(data stored in ACNUC30630 zone)

EMBL: BX251410.GYRA1

BX251410.GYRA1       Location/Qualifiers
FT   CDS_pept        6438..8897
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="TW006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Streptomyces coelicolor DNA gyrase
FT                   subunit A GyrA or SCO3873 or SCH18.10c SWALL:GYRA_STRCO
FT                   (SWALL:P35885) (857 aa) fasta scores: E(): 1.8e-189, 61.26%
FT                   id in 808 aa"
FT                   /protein_id="CAD66698.1"
FT                   /translation="MSEQNINQVDLREEMQRSYLDYAMSVIIGRALPDVRDGLKPVHRR
FT                   VLYAMYKGGYRPEKAFSKCARVVGDVMGQFHPHGDAAIYDALVRLVQPWAMRYPLAQGQ
FT                   GNFGSPGNDGAAAPRYTETKMATLAIEMVRDIDEDTVDFSPNYDGESVEPTVMPCRFPN
FT                   LLVNGSVGIAVGMATNIPPHNLAEVSAGALWCLENPDATDEELTEALLERIKGPDFPTG
FT                   ATVLDTGGIKDAYLTGRGSVVMRGVVDIEEIDGRTCLVVRELPYQVNPDNLALKIASLV
FT                   KENKLSGIADIRDETSGRTGQRLIIVLKRDAVARVVLNSLYKHTQLQENFGVNMLAIVD
FT                   GAPRTLSLCSFIRLWVEHQIEVIVRRTTFRLARAEQRAHILRAYLRALDQIDEVIQLIR
FT                   SSKSAEEAQSNLMALLKIDETQARAILDLQLRRLAALERQRIISEAREIEELISSFRKI
FT                   LSDKTAQCQVIAEELREIGQKHSDARRTEIIRGFDGSVSIEDLIPVEPVVVVMTRCGYI
FT                   KRTRIDQYRSQHRGGRGVKGAQVKADDVVLQFISTTTHNWLMFFTNTGRVYRAKAYEVP
FT                   EASREARGQHVANLLPLKPNEAVTRILSVSNFDSEDTSLVLATKDGYVKKTTLKEYDTS
FT                   LSTGVIAIKLRPGDKLVSAVLARSDQDIILVTKNARSLRFKSGTLRPLSRGSYGVKGIS
FT                   LRENDLLLSAELILSDDSYIFVVSERGYAKRSRVGDYKLQARGGIGVRVANITEQKGVL
FT                   ADMLVVNDDDEVLVILASGKVIRSSVAEVSPTLRYTTGVVFVRMSDGDKILAMTIAEKC
FT                   DDLEGQG"
     ttgtctgagc aaaatattaa ccaagtagat cttcgcgagg agatgcagcg gtcgtatctc        60
     gactacgcca tgagcgttat aatcggtcgt gccttacccg acgtccggga tggtcttaag       120
     cccgtacatc gcagggtttt gtacgcgatg tacaaagggg gttatagacc agaaaaggct       180
     ttttcaaaat gtgccagggt tgtcggcgat gttatgggtc aatttcatcc tcatggggat       240
     gcggcaattt atgacgcact tgtccgtctt gtgcagccgt gggccatgcg ctatccgctt       300
     gcgcagggcc aggggaactt tggctctccg ggcaatgatg gcgctgccgc ccctcgttac       360
     acagaaacga aaatggccac actcgcgatt gagatggtca gggatattga tgaggatact       420
     gttgattttt ccccaaatta tgatggcgaa agcgttgaac ccacagttat gccgtgccgc       480
     tttcccaatc ttttggttaa tggctcagtc ggtattgcgg ttggtatggc aaccaatatc       540
     ccgccgcata accttgccga ggtgtcggcc ggtgctctgt ggtgcctcga aaatccggat       600
     gcaacagatg aggagttgac agaagctctt ctggaaagaa taaaaggtcc cgattttccc       660
     accggtgcta cggtgttgga caccggaggc ataaaagacg cctatctcac gggccgcggc       720
     agcgtggtta tgcgaggcgt tgttgatatt gaagaaatag acggaaggac ctgccttgtt       780
     gtgcgcgaac ttccttatca agtcaatccg gataatttgg ctttaaagat agcctctctc       840
     gttaaggaaa ataaactttc gggaattgct gatattcggg atgaaacaag cggtagaacc       900
     ggccagcggt tgataatcgt cctcaagcga gatgctgtcg ctcgggtggt tctgaatagc       960
     ctatacaaac atacacagct tcaagagaac tttggggtca atatgcttgc gattgttgac      1020
     ggggcaccca gaaccctttc cctctgttcg ttcattcgtt tatgggttga acaccaaata      1080
     gaagtcatcg tccggcgcac taccttcagg cttgccaggg ccgagcagcg cgcgcatatt      1140
     ctcagggcct atctaagggc tctggaccag atcgacgagg ttatacagct cattcgatct      1200
     tctaagagcg ccgaggaggc tcagtctaac cttatggcgc tcctgaaaat agacgaaaca      1260
     caggctcgtg caatccttga tcttcagttg cggcgccttg ccgccctcga gcgacaaagg      1320
     attatctctg aggcaagaga aatagaagag ctaatatcca gcttcaggaa gattctttct      1380
     gacaagaccg cccagtgcca ggttattgca gaagaattga gggaaatagg tcaaaaacac      1440
     tcagacgcac gacgcacaga aataattcgg gggtttgatg ggtcggtgtc tattgaagac      1500
     ctgattccgg tggaacctgt agttgttgtt atgacccgct gtggttatat aaaacgaaca      1560
     cgtattgatc agtataggtc tcaacatagg ggtggtcgcg gcgtaaaagg cgcccaagtt      1620
     aaggctgatg atgtcgtgct gcagtttatc tctacaacaa cacacaactg gctcatgttt      1680
     tttaccaata cagggagggt ttatcgcgca aaagcctatg aagtcccgga ggcaagcagg      1740
     gaggctcgtg gtcagcatgt tgcaaatctt cttccgctaa aaccgaatga ggcggtgacc      1800
     aggattttat ctgtctctaa ttttgatagc gaggatacaa gccttgtttt ggccactaaa      1860
     gatggatatg tgaaaaaaac aacccttaaa gagtacgata catcgcttag cactggtgtt      1920
     atagcaataa agcttcggcc cggagataag cttgtatctg cagtgcttgc aagaagtgat      1980
     caggacatca tactggttac aaaaaatgcc agatcgctca ggtttaaatc cggtacattg      2040
     cgccccttat ctaggggatc atacggcgta aagggtatat ctcttcgcga aaacgatctc      2100
     cttctttcag ctgagctgat tctttcggac gacagctata tatttgttgt cagcgagagg      2160
     ggttatgcaa agcgctctag ggttggtgat tacaaacttc aggcccgggg cgggattggc      2220
     gtacgggttg caaacataac cgagcaaaag ggcgtacttg ctgacatgct cgttgtcaat      2280
     gacgatgatg aggttcttgt aattcttgca agcggtaagg ttattcgctc atctgttgcc      2340
     gaggtctccc caactcttcg atatactacc ggggtcgttt ttgtccgcat gtctgacggg      2400
     gataaaattc tggccatgac gatagcagag aaatgcgatg acctggaagg gcaggggtga      2460
//

If you have problems or comments...

PBIL Back to PBIL home page