatg gaacggtaaa ttttgcagga      1020
     gcaattcgac gagcggttgc actggctggc tttcaagatc tgaagaattt tcagcgggtc      1080
     gagatggttg ttatacagga ccaacgacgg tgttgtgcct aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page