(data stored in ACNUC30630 zone)

EMBL: BX251410.GYRB2

BX251410.GYRB2       Location/Qualifiers
FT   CDS_pept        301377..303365
FT                   /transl_table=11
FT                   /gene="gyrB2"
FT                   /locus_tag="TW268"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Streptomyces sphaeroides DNA gyrase
FT                   subunit B, novobiocin-sensitive GyrBS SWALL:GYBS_STRSH
FT                   (SWALL:P50075) (684 aa) fasta scores: E(): 1.7e-98, 43% id
FT                   in 665 aa"
FT                   /protein_id="CAD66944.1"
FT                   /translation="MSSNTDYNADDIALLEGLAAVRKRPGMYIGSTDNHGLAHCLWEII
FT                   DNSVDEVLAGFGNVVNITLHGDNSFSVQDFGRGIPVDIESKTGLTGVELVFTKLHAGGK
FT                   FGTGAYFTSGGLHGVGASVVNALSEKLSVEVDRDGMTWVMEFRNQVTSGLRSKCKIASN
FT                   VTGTRVRFWPDPLIFGSAEICIESLHQRAMQTAFLVPGLRVNIEDRVLGKSSSYLFEGG
FT                   CKQFVEHLSAGELITDVLCIRGKGSFSEAVPVLKETGNLVISSVERVCDVDIALAWRND
FT                   FETHINSFVNVIETPKGGTHYSGFEQALLKTIRNAVSSQSRYLKSGNNRPEREDVFSGL
FT                   TAVVSVKLPEPQFEGQTKEVLGTPAVKGIVANIVADNLQKLFEDPKYKTQIRRVLEKVV
FT                   AQMHFRLAARASRETQRRKNALETSSLPAKLVDCRSNDVNESELFIVEGDSALGTARRA
FT                   RNSEYQALLPIRGKILNVQKASVADALANAECASIIQVIGAGSGSNFDIAQARYGKVII
FT                   MSDADVDGAHIRILLLTLFFRYMQPMISSGRVFSALPPLHRVVVKNSNEKIYTRSDREL
FT                   EMVLSRLKQEGLEHREPIQRYKGLGEMDADQLAETTMDRSKRTLLRIRMSDAQQASDIF
FT                   ALLMGNDVAPRREFIANSVVSTDRIDS"
     ttgtcgagta atactgatta taacgccgat gacattgccc tactagaggg cttggctgct        60
     gttcgtaaac ggcctggaat gtacataggc tcaaccgaca atcacggctt ggcccattgt       120
     ctgtgggaaa taatcgataa ttctgtggat gaggttttag ctggatttgg caatgttgtg       180
     aacattacct tgcatggcga taacagtttt tctgttcagg attttggccg agggatacct       240
     gttgatattg aaagcaagac gggcctaacg ggtgttgagt tggtttttac aaagcttcat       300
     gcgggcggaa agtttggcac aggagcgtat ttcacatcgg gtggattgca tggtgttggt       360
     gcgagtgttg taaatgccct ttccgaaaag ctctctgttg aggttgacag agatggaatg       420
     acatgggtaa tggaatttcg taaccaagtg acatctggcc ttcgatctaa gtgtaaaatc       480
     gctagtaatg taacgggaac acgggtgcgt ttttggcctg atccgcttat ttttggtagt       540
     gcagaaatct gtattgagtc tttgcatcag cgcgcgatgc aaactgcctt tttagttcca       600
     ggcctcaggg tgaatattga agatagggtg cttggcaaga gctcttccta tctctttgag       660
     ggcggttgca aacaatttgt agagcatctt tccgcaggag agctgattac agatgtcttg       720
     tgtattagag gtaaaggtag tttttctgag gcggttcccg ttttgaaaga gacgggtaac       780
     cttgttatca gctcagttga gcgggtgtgt gatgttgata ttgctcttgc gtggcgtaat       840
     gattttgaaa ctcatatcaa tagctttgta aatgtgatcg aaaccccgaa gggcggaacc       900
     cattattctg gttttgagca ggctcttttg aagactattc gaaacgcagt gtcaagtcaa       960
     tctaggtatt tgaagtctgg caataaccgc cccgaacgcg aagatgtttt ttcgggactg      1020
     accgctgtgg tatccgtaaa attgcccgaa ccgcaatttg aaggccagac caaggaagtg      1080
     ctgggaacac ccgcggtgaa aggcatagtt gcaaatatcg tggcagataa tcttcaaaaa      1140
     ctttttgaag atccaaaata caaaacccag atccggcgtg tcttagaaaa agttgttgca      1200
     caaatgcact ttcggttagc cgcacgggct agtagggaga ctcagagacg taagaatgca      1260
     cttgaaactt cgagtttacc cgcaaaactt gtggattgtc gaagcaatga tgttaacgaa      1320
     agcgaactgt ttattgttga gggagattct gccctcggca ctgctcgcag ggccagaaat      1380
     agcgagtacc aggcacttct gccaattcga gggaaaatcc taaacgtaca aaaggcgagt      1440
     gtagccgatg cacttgctaa tgccgaatgt gcaagtatta ttcaagtgat tggtgccgga      1500
     tctggaagta actttgatat agcacaggca cgctatggca aggtgataat aatgtctgat      1560
     gctgatgtgg atggtgctca cattaggatt ctgttgctaa ccttattttt caggtatatg      1620
     cagccgatga tttcatccgg ccgtgtcttt tcagcccttc ctccgttaca tcgggtggtg      1680
     gttaaaaaca gcaatgagaa gatctacacc agatcagatc gtgagctaga aatggttttg      1740
     tcaagactga aacaggaggg gcttgaacat agggagccga ttcagagata caagggcctt      1800
     ggtgagatgg atgccgatca acttgcagag acaactatgg acagatcaaa gcgtaccctt      1860
     cttaggatta ggatgtctga tgcccaacag gcttcagaca tttttgcgct ccttatgggg      1920
     aatgatgtcg caccacgcag ggagttcata gcaaattccg tggttagcac tgacagaata      1980
     gacagctaa                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page